https://nicecrew.tv/about/instance/homehttps://nicecrew.tv/videos/browse?scope=localhttps://nicecrew.tv/homehttps://nicecrew.tv/w/gSoiMVLudmbFLEUteZ5Sx9https://nicecrew.tv/lazy-static/thumbnails/03670bde-68b2-4437-a99c-3d7ba520930c.jpgSaleel SawarimSaleel Sawarimhttps://nicecrew.tv/static/streaming-playlists/hls/808203f2-ffcf-4037-8c4a-ac57c6829726/74aa9482-6c61-419f-9b97-70cfd4387b09-master.m3u8https://nicecrew.tv/videos/embed/gSoiMVLudmbFLEUteZ5Sx91835122023-11-06T00:46:56.092ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/mvGVDH4gmGSkF84SykPnqRhttps://nicecrew.tv/lazy-static/thumbnails/feb33d83-2ccb-4d50-a2e5-5058304011ba.jpgDracula Flow 3Dracula Flow 3https://nicecrew.tv/static/streaming-playlists/hls/a61c903e-d269-403a-879f-a53e2539441d/715ba94f-3a82-4c55-b3c9-b7d6b86fa7fa-master.m3u8https://nicecrew.tv/videos/embed/mvGVDH4gmGSkF84SykPnqR2325452023-11-06T01:14:06.668ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/ve7VMWHdmF4BJMyCAwpPmYhttps://nicecrew.tv/lazy-static/thumbnails/ee5eb66c-ea63-4a3a-ab59-88343488add6.jpgNaming The JewsNaming The Jewshttps://nicecrew.tv/static/streaming-playlists/hls/ecadf597-7bcf-480b-a64d-6dbbbb9ba514/74338d13-5de7-403c-be46-62ae899dfe42-master.m3u8https://nicecrew.tv/videos/embed/ve7VMWHdmF4BJMyCAwpPmY5780182023-11-07T01:26:26.109ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/ofbqmzN51ug9zsbC9ZMvouhttps://nicecrew.tv/lazy-static/thumbnails/8977f97b-8ec5-4e2c-bdd7-fb16d0cf59c3.jpgThe Ride Is OverEverything is spiraling out of control and things are unsustainable by design. We are in the age of data harvesting/analytics. It seems like the goal is to destroy the US Dollar as the world reserve currency. We already have inflation now, and it is going to get much, much worse. Americans are projected to run out of savings by January 2024 according to a report just released by the Federal Reserve Bank of San Fransisco. Food and utilities are up 20 percent, and gas is up 40 percent in some places. The average cost of a new car is up 8 percent from just last year. The cost of living has simply become too expensive. American credit card debt is over $1 trillion dollars for the first time in history. Interest rates have gone up so most folks are paying around 20 percent interest on these credit cards. The US government has accumulated over $33 trillion in debt that it can’t pay back. The debt has been accelerating at an alarming rate – they have been printing money and the printer can no longer go burrrrrrrr. The government is spending more than they have coming in, so they have to borrow and they have to pay interest on that. We are going to be paying more on debt than defense in the next decade. If you know how much we spend on defense that should make you sick. Right now, on social media, people are being manipulated, nudged, and steered down a primrose path laid out and planned for them in dark rooms by men in suits decades ago. I am reminded of the quote from Cormac McCarthy’s Blood Meridian, from the epigraph. It’s from the French poet Paul Valéry, taken from the 1895 essay “Le Yalou,” about the atrocities of the Sino-French war. It was about the inability of the West to see their own culture for what it really was. A clash is seemingly being set up, a clash of civilizations – so the elites can bring forward order out of chaos. Music Credit: Secrets of the Carnival by Erik M Music Link: https://youtu.be/UYODOfLu7bE?si=hEg36qTwZ...https://nicecrew.tv/static/streaming-playlists/hls/b423e282-26b9-4c7a-839d-de7f148306c4/2b706061-de4a-4358-adca-4ec2349c5144-master.m3u8https://nicecrew.tv/videos/embed/ofbqmzN51ug9zsbC9ZMvou3135162023-11-08T21:34:57.928ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/bDZBk1iKEL76gbK4yPah5Ehttps://nicecrew.tv/lazy-static/thumbnails/f6663fd7-af4b-427c-b8a2-13554062af63.jpgFrontlines-RobloxShort clip I made for lols.https://nicecrew.tv/static/streaming-playlists/hls/564968b1-76f4-4c81-a5ae-ea5b488182e6/03c7ae3c-3f7e-4dce-abe8-16537e92bd6b-master.m3u8https://nicecrew.tv/videos/embed/bDZBk1iKEL76gbK4yPah5E6365142023-11-09T02:38:53.861ZYESMain omega_variant channelNOhttps://nicecrew.tv/w/o3hd6xsCLJF6SbAwaxaK2shttps://nicecrew.tv/lazy-static/thumbnails/17e2e5f9-c60e-45b0-871f-fd4ae9cee1b7.jpgDog WhistleDog Whistlehttps://nicecrew.tv/static/streaming-playlists/hls/b27a86e4-e228-450a-ad9b-9d34e35082d8/7cc321f1-2b99-475f-9e2f-8f68ddbed772-master.m3u8https://nicecrew.tv/videos/embed/o3hd6xsCLJF6SbAwaxaK2s595132023-11-11T17:32:49.828ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/iPAwvKuiqgSKikkKumxuXChttps://nicecrew.tv/lazy-static/thumbnails/ad9a843c-5b22-4da2-987a-2a4b4d4261bb.jpgThe mighty naked shotgun man vs a .338 Lapua.I love Tarkov. Nothing like hitting a bare naked man with a .338 Lapua Magnum...https://nicecrew.tv/static/streaming-playlists/hls/90509784-8217-4513-a4f8-fe375380d762/88cbd780-4363-4b37-93f4-7f2d0f613fc6-master.m3u8https://nicecrew.tv/videos/embed/iPAwvKuiqgSKikkKumxuXC3052023-11-11T20:38:25.829ZYESMain coffee channelNOhttps://nicecrew.tv/w/wTKsyANxjxM5tYAGSMVfunhttps://nicecrew.tv/lazy-static/thumbnails/8619d811-2042-4c16-89b7-b0107e130f6c.jpgMassive New FBI Headquarters in Maryland...The Federal Bureau of Investigation (FBI) has secured approval for a jaw-dropping $300 million sprawling new headquarters in Maryland, in a move that has ignited concerns about the unchecked expansion of government surveillance. From the days of J. Edgar Hoover and his notorious political blackmail files to the present, the FBI has been no stranger to controversy and intrigue. The shadows of the past loom large, reminding us of a history marked by abuse of power and political maneuvering. Now, as the agency gears up for a headquarters twice the size of the Pentagon and bigger than the Kremlin in Moscow3, questions about the extent of government reach and potential abuses of power become more pressing than ever... Donate to Documentary: https://www.kandkfilm.com/donatehttps://nicecrew.tv/static/streaming-playlists/hls/fa2bdfbe-0551-4dd0-a4e6-09802029aabd/fc0f7f4c-da99-4796-a967-acedf7bb72c5-master.m3u8https://nicecrew.tv/videos/embed/wTKsyANxjxM5tYAGSMVfun16255372023-11-11T21:36:35.062ZFBIHeadquartersMarylandWhitmer HoaxPentagonYESRadix Verum ☦NOhttps://nicecrew.tv/w/b14cbdc4ahap9NCL6pG2mFhttps://nicecrew.tv/lazy-static/thumbnails/e3d2337d-6d6e-477c-b1cb-d0f5c219d6ae.jpgGive 'em The SauceGive 'em The Saucehttps://nicecrew.tv/static/streaming-playlists/hls/50fd5aaa-9213-4569-97af-20fe36340fa3/ab13dce3-b1eb-46b8-b11e-700c4081ee81-master.m3u8https://nicecrew.tv/videos/embed/b14cbdc4ahap9NCL6pG2mF48022023-11-12T16:20:17.772ZYESGamingNOhttps://nicecrew.tv/w/vG6oTCQzkDDL54yda4GJLYhttps://nicecrew.tv/lazy-static/thumbnails/573a7ab7-ad91-40e1-974f-05c2e67ae0f5.jpgNo no.No no.https://nicecrew.tv/static/streaming-playlists/hls/f07218b5-53a2-4d0a-ac94-3a235e768028/272eb753-c41f-4019-868c-fecc4a8220a0-master.m3u8https://nicecrew.tv/videos/embed/vG6oTCQzkDDL54yda4GJLY11042023-11-12T16:19:41.556ZYESGamingNOhttps://nicecrew.tv/w/mDSTRof79HYo8C8FNhwAbVhttps://nicecrew.tv/lazy-static/thumbnails/1d20ea8e-35ba-4859-a13a-fc6c17d2c793.jpgGet Out of My Hill!Get Out of My Hill!https://nicecrew.tv/static/streaming-playlists/hls/a740a83f-f1fc-4d08-9328-f2ce65e3e4f1/9b23fc6b-997b-40ac-a7c6-666e9c2cda02-master.m3u8https://nicecrew.tv/videos/embed/mDSTRof79HYo8C8FNhwAbV19022023-11-12T16:38:13.698Zgears of warYESGamingNOhttps://nicecrew.tv/w/nDZJGZs3FyAJtJM8qv7Ewghttps://nicecrew.tv/lazy-static/thumbnails/7e6071f5-dad5-4784-ab23-46731c79f912.jpgSlayer GateNot for those with motion sickness.https://nicecrew.tv/static/streaming-playlists/hls/af5e033b-4347-43a8-8bb5-a3b94070dd33/5320350d-8805-41e4-b0f2-bad7b669cc08-master.m3u8https://nicecrew.tv/videos/embed/nDZJGZs3FyAJtJM8qv7Ewg2430112023-11-12T16:40:51.678Zdoomdoom eternalYESGamingNOhttps://nicecrew.tv/w/92EYx34FWcSeDDhXWZzMqjhttps://nicecrew.tv/lazy-static/thumbnails/4b0da650-2160-4e98-a7cb-4a7fb76abd02.jpgDefending The HillDefending the hill better than our government defends our borders.https://nicecrew.tv/static/streaming-playlists/hls/4104df41-34e0-4e54-af6f-c940721a070e/5fcdf583-18b8-465e-982e-3fd8a81cd0c9-master.m3u8https://nicecrew.tv/videos/embed/92EYx34FWcSeDDhXWZzMqj52022023-11-12T16:44:31.774Zgears of warYESGamingNOhttps://nicecrew.tv/w/pNLwGwm4ZPiCkPJkt36Hamhttps://nicecrew.tv/lazy-static/thumbnails/b8977a2d-3a3f-42e3-b2f1-9b9230cc6994.jpgJust Stop ThinkingI realized the best way to win at the game was to stop thinking about how to play.https://nicecrew.tv/static/streaming-playlists/hls/c0c9d841-6b3e-41ff-b9d1-bf7018a6766a/747a6dbe-0020-469f-884a-2f5a57350247-master.m3u8https://nicecrew.tv/videos/embed/pNLwGwm4ZPiCkPJkt36Ham42062023-11-12T16:54:40.573Zhalo infiniteYESGamingNOhttps://nicecrew.tv/w/jDqe7hQFsgWT3G8h7wGcm4https://nicecrew.tv/lazy-static/thumbnails/58ca7c9e-f6a2-4808-ab09-4085ab432583.jpgPeter Nygard, Former Bill Gates Business Partner & Canadian Fashion Mogul, Found GUILTY in Toronto!"Former Canadian fashion executive Peter Nygard has been found guilty of four out of five counts of sexual assault for attacking women at his Toronto office building. Nygard—who is most famous for founding Nygard International, a women’s apparel company—reportedly showed little emotion as the Toronto jury’s verdict was read. He was also found not guilty of one count of forcible confinement. Five women testified during the six-week trial that Nygard attacked and assaulted them between the late 1980s to 2005 in his private bedroom suite. Four of the women were in their 20s, while one was 16 at the time." - DB Nygard faces additional charges in Manitoba, Quebec, and the United States. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/https://nicecrew.tv/static/streaming-playlists/hls/96fdf1f7-2891-473d-bd72-a781ed986a77/8753638a-c6b8-4fe8-a52a-a6829d8a7258-master.m3u8https://nicecrew.tv/videos/embed/jDqe7hQFsgWT3G8h7wGcm42143572023-11-12T23:20:12.418ZNygardPeter NygardBill GatesPrince AndrewSex TraffickingYESRadix Verum ☦NOhttps://nicecrew.tv/w/42zjg7zp3YpQ9hxg8jdtJYhttps://nicecrew.tv/lazy-static/thumbnails/d9d6777d-c349-482c-8e91-eb9210988977.jpgIt's So Over BrosIt's So Over Broshttps://nicecrew.tv/static/streaming-playlists/hls/1883b0d4-dd6e-4ca1-9337-a7e395eee428/d649989a-cae9-4ca8-83ae-e52f34a1644a-master.m3u8https://nicecrew.tv/videos/embed/42zjg7zp3YpQ9hxg8jdtJY15032023-11-13T18:50:06.372ZYESGamingNOhttps://nicecrew.tv/w/21xzgcNTSytoRpGoU471czhttps://nicecrew.tv/lazy-static/thumbnails/aef9c23f-fc9d-471a-b720-a13520bcae43.jpgKIDNAP and KILL: An FBI Terror Plot | OFFICAL TRAILEROn October 8, 2020, the FBI announced the arrest of thirteen men who were allegedly “attempting to formulate a plan to kidnap Michigan Governor Gretchen Whitmer” and “otherwise use violence to overthrow the state government.” This event, dubbed the “Whitmer Fednapping Hoax” was astroturfed by every mainstream media outlet as proof that individuals they consider “far-right” are dangerous domestic terrorists. The FBI used a network of at least 12 informants and 2 undercover agents to create a domestic terror plot that never materialized. This documentary will dive deep into the anatomy of the FBI's most recent frame job and shed a light on the corruption plaguing federal law enforcement. ------------------------------------- This film can only happen with your support! FUNDRAISER LINK http://www.kandkfilm.com ------------------------------------- https://twitter.com/KandKFilm media inquiries: contact@kandkfilm.com (c) Digging Deeper, LLChttps://nicecrew.tv/static/streaming-playlists/hls/082c98b4-f9f6-4866-957e-7a7e10dfd9bf/6c3e75dc-7d66-4006-b80c-8b2e9ed345da-master.m3u8https://nicecrew.tv/videos/embed/21xzgcNTSytoRpGoU471cz131502023-11-13T19:06:02.221ZFBIWhitmerKidnapping PlotFednappingMichiganYESRadix Verum ☦NOhttps://nicecrew.tv/w/vpRwd4ZCPbQaAgXki74mx9https://nicecrew.tv/lazy-static/thumbnails/a42b2dfd-2cb0-48ec-839a-45f313120853.jpgNo Charges Filed After Brutal Lynching of White Teen by Mob of 15 Black TeensA White student at a Las Vegas High School has died from his injuries, days after he fell victim to a targeted beatdown by up to 15 non-White students, according to Police. The brutal attack—which was recorded and passed around social media—has so far not resulted in any criminal charges and has since been referred to as a modern-day “lynching.” Jonathan Lewis Jr, the victim, was critically injured after attempting to help a smaller friend, after being punched, kicked, and beaten while on the ground by a mob of teens. He was found unconscious and bleeding from the head before being transported to the University Medical Center where he later passed away. Please pray for his family. https://nicecrew.tv/static/streaming-playlists/hls/ee2da569-c0b0-40b2-abf6-18a5ba637996/6c994cb2-0ecb-4fb1-bba6-afe400ccf682-master.m3u8https://nicecrew.tv/videos/embed/vpRwd4ZCPbQaAgXki74mx910235112023-11-13T20:36:18.910ZJonathan LewisMurderCrimeLas VegasDiversityYESRadix Verum ☦NOhttps://nicecrew.tv/w/uZbpsP9Hb9YjcMwrkK2WMyhttps://nicecrew.tv/lazy-static/thumbnails/2f8174e8-2dda-45bf-b2c6-01a081921818.jpgOdysee For Sale, Omegle Shutting Down, YouTube Dying...My rambling thoughts on this concerning situation...https://nicecrew.tv/static/streaming-playlists/hls/eabbb07b-7e5c-468e-a27f-6e6d777760e2/14b1dbca-a0c6-448f-9ed6-8d6dfa7b1f6f-master.m3u8https://nicecrew.tv/videos/embed/uZbpsP9Hb9YjcMwrkK2WMy22990232023-11-14T02:40:14.321ZOdyseeOmegleYouTubeInternetAlt TechYESRadix Verum ☦NOhttps://nicecrew.tv/w/ujY1EEqFwGrK2TLF2vX8QAhttps://nicecrew.tv/lazy-static/thumbnails/ae0757b6-fc7e-4485-8fc6-05e92c70ee5f.jpgThe Glass Eyes of Jeffrey Epstein & Jimmy SavileIn this video, I discuss disgraced "financier" and sex trafficker Jeffrey Epstein's glass eye collection that he had framed and mounted in the entranceway to his New York Townhouse in "row upon row." Elite child sex predator Jimmy Savile also had a glass eye he stole from the corpse of a victim which he had turned into a ring and then a necklace. Is there a deeper meaning to the glass eyes? What do you guys think?https://nicecrew.tv/static/streaming-playlists/hls/e565c9e4-e201-46f6-9625-7da2102718c6/c1e4c2e8-2188-4343-a3db-639575c05a7c-master.m3u8https://nicecrew.tv/videos/embed/ujY1EEqFwGrK2TLF2vX8QA8090102023-11-14T17:38:19.242ZEpsteinJeffrey EpsteinJimmy SavileGlass EyesSymbolismYESRadix Verum ☦NOhttps://nicecrew.tv/w/cDSm9oCJqDZ8ggpTChkkFwhttps://nicecrew.tv/lazy-static/thumbnails/074bd63f-c87b-42dc-a124-a2fadd5396c2.jpgMaytag top load Washer Fix - No control panel response - F5E1 Error Code - Door LatchReed switch in the electromechanical latching and sensor unit gets internally corroded easy. You can replace the switch, or just bypass it, making the washer think that the lid is always closed.https://nicecrew.tv/static/streaming-playlists/hls/5e5e1288-1b18-4ae9-a990-bc6de093a858/27ed22ab-1ec2-4eaf-bdb5-0a30054ecc33-master.m3u8https://nicecrew.tv/videos/embed/cDSm9oCJqDZ8ggpTChkkFw2475872023-11-16T02:24:06.252ZYESBrother TylerNOhttps://nicecrew.tv/w/kyH2GdGjpx77hwMRWuyvSnhttps://nicecrew.tv/lazy-static/thumbnails/3bbe5929-d1fc-4fee-a22b-5677823c63a9.jpgBrap NasheedBrap Nasheedhttps://nicecrew.tv/static/streaming-playlists/hls/9e6eb866-f2d3-48e4-9022-f4eeeff86bbd/2a13c7e0-f99c-473b-a40a-1a526487f9f0-master.m3u8https://nicecrew.tv/videos/embed/kyH2GdGjpx77hwMRWuyvSn125372023-11-17T01:18:02.120ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/fkm9q8QmL2vR28XMqbACiehttps://nicecrew.tv/lazy-static/thumbnails/f0e6ec42-6331-4ddb-8d07-c79dc903b2a4.jpgSalvationWhat the King James Bible has to say about salvation. What Should I Know? Acknowledge Sin. Romans 3:23 For all have sinned, and come short of the glory of God; Realize the Penalty for Sin. Death & Hell. Romans 6:23 For the wages of sin is death; but the gift of God is eternal life through Jesus Christ our Lord. Revelation 21:8 But the fearful, and unbelieving, and the abominable, and murderers, and whoremongers, and sorcerers, and idolaters, and all liars, shall have their part in the lake which burneth with fire and brimstone: which is the second death. Admit Sin. 1 John 1:8 If we say that we have no sin, we deceive ourselves, and the truth is not in us.; Understand Jesus Christ Died for You! John 3:16 For God so loved the world, that he gave his only begotten Son, that whosoever believeth in him should not perish, but have everlasting life. 1 Peter 2:24 Who his own self bare our sins in his own body on the tree, that we, being dead to sins, should live unto righteousness: by whose stripes ye were healed. 1 Timothy 3:16 And without controversy great is the mystery of godliness: God was manifest in the flesh, justified in the Spirit, seen of angels, preached unto the Gentiles, believed on in the world, received up into glory. Believe for Salvation. Romans 10:9-11 9 That if thou shalt confess with thy mouth the Lord Jesus, and shalt believe in thine heart that God hath raised him from the dead, thou shalt be saved. 10 For with the heart man believeth unto righteousness; and with the mouth confession is made unto salvation. 11 For the scripture saith, Whosoever believeth on him shall not be ashamed. Saved by Faith. Not of Works! Ephesians 2:8-9 8 For by grace are ye saved through faith; and that not of yourselves: it is the gift of God: 9 Not of works, lest any man should boast. How do I know I'm saved? 1 John 5:10-13 10 He that believeth on the Son of God hath the witness in himself: he that believeth not God hath ma...https://nicecrew.tv/static/streaming-playlists/hls/74137cdc-0546-4237-83dc-b171ee3397a7/b7e28508-3e1c-45a0-a0fd-e6c9d494e833-master.m3u8https://nicecrew.tv/videos/embed/fkm9q8QmL2vR28XMqbACie38951902023-11-17T05:37:00.561ZYESBrother TylerNOhttps://nicecrew.tv/w/tRWofXACMkqaenqD7iYswShttps://nicecrew.tv/lazy-static/thumbnails/429750a7-634e-4384-aa8d-50ddaf912fa9.jpgThyme & Place - Nuke The Space WhalesHere's my latest single, hope you enjoy. < 3 Free download of Nuke The Space Whales here: https://thymeandplace.bandcamp.com/track/nuke-the-space-whaleshttps://nicecrew.tv/static/streaming-playlists/hls/e19fb427-b32a-460b-bc35-a76b87009376/4e23e5b8-7fd0-4c57-aa5d-d19d38783a6d-master.m3u8https://nicecrew.tv/videos/embed/tRWofXACMkqaenqD7iYswS143542023-11-17T13:14:53.465ZmusicsynthwaveYESThyme & PlaceNOhttps://nicecrew.tv/w/6EpKqjEwa1jan3TBSJhM3Zhttps://nicecrew.tv/lazy-static/thumbnails/a508d209-3ba7-4828-8bab-66ab4f091d5d.jpgThe Grandiosity and Lies of Prince Andrew ꟾ Extended VersionWe talk about the narcissistic lies of Prince Andrew, former Duke of York. We discuss the renewed calls for him to speak to the FBI after this third pedophile friend was convicted of child sex crimes, Peter Nygard. This comes on the heels of the Jeffrey Epstein scandal and the conviction of Ghislaine Maxwell.https://nicecrew.tv/static/streaming-playlists/hls/2dda9797-d3d3-43ed-8921-58a1f81ffaa1/19608638-2c99-4451-8fbf-857458b42e6a-master.m3u8https://nicecrew.tv/videos/embed/6EpKqjEwa1jan3TBSJhM3Z3099592023-11-17T18:21:57.664ZPrince AndrewJeffrey EpsteinSex TraffickingBlackmailGhislaine MaxwellYESRadix Verum ☦NOhttps://nicecrew.tv/w/2iTL5PzqCH2cVKjxJ3J1HYhttps://nicecrew.tv/lazy-static/thumbnails/0e337734-64d7-4d0d-acef-718f4a0d1efa.jpgHow to install a PL259 UHF solder-crimp type RF connecter onto RG-58A/U 50 ohm coaxial cable.You'll need some tools as pictured, but it takes less than 5 minutes to actually put on a connector.https://nicecrew.tv/static/streaming-playlists/hls/0a98ae57-16e0-4095-8deb-449ad5c8ea32/29ded369-659b-48da-8eab-2b0d2daef7cd-master.m3u8https://nicecrew.tv/videos/embed/2iTL5PzqCH2cVKjxJ3J1HY572022023-11-18T00:44:32.470ZYESBrother TylerNOhttps://nicecrew.tv/w/hPAjie4z6q7PmHuYSu3cHuhttps://nicecrew.tv/lazy-static/thumbnails/6a306679-86f1-4f2c-9884-5c157aecadea.jpgR290 (propane) in lieu of R12/R22/R134aIf you do this don't blame me if the epa decides to ruby ridge you because of the racket that's refrigerant.https://nicecrew.tv/static/streaming-playlists/hls/883752ca-c7d9-484a-a2e9-2e338a72b642/b75864a6-a3a3-480f-a30a-f57949c2c4ff-master.m3u8https://nicecrew.tv/videos/embed/hPAjie4z6q7PmHuYSu3cHu8815192023-11-18T05:42:26.282ZYESBrother TylerNOhttps://nicecrew.tv/w/r8CcEzPKba62hc7eZtBhBahttps://nicecrew.tv/lazy-static/thumbnails/7eeee919-8740-405d-9200-ebfab052c72b.jpgHunter Call of the Wild- Kill compilation 1A few kills I got, nothing impressive or cool just displaying the game and the views.https://nicecrew.tv/static/streaming-playlists/hls/cb84fb8d-5753-4855-907a-f26279b9363f/6e78ee26-8d21-4094-b83d-6185365bd467-master.m3u8https://nicecrew.tv/videos/embed/r8CcEzPKba62hc7eZtBhBa496042023-11-18T12:08:33.304ZYESMain omega_variant channelNOhttps://nicecrew.tv/w/jjZwyRcdHRG2bJAA42BuJwhttps://nicecrew.tv/lazy-static/thumbnails/ced25ce8-cb3c-4dd1-91a4-8c307ecab155.jpgBeaners in GoWBeaners in GoWhttps://nicecrew.tv/static/streaming-playlists/hls/946b5605-33ed-489b-8f22-7179c9b4f67a/6aa97480-3d7d-47af-a1ae-84c1f199787d-master.m3u8https://nicecrew.tv/videos/embed/jjZwyRcdHRG2bJAA42BuJw35062023-11-18T15:07:34.736ZYESGamingNOhttps://nicecrew.tv/w/tgpb3G4dwZRDJYSPENGeWvhttps://nicecrew.tv/lazy-static/thumbnails/8f05adea-e837-4196-84fb-168993cd61cf.jpgDracula Flow 4Dracula Flow 4https://nicecrew.tv/static/streaming-playlists/hls/dccd2e6e-43dc-4734-a825-9d82727996cd/f472c4bc-f5e6-4b66-8767-18b7712588a4-master.m3u8https://nicecrew.tv/videos/embed/tgpb3G4dwZRDJYSPENGeWv6105782023-12-02T06:40:28.991ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/sr8Wk3deWGDF17N32BPN1Qhttps://nicecrew.tv/lazy-static/thumbnails/1d9d41fb-495f-49d6-a24a-bb77fea5d3aa.jpgGRRRRR Y DO U STILL BELIEVE IN JESUSGRRRRR Y DO U STILL BELIEVE IN JESUShttps://nicecrew.tv/static/streaming-playlists/hls/d610172f-aab5-44e8-ae79-c337d1602250/70187207-83fc-492a-b9d5-64a734c44ae3-master.m3u8https://nicecrew.tv/videos/embed/sr8Wk3deWGDF17N32BPN1Q960342023-12-02T16:04:31.678ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/2jjFa1gxn1X9wbGSbi6zEJhttps://nicecrew.tv/lazy-static/thumbnails/5443dcbe-c1fe-4295-8aa7-d64bdc82f6de.jpgFBI & BOP Hit? Derek Chauvin Stabbed 22 Times by "Former" FBI InformantJohn Turscak, a 52-year-old former Mexican Mafia FBI snitch, has been charged with attempted murder for stabbing former Minneapolis police officer Derek Chauvin in a federal prison in Tucson. The complaint says Turscak attacked Chauvin inside the law library at the Federal Correctional Institution in Tucson, Arizona. Chauvin should have been protected as a high profile political prisoner. https://nicecrew.tv/static/streaming-playlists/hls/0aa80913-7a57-4488-927c-d4e62a28fe02/ac39544b-d818-4160-8b6a-b4b5e78d412c-master.m3u8https://nicecrew.tv/videos/embed/2jjFa1gxn1X9wbGSbi6zEJ20535632023-12-04T17:40:44.326Zderek chauvingeorge floydFBI informantBOPsaint floydYESRadix Verum ☦NOhttps://nicecrew.tv/w/j3UEVDGGzKAUzhYyjieM1Lhttps://nicecrew.tv/lazy-static/thumbnails/178c8454-830f-4b5c-9086-dd0961961cb7.jpgGrand Theft Auto VI TrailerReleased 12/04/2023https://nicecrew.tv/static/streaming-playlists/hls/922c7172-5c45-41b8-865e-07972b1914d8/3f298ab1-e8f3-430c-b652-930e6fe70f57-master.m3u8https://nicecrew.tv/videos/embed/j3UEVDGGzKAUzhYyjieM1L900262023-12-05T00:15:29.877ZYESGamingNOhttps://nicecrew.tv/w/p9XTj317n1f65be1e58Yc1https://nicecrew.tv/lazy-static/thumbnails/e738e8ed-2719-4dc9-b177-e15dc604380a.jpgWhitmer Kidnapping Plot Hoax Inmates to Remain in Out-of-State GulagsIn October, Mich. Judge Thomas Wilson demanded answers from prosecutors about why the men convicted on state charges of assisting the Gov. Gretchen Whitmer kidnap plot were transferred to federal prisons outside of Michigan—where they’re unable to regularly communicate with their attorneys or review records for their pending appeals. This is clearly political and done with the intentional design to destroy their chances of being able to appeal because they know all this will be overturned and these men will be released and sent home. https://nicecrew.tv/static/streaming-playlists/hls/bb829459-9948-4527-b8e0-2b039c290556/8793f55d-bc98-401c-b291-ed3ee412abf5-master.m3u8https://nicecrew.tv/videos/embed/p9XTj317n1f65be1e58Yc16565112023-12-06T21:20:30.412Zmichiganwhitmerpaul bellarjoe morrisonpete musicoYESRadix Verum ☦NOhttps://nicecrew.tv/w/5gtuHyZjSznF8NftyRCvQAhttps://nicecrew.tv/lazy-static/thumbnails/ea1c1818-0c1d-49c8-adeb-a82040b84026.jpgMist Survival major update: Exploring the new (to me) area-LiveMist Survival major update: Exploring the new (to me) area-Livehttps://nicecrew.tv/static/streaming-playlists/hls/228da7d9-229b-4013-ba60-10ad90ebbd86/cdbe5788-d41a-4db4-8812-630e308bc9e5-master.m3u8https://nicecrew.tv/videos/embed/5gtuHyZjSznF8NftyRCvQA33410162023-12-08T12:12:12.714ZYESMain omega_variant channelNOhttps://nicecrew.tv/w/vmAEJNjzGFU2xb5WghxEVHhttps://nicecrew.tv/lazy-static/thumbnails/4bfb7bc4-b54d-4694-a6c8-4bfa12c0f136.jpgThe Dissolution of Destiny and Melina's "Open Marriage"Streaming couple Destiny and Melina Göransson are planning to divorce after flaunting their "open" marriage publicly for years. Destiny is an almost 35-year-old man who is known for his obnoxious personality and progressive views. Melina is a decade younger than him and a Swedish influencer. Both Göransson and Destiny are also "bisexual" and extremely online. According to Destiny's fans on his subreddit, the streamer revealed that he was done with Göransson after she fell for an abusive guy. "I'll have a small convo when I'm back about things, I'm not gonna 'nuke' Melina or anything, but the last two months (and two weeks) have been a massive mindf*ck for me, watching her become obsessed with a toxic/abusive guy (when I visited Sweden last, he gave Mel an ultimatum to divorce me and then threatened to yeet himself when she didn't do it, among 20 other abusive/manipulative things he's done) and endlessly make excuses for him, so I'm out," a screenshot of a Discord message showed. The divorce rumors come after Göransson has reportedly been in Sweden for six months due to a trial, frequently streaming with a man who goes by Memetix.https://nicecrew.tv/static/streaming-playlists/hls/edb942ea-64a9-48f6-880d-4e9232c67f3b/08dbe635-6b33-4ca3-8259-078ff5f0ba4f-master.m3u8https://nicecrew.tv/videos/embed/vmAEJNjzGFU2xb5WghxEVH26615182023-12-08T20:59:34.249Zdestinymelinaopen marriagestoxic relationshipsstreamersYESRadix Verum ☦NOhttps://nicecrew.tv/w/2vVYencDVp5UZzaFXj7z1ehttps://nicecrew.tv/lazy-static/thumbnails/d1f23067-1fa8-4fca-83b5-c5a70c15cc3c.jpgYaesu SP-10 Speaker UpgradeReplacing the stock crappy speaker the external ham radio speaker cabinet comes with, upgrading to a CE65W-8 from Dayton Audio. Sounds considerably better than stock.https://nicecrew.tv/static/streaming-playlists/hls/0c46f7c6-56ae-49c9-8c92-b526dc8c3c61/277ccfbd-15e4-43f0-8f6d-47343c5edb98-master.m3u8https://nicecrew.tv/videos/embed/2vVYencDVp5UZzaFXj7z1e8660262023-12-11T05:06:09.021ZhamradioYESBrother TylerNOhttps://nicecrew.tv/w/3xz7iACZGwpaGupqCtQn8ihttps://nicecrew.tv/lazy-static/thumbnails/e47e10b2-fab1-4a81-ba77-b33ac7c3b04c.jpgEuropa - The Last BattleEuropa - The Last Battlehttps://nicecrew.tv/static/streaming-playlists/hls/149abcf6-a621-4e8b-8209-50509e85d7cb/38a09428-8830-4300-8ca0-c6ef466f37cb-master.m3u8https://nicecrew.tv/videos/embed/3xz7iACZGwpaGupqCtQn8i4317406932023-12-12T02:11:41.536ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/givV7eKN8uG4vaN2YRLbTrhttps://nicecrew.tv/lazy-static/thumbnails/8b02aae9-4782-411e-96c8-3e91456d32bf.jpgAdolf Hitler - The Greatest Story Never ToldAdolf Hitler - The Greatest Story Never Toldhttps://nicecrew.tv/static/streaming-playlists/hls/7beb2900-684e-4263-b6d5-f27e3050f93f/36a778aa-e0e6-4f19-b805-035878fe6baa-master.m3u8https://nicecrew.tv/videos/embed/givV7eKN8uG4vaN2YRLbTr2353451112023-12-12T01:51:04.917ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/btXgdEU7tMvehUfrJJKeE2https://nicecrew.tv/lazy-static/thumbnails/6f427023-ebca-4d6c-9d02-8c7743ae36bf.jpgCawadooty MW2 Remastereduwu don't shoot me there senpai *blushes*https://nicecrew.tv/static/streaming-playlists/hls/54e28669-6b72-40db-987a-3a7385695849/128edffe-6354-4a96-be79-33677951eb8d-master.m3u8https://nicecrew.tv/videos/embed/btXgdEU7tMvehUfrJJKeE228215532023-12-12T03:58:15.899ZYESGamingNOhttps://nicecrew.tv/w/3h3ipKndD6LXnELMximtSDhttps://nicecrew.tv/lazy-static/thumbnails/7a11db51-fcf6-4c42-afa1-c1130cba4536.jpgLawsuit: Facebook and Instagram Enabled Child TraffickingFacebook and Instagram display s*xual content to minors and serve as a “marketplace for predators in search of children,” according to a lawsuit brought against the platforms’ parent company, Meta, by the state of New Mexico’s attorney general. Filed on Tuesday, the suit alleges that underage users of both platforms – who can sign up without age verification – are shown adverts linking to adult p*rn sites and directed to accounts posting “images of s*xual intercourse and s*xualized images of minors,” even when the child has expressed no interest in this content. Join me as we go over the lawsuit. Links: https://archive.is/Ulnqr https://www.nmag.gov/attorney-general-raul-torrez-files-lawsuit-against-meta-platforms-and-mark-zuckerberg-to-protect-children-from-sexual-abuse-and-human-trafficking/ https://www.nmag.gov/wp-content/uploads/2023/12/2023-12-05-NM-v.-Meta-et-al.-COMPLAINT-REDACTED.pdf https://about.fb.com/news/2023/12/default-end-to-end-encryption-on-messenger/ https://www.theguardian.com/technology/2017/may/04/facebook-content-moderators-ptsd-psychological-dangershttps://nicecrew.tv/static/streaming-playlists/hls/126f985c-c707-4a47-a005-b097a7aef115/9f6a1a27-2775-4ae0-b76f-48c425669d90-master.m3u8https://nicecrew.tv/videos/embed/3h3ipKndD6LXnELMximtSD5381562023-12-13T18:59:38.298Zinstagrammetafacebookpedophileschild traffickingYESRadix Verum ☦NOhttps://nicecrew.tv/w/tGaorNrK188QVpQWDpaqi2https://nicecrew.tv/lazy-static/thumbnails/8e109f21-7409-4642-871a-8ce5c0ab9b05.jpgWomen, we need to be less prideful.We are going to be talking about pride and women being too prideful. Oxford defines pride as "the quality of having an excessively high opinion of oneself or one's own importance.” In ancient Greek, hubris referred to "outrage": actions that violated natural order, or which shamed and humiliated the victim, sometimes for the pleasure or gratification of the abuser. While pride and hubris are connected, they are two different things. Now pride is a complex emotion, and it isn’t bad on its own. We all take pride in our work at times and in our families and children. But there is a huge difference between Godly confidence and pride. Remember that pride is a sin. In relationships, the manifestation of pride can lead to resistance, hindering the growth of love and understanding. I wanted to talk about how particularly it may contribute to women being resistant to men during moments of anger. Whether it stems from a desire to assert independence, fear of vulnerability, or a need to protect oneself emotionally, this resistance may hinder the development of a deep and meaningful connection. Pride is that resistance to submission to a man or to God’s will. Unfortunately, society is selling women liberalism as “freedom,” and devaluing and degrading yourself as “empowerment.” “She’s a strong independent woman who don’t need no man,” – is the prideful attitude so many women have been indoctrinated with, and yet - It’s estimated that 45% of women ages 25–44 will be single and childless by 2030, according to a study by Morgan Stanley. Proverbs 31:10-31: "Who can find a virtuous woman? for her price is far above rubies..." Proverbs 31:26: "She openeth her mouth with wisdom, and in her tongue is the law of kindness." Proverbs 31:30: "Favour is deceitful, and beauty is vain: but a woman that feareth the Lord, she shall be praised." Women need to start enforcing these standards on themselves and other women. If you have a friend and you hear her smea...https://nicecrew.tv/static/streaming-playlists/hls/e0424790-b2d7-4521-afcf-d5eeacd9a1b3/a46c5b70-9347-44fc-a086-293c701bfcf6-master.m3u8https://nicecrew.tv/videos/embed/tGaorNrK188QVpQWDpaqi211795802023-12-13T20:36:45.670ZwomenprideredpilldatingrelationshipsYESRadix Verum ☦NOhttps://nicecrew.tv/w/13oVXzU8wdWvabUvQMVd5chttps://nicecrew.tv/lazy-static/thumbnails/2cf8717b-1638-4fde-91cd-3a3cda707441.jpgDebt SlaveryDebt Slaveryhttps://nicecrew.tv/static/streaming-playlists/hls/00559e6c-ed4a-47a1-af24-b66356fcb1fb/a38a779d-df9b-432c-bde0-58ecdd49f202-master.m3u8https://nicecrew.tv/videos/embed/13oVXzU8wdWvabUvQMVd5c2115102023-12-14T00:47:59.528ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/maFx9xVPcg17kEtJdLAdB6https://nicecrew.tv/lazy-static/thumbnails/bd8d70f8-e204-4f1c-a906-72b129a2fdc9.jpgCowadooty MW2: Electric Boogalootime to play CIA simulator again https://nicecrew.tv/static/streaming-playlists/hls/a350d52a-f76b-426b-b17b-4790b8b63f33/04c65874-da4d-4d33-a1b9-43246b05bc66-master.m3u8https://nicecrew.tv/videos/embed/maFx9xVPcg17kEtJdLAdB619210342023-12-14T02:53:04.349ZYESGamingNOhttps://nicecrew.tv/w/qXFvcNELffvovgoRLhLavhhttps://nicecrew.tv/lazy-static/thumbnails/991e746b-68d7-454e-91d3-b1c3ea953e53.jpgVivek Ramaswamy Calls Whitmer Hoax "Entrapment" on CNN & The FBI Charges my Friend.I am so pleased that Vivek brought attention to the FBI's Governor Gretchen Whitmer "kidnapping plot" hoax! I was also very happy to see him mention federal involvement on the infamous day in January 2021. It is important for the CNN audience to be exposed to facts and truth. The government finally replied to Adam Fox & Barry Croft's Appeals Briefs. The FBI announced they are charging my friend the journalist Steve Baker for doing journalism on that infamous day. https://nicecrew.tv/static/streaming-playlists/hls/ca219480-ec41-4984-9005-55830713fe86/6daa970d-bb51-443f-acb5-df5b3627a93c-master.m3u8https://nicecrew.tv/videos/embed/qXFvcNELffvovgoRLhLavh1832572023-12-14T22:14:49.006ZVivekWhitmer HoaxEntrapmentFBIJanuary 6YESRadix Verum ☦NOhttps://nicecrew.tv/w/r4DoPXreWX9CKrgd2qgcEhhttps://nicecrew.tv/lazy-static/thumbnails/0aec4093-1048-4114-ae83-671c47ca4dd4.jpgUkranian Deputy Blows Himself UpA Ukrainian deputy uses three grenades (maybe flashbangs) to blow up (or flashbang) a village council meeting in the Zakarpattia region.https://nicecrew.tv/static/streaming-playlists/hls/caf6be0e-d007-4100-86f5-9681ec3bf030/cbefea4a-d3cd-437a-bec9-d94530f49c5d-master.m3u8https://nicecrew.tv/videos/embed/r4DoPXreWX9CKrgd2qgcEh330902023-12-15T15:21:30.781ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/idwfdndTty15eH5owzHdkhhttps://nicecrew.tv/lazy-static/thumbnails/ee0327b1-064e-4572-b11a-01a3d799018e.jpgThe FBI's Favorite Pedophile Informant - No Jail for FeloniesPedophile FBI Informant Steve “Robey” Robeson, Key Architect of the Governor Gretchen Whitmer Kidnap Plot, Pleads Guilty to Felony Theft in Another Sweetheart Deal: A confidential informant (CHS) at the heart of the FBI’s sprawling Gretchen Whitmer “kidnap plot” case has just pleaded guilty to felony theft and has once again received NO jail time and NO probation despite having a lengthy criminal record including prior felonies and convictions for things like having sex with a child 16 or over, sexual assault, fraud, bail jumping, and a slew of other crimes. Robeson has paid a fine of $528.00 and that is it. link to article: https://radixverum.substack.com/p/pedophile-fbi-informant-steve-robeyhttps://nicecrew.tv/static/streaming-playlists/hls/8b6aebf0-6d6d-4517-b49f-02350e7368c6/0e2acc85-5e91-4336-ac9f-503dbf4dfb0e-master.m3u8https://nicecrew.tv/videos/embed/idwfdndTty15eH5owzHdkh28825282023-12-17T18:56:05.541ZSteve RobesonWhitmer Kidnap PlotFBIChild PredatorsFednapping YESRadix Verum ☦NOhttps://nicecrew.tv/w/hpXDBqzm24iZwMaSfJEqKJhttps://nicecrew.tv/lazy-static/thumbnails/cc992efc-4829-43f8-96f8-d62b7be8d30e.jpgFT-991A ATU Repair and Fan replacementThe (Automatic) Antenna Tuner Unit has a manufacturing defect, that there is laquer covering the bonding pads of the board, and also there's paint that covers parts of the case where a good RF bond is needed. This causes the Standing Wave Ratio during transmit to be dangerously high when the tuner is in use. The solution is to improve the RF bonding of the top and bottom case covers, and the pads of the ATU. The fan was replaced because it was loud. It was replaced with a magnetic bearing one from DigiKey.https://nicecrew.tv/static/streaming-playlists/hls/84ea9eae-a8c5-45d8-b24d-4627c83f4698/5568c2ca-1c4f-4859-be6f-a4f02aa73433-master.m3u8https://nicecrew.tv/videos/embed/hpXDBqzm24iZwMaSfJEqKJ4595272023-12-17T22:06:13.365ZelectronicshamradioYESBrother TylerNOhttps://nicecrew.tv/w/cFR6REVJQrMUCVXJKjSuShhttps://nicecrew.tv/lazy-static/thumbnails/a1192dae-9da3-4512-8eda-a63b40b58a09.jpgGerman TV MDR Covers DNA Contamination in Pfizer's mRNA VaccineOriginal Twitter thread [here](https://twitter.com/_aussie17/status/1734886856838582489?s=19). https://nicecrew.tv/static/streaming-playlists/hls/5ea4cab5-fa3d-4707-a0d9-cc5392dcd124/b6ef3086-17fe-4654-a02a-2c6815a724d5-master.m3u8https://nicecrew.tv/videos/embed/cFR6REVJQrMUCVXJKjSuSh6865182023-12-18T16:22:51.617ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/u82MJzhifD69gBfwCPUeLDhttps://nicecrew.tv/lazy-static/thumbnails/6794528e-90a9-4d66-9f30-a7d88b939915.jpgSam Altman is not your friend.Join me for a deep dive into Sam Altman. We cover how he commercialized OpenAI, we talk about Worldcoin, his dystopian eyeball scanning protocol and crypto currency that involves UBI and biometrics for verification. Altman recently attended the Annual Bilderberg Meeting. Worldcoin's "world ID" reminds me of Ghislaine Maxwell's "Terra Mar Project" which aimed to create digital ID's to be a "global citizen of the oceans." Sources: https://twitter.com/sama/status/1451203161029427208 https://twitter.com/nullagent/status/1451228747189800960 https://twitter.com/AaronRDay/status/1641121073398792209 https://twitter.com/mishadavinci/status/1645094220343181313 https://twitter.com/kerikukral/status/1652636737162600449 https://twitter.com/Chad_GPT_DAO/status/1658143533193199618 https://twitter.com/kepano/status/1685378433617207296 https://twitter.com/SovereignHRZN/status/1640373676775288834 https://twitter.com/sashayanshin/status/1683494363186307072 https://twitter.com/SkallasTown/status/1734700542947975611 https://twitter.com/FaceLikeTheSun/status/1734631308242964642 https://archive.is/CGj2c https://worldcoin.org/blog/announcements/introducing-world-id-2.0 https://read.cash/@Unity/biometrics-is-a-security-hole-on-the-worldcoin-crypto-project-c9cabecf https://reclaimthenet.org/worldcoin-integrates-with-reddit-telegram-and-more https://www.treehugger.com/terramar-project-launches-to-celebrate-and-protect-the-worlds-oceans-4862102 https://www.businessinsider.com/ghislaine-maxwell-terramar-project-charity-jeffrey-epstin-2019-7https://nicecrew.tv/static/streaming-playlists/hls/e3bb30ea-cfc5-4976-91e3-377a1b800501/6c606a72-99e8-4316-8e7e-fbe924f40ed8-master.m3u8https://nicecrew.tv/videos/embed/u82MJzhifD69gBfwCPUeLD399852012023-12-18T21:53:31.595Zsam altmanopenaiworldcointerramarsilicon valleyYESRadix Verum ☦NOhttps://nicecrew.tv/w/ubuuMBE4LvpdqvERqicegihttps://nicecrew.tv/lazy-static/thumbnails/d574cabe-9d71-4773-b36f-4ef210ea711d.jpgSoundInvestigations PornHub/MindGeek StingThe usual suspects doing usual suspect things. Original thread on Twitter can be found [here](https://x.com/SoundInvestig/status/1735340115969384827). From [Andy Ngo](https://twitter.com/MrAndyNgo) on Twitter: "SoundInvestigations did an undercover sting on PornHub. One leftist employee discusses how important it is for kids as young as 12 to access their content. He says that fetish, trans genres can be slipped in to groom others into developing an attraction."https://nicecrew.tv/static/streaming-playlists/hls/e436e1b4-753d-4d5a-8c40-053c2f3b9953/c36b268e-2177-404e-a6f1-fecdff5ddf5d-master.m3u8https://nicecrew.tv/videos/embed/ubuuMBE4LvpdqvERqicegi4600202023-12-18T23:54:54.023ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/pRuqFKWhhR9TTqHKn4QB2Ahttps://nicecrew.tv/lazy-static/thumbnails/d31ecc08-274d-43ba-95d8-754eee6bac6b.jpgThe Not So "Chosen" PeopleAn entry level redpill to international jewry.https://nicecrew.tv/static/streaming-playlists/hls/c12b26dd-5e9a-48e1-926d-cf70e45c3e58/e3b6bf41-7ac1-424a-983f-30adca8afdb5-master.m3u8https://nicecrew.tv/videos/embed/pRuqFKWhhR9TTqHKn4QB2A6505692023-12-20T00:08:54.244ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/vwGD3A3LptgGvMGh3vTAGwhttps://nicecrew.tv/lazy-static/thumbnails/d289ebdd-31e6-4cf1-9e2c-d87b73d5bd0e.jpgA rambling rant on gatekeeping.I felt the need to do another rant lol sorryhttps://nicecrew.tv/static/streaming-playlists/hls/ef2260f4-58f1-4f54-8b09-bd0d8d73d2fe/ab34a8b1-0e6c-4dff-bbcb-dc959facd405-master.m3u8https://nicecrew.tv/videos/embed/vwGD3A3LptgGvMGh3vTAGw186851712023-12-20T22:18:10.123Zgatekeepingcontrolled oppositiondistractionspsyopsalt mediaYESRadix Verum ☦NOhttps://nicecrew.tv/w/bfoBjVrDwN1pAswET5dzH9https://nicecrew.tv/lazy-static/thumbnails/1ef146d2-9204-4bc3-a623-0f1312e4bb81.jpgDangers of Pornography and the Grace of GodDangers of Pornography and the Grace of Godhttps://nicecrew.tv/static/streaming-playlists/hls/52fdbb93-4940-47e3-8a30-221601762a76/709b3efa-6263-462f-a032-85f53040b628-master.m3u8https://nicecrew.tv/videos/embed/bfoBjVrDwN1pAswET5dzH9215652292023-12-26T08:14:08.026ZpreachingbaptistsermonbiblekjvYESBrother TylerNOhttps://nicecrew.tv/w/sxvHup91dd5iHzAQibBTwLhttps://nicecrew.tv/lazy-static/thumbnails/d01d4a54-dde0-4a01-9c44-c7777dfcc2de.jpgWhitmer Kidnap Inmates Sue MDOC - Who is listening in to Legal Calls?Two men convicted in the 2020 conspiracy to kidnap Michigan’s Gov. Gretchen Whitmer have sued the MDOC for being placed in out-of-state federal prisons, where their ability to communicate with lawyers or prepare their appeals has effectively been eliminated. The men—Joe Morrison and Paul Bellar—are all incarcerated in federal prisons outside of Michigan, despite the fact that they were convicted of state crimes. Pete Musico is in a similar situation, but his lawyer hasn’t joined the lawsuit. In the lawsuit, Morrison and Bellar’s attorneys detailed how they haven’t been able to communicate with their clients. Their lawyers note that a "third party" is listening in to all privileged attorney/client phone calls - GEE, I wonder who that could be? See Headline USA article by Ken Silva and documents posted by Eric VonDussen. https://headlineusa.com/whitmer-kidnap-inmates-sue-michigan-over-constitutional-rights-violations/ https://www.documentcloud.org/documents/24245230-joseph-morrison-paul-bellar-v-mdoc-et-al-verified-complaint-writ-of-mandamous-and-request-for-declaratory-and-injunctive-relief-12-21-23 https://www.documentcloud.org/documents/24245231-joseph-morrison-paul-bellar-v-mdoc-et-al-brief-in-support-of-motion-for-order-to-show-cause-for-why-a-preliminary-injunction-should-not-enter-12-21-23https://nicecrew.tv/static/streaming-playlists/hls/d6f3f989-b99d-4b9c-b38c-7ba8ce920adc/42852d1b-8150-40a1-ac29-7416e6ba4c69-master.m3u8https://nicecrew.tv/videos/embed/sxvHup91dd5iHzAQibBTwL1198582023-12-28T23:43:11.158Zmichiganwhitmerpaul bellarjoe morrisonkidnap plotYESRadix Verum ☦NOhttps://nicecrew.tv/w/6nwbzJB3Hvx1Ve9v6eaqyxhttps://nicecrew.tv/lazy-static/thumbnails/d2159bf0-3ed4-4254-8da6-c3e4ef226899.jpgJudges Chapter 1Judges Chapter 1https://nicecrew.tv/static/streaming-playlists/hls/2b7ee9be-57d5-4af4-94d8-55da5c494457/04debe97-10ad-4096-9396-2c40458703f9-master.m3u8https://nicecrew.tv/videos/embed/6nwbzJB3Hvx1Ve9v6eaqyx383042024-01-01T23:48:48.148ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/64j8qNyLXH2w4vxDXaTR8Ahttps://nicecrew.tv/lazy-static/thumbnails/8558a5af-4b69-48d5-803c-d65981e3b893.jpgJudges Chapter 2Judges Chapter 2https://nicecrew.tv/static/streaming-playlists/hls/28f418af-57a6-44e6-8245-639ff8d31e44/7b09bdae-9586-44fd-b423-48c60b9a5e9c-master.m3u8https://nicecrew.tv/videos/embed/64j8qNyLXH2w4vxDXaTR8A252002024-01-02T00:29:06.108ZbiblekjvYESAudio BibleNOhttps://nicecrew.tv/w/wLHD5JETEskARDkESKCjPyhttps://nicecrew.tv/lazy-static/thumbnails/6103546c-f8a7-4803-90e1-ad0342aaf175.jpgWhitmer & Husband Cry "Threats" in Latest Ploy for Sympathy as Fednapping Hoax CollapsesOn January 2, 2024, Michigan Governor Gretchen Whitmer and her husband Dr. Marc Mallory did a sit-down interview with Michigan public broadcasting TV. They blamed her husband's early retirement on "threats" they received in the form of "crank calls" during the "kidnap plot" trial. Meanwhile, the families of the men who were targeted and victimized were disarmed, doxed, and had no private security detail let alone a team of federal, state, and local law enforcement assisting them. Whitmer must have forgotten the interview she did a year before where she and her husband blamed "covid" for his early retirement. https://www.fox2detroit.com/news/michigans-first-gentleman-says-he-retired-from-dental-practice-early-due-to-threats-at-time-of-kidnap-trialhttps://nicecrew.tv/static/streaming-playlists/hls/f9308bfd-4f6a-4bc6-89d6-7756606d83de/71b4c232-050f-44b3-b2a8-32d41a3aed5c-master.m3u8https://nicecrew.tv/videos/embed/wLHD5JETEskARDkESKCjPy1161542024-01-04T21:48:23.309Zwhitmermichiganfednappingkidnap plotfbiYESRadix Verum ☦NOhttps://nicecrew.tv/w/vE8NVJNi4QxydtW1hmDE8ahttps://nicecrew.tv/lazy-static/thumbnails/8e8cc204-7892-427b-9d8e-af7fbc089dbf.jpgJudges Chapter 3Judges Chapter 3https://nicecrew.tv/static/streaming-playlists/hls/f02c18cf-6a33-450d-a13f-802284551dff/4bb149e1-5089-4a02-b515-e622c94dcf0a-master.m3u8https://nicecrew.tv/videos/embed/vE8NVJNi4QxydtW1hmDE8a335002024-01-05T21:06:16.479ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/233Y243darryXH4eZPRnrAhttps://nicecrew.tv/lazy-static/thumbnails/c848d3c0-ffc5-406c-a48c-6dce2443664a.jpgJudges Chapter 4Judges Chapter 4https://nicecrew.tv/static/streaming-playlists/hls/08627436-92a6-4553-a4f7-d06f422539b8/c08c63bb-984a-43cb-a0b1-22b084033fc1-master.m3u8https://nicecrew.tv/videos/embed/233Y243darryXH4eZPRnrA285002024-01-05T21:06:44.592ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/w32LRkDa14ScmWSRLNYC9Thttps://nicecrew.tv/lazy-static/thumbnails/9912e60b-833c-44c5-a9e5-27dbd8be264d.jpgJudges Chapter 5Judges Chapter 5https://nicecrew.tv/static/streaming-playlists/hls/f33abd7b-92d0-46af-aa00-6bf3ff4bcd73/429cb2ff-1d9a-453d-bf16-c08b14dbd3da-master.m3u8https://nicecrew.tv/videos/embed/w32LRkDa14ScmWSRLNYC9T307002024-01-05T21:07:18.875ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/g385NPpCjGHpKXr2eisRjDhttps://nicecrew.tv/lazy-static/thumbnails/7ca41c7d-fcd9-4d4d-b879-c014c664dd95.jpgJudges Chapter 6Judges Chapter 6https://nicecrew.tv/static/streaming-playlists/hls/79c4eeb3-2aff-4b9a-9aab-9dff071f6d1d/2339cea6-a380-4b7c-b9e0-d9bb83a87d45-master.m3u8https://nicecrew.tv/videos/embed/g385NPpCjGHpKXr2eisRjD424002024-01-05T21:08:03.979ZkjvBibleYESAudio BibleNOhttps://nicecrew.tv/w/gCudc9ZYJtDyyNLsfCz5Juhttps://nicecrew.tv/lazy-static/thumbnails/bfbf4ec9-1171-4509-961f-aed01c1295c9.jpgJudges Chapter 7Judges Chapter 7https://nicecrew.tv/static/streaming-playlists/hls/7e913da3-d3aa-4648-a854-d7f34cfbd8d8/2f578e94-df01-407c-8458-81cbe7d16add-master.m3u8https://nicecrew.tv/videos/embed/gCudc9ZYJtDyyNLsfCz5Ju330002024-01-05T21:09:25.768ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/hnELiYLk7EMLXDCZgYUJ2ohttps://nicecrew.tv/lazy-static/thumbnails/70d0f289-4314-4ef1-869a-b5ac1a8eec71.jpgJudges Chapter 8Judges Chapter 8https://nicecrew.tv/static/streaming-playlists/hls/8498ba14-4ac1-4029-8c09-178d65f40978/5f75f805-0007-417f-ad13-3c8c587441d8-master.m3u8https://nicecrew.tv/videos/embed/hnELiYLk7EMLXDCZgYUJ2o337002024-01-05T21:10:03.083ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/i19a8CUkngVR7DD6bAW2Dhhttps://nicecrew.tv/lazy-static/thumbnails/86307d5f-7c39-42e0-bb9f-c33d32f3225b.jpgJudges Chapter 9Judges Chapter 9https://nicecrew.tv/static/streaming-playlists/hls/89b06269-8043-4d4b-a5c5-858e310bef26/93e96e4c-b1f0-401f-bdcb-55c8d8e7deec-master.m3u8https://nicecrew.tv/videos/embed/i19a8CUkngVR7DD6bAW2Dh543012024-01-05T21:10:48.195ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/wiVV8LWBY3CJeDuom8LB1Whttps://nicecrew.tv/lazy-static/thumbnails/f4f9cc07-26ab-47de-a86b-0af8b5ce0c91.jpgJudges Chapter 10Judges Chapter 10https://nicecrew.tv/static/streaming-playlists/hls/f57307e7-10a9-4e19-b320-c772cefe8572/105d4c48-b729-4f28-ad9a-3f4612b9a47d-master.m3u8https://nicecrew.tv/videos/embed/wiVV8LWBY3CJeDuom8LB1W175012024-01-05T21:10:34.738ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/44bwwsSdTXfq4MzVGpvnPdhttps://nicecrew.tv/lazy-static/thumbnails/d1babdf0-b67e-476c-aec9-755c3768e50e.jpgJudges Chapter 11Judges Chapter 11https://nicecrew.tv/static/streaming-playlists/hls/18bd2264-d3c2-4baf-95de-0925462be35e/ec7f99e3-edca-4b50-8a5b-26cdbf4f0675-master.m3u8https://nicecrew.tv/videos/embed/44bwwsSdTXfq4MzVGpvnPd416002024-01-07T01:16:08.741ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/kap6oESZe6bonufjVatrMThttps://nicecrew.tv/lazy-static/thumbnails/15b1a6e1-5671-4639-8656-13702c21eee4.jpgJudges Chapter 12Judges Chapter 12https://nicecrew.tv/static/streaming-playlists/hls/9b2d8f5c-6252-41dd-9c32-3ed5fdfcde51/7a1bc454-534c-4699-83a3-aaf154d01d65-master.m3u8https://nicecrew.tv/videos/embed/kap6oESZe6bonufjVatrMT160002024-01-07T01:18:05.289ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/p88X19vCU2XNVXJkKseUj4https://nicecrew.tv/lazy-static/thumbnails/3fea5e90-fc9b-4690-a4f9-a12f91359d68.jpgJudges Chapter 13Judges Chapter 13https://nicecrew.tv/static/streaming-playlists/hls/bb414b3c-bf2f-4f2e-a392-f8ab3d59c1af/ddbdb53d-f1c2-44a4-a90d-de7da14497fb-master.m3u8https://nicecrew.tv/videos/embed/p88X19vCU2XNVXJkKseUj4242002024-01-07T01:19:14.255ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/7QxuoafKwzf91r3aerGajuhttps://nicecrew.tv/lazy-static/thumbnails/3577ff36-12b3-4769-8784-0ecc85ad4ac6.jpgJudges Chapter 14Judges Chapter 14https://nicecrew.tv/static/streaming-playlists/hls/375df05c-fc1e-4321-9bdd-693f4cec76a4/f9ff49c1-e18b-4831-969e-711c7b58ece6-master.m3u8https://nicecrew.tv/videos/embed/7QxuoafKwzf91r3aerGaju227002024-01-07T01:19:51.330ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/i4mZQmHoerixtmZcov3Z9khttps://nicecrew.tv/lazy-static/thumbnails/ceb7c18e-97b5-4779-beb1-eaf70d9e7375.jpgJudges Chapter 15Judges Chapter 15https://nicecrew.tv/static/streaming-playlists/hls/8a23874a-0376-407a-9704-5b5e682e5b07/f9d8a29c-8ff3-41b4-a8fb-840aeddf72a8-master.m3u8https://nicecrew.tv/videos/embed/i4mZQmHoerixtmZcov3Z9k225002024-01-07T01:20:34.058ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/oxxnDwZrmhp8GwUCK3H2FZhttps://nicecrew.tv/lazy-static/thumbnails/82ab6417-bdfb-49f7-a6fe-5b4bc328a682.jpgJudges Chapter 16Judges Chapter 16https://nicecrew.tv/static/streaming-playlists/hls/b690711b-9d6d-48f0-8637-b1595dddc79b/943c7863-901c-4f1a-9795-857bd38b2991-master.m3u8https://nicecrew.tv/videos/embed/oxxnDwZrmhp8GwUCK3H2FZ353002024-01-07T01:21:32.756ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/2q7AkFv9R6CWf7Ve7nLJvehttps://nicecrew.tv/lazy-static/thumbnails/994c34e4-4cd3-4b11-80ee-aa72e8013e70.jpgJudges Chapter 17Judges Chapter 17https://nicecrew.tv/static/streaming-playlists/hls/0b770d38-425f-4f9f-9e89-e619c5e4f937/37508a77-c05b-43b2-a51a-d2633f8ad6a9-master.m3u8https://nicecrew.tv/videos/embed/2q7AkFv9R6CWf7Ve7nLJve125002024-01-07T01:23:23.680ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/8eDYudzhL82DLZbHctZyoyhttps://nicecrew.tv/lazy-static/thumbnails/e9249e48-0ed3-4052-b1bc-d4f6714a7994.jpgJudges Chapter 18Judges Chapter 18https://nicecrew.tv/static/streaming-playlists/hls/3a980ab8-ad41-4664-82b3-5efcd5bbd154/8ba2d28f-ecb5-4d8e-93df-02681fac1028-master.m3u8https://nicecrew.tv/videos/embed/8eDYudzhL82DLZbHctZyoy315002024-01-07T01:24:17.261ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/xmCPNDHT8wFdvYhvdkzu72https://nicecrew.tv/lazy-static/thumbnails/48fd0143-e347-4a7c-abc5-e643fd6e8e62.jpgJudges Chapter 19Judges Chapter 19https://nicecrew.tv/static/streaming-playlists/hls/fdecde1a-2c05-4902-bfe6-2838f4a55b65/96117248-f5ff-49c2-8871-65b3507176e5-master.m3u8https://nicecrew.tv/videos/embed/xmCPNDHT8wFdvYhvdkzu72347002024-01-07T01:25:49.247ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/aUz6kamsEKB11oW3tTbt9Chttps://nicecrew.tv/lazy-static/thumbnails/3b217600-a63d-4833-9812-a8e9c8c02f75.jpgJudges Chapter 20Judges Chapter 20https://nicecrew.tv/static/streaming-playlists/hls/5039514d-8de9-4414-adc5-1b1ceff5cde0/ced2ecd3-0318-49bd-b717-56e3f2e2c3eb-master.m3u8https://nicecrew.tv/videos/embed/aUz6kamsEKB11oW3tTbt9C466002024-01-07T01:26:24.119ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/dnLizrbz35F9DSFP41DwyBhttps://nicecrew.tv/lazy-static/thumbnails/e02d928d-3ca7-4d7d-814a-8b5c02ea885c.jpgJudges Chapter 21Judges Chapter 21https://nicecrew.tv/static/streaming-playlists/hls/643795f7-a0a3-4eaa-b9f6-b6cd71eb6583/8930b1b3-0958-4807-9f57-3c8c58d7e51f-master.m3u8https://nicecrew.tv/videos/embed/dnLizrbz35F9DSFP41DwyB236032024-01-07T01:28:38.113ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/aqRuWTR7zBZ1PdrkTLFZC3https://nicecrew.tv/lazy-static/thumbnails/6fb9c18e-b08c-4372-af1b-6e9fc16bf773.jpgDreamsDreamshttps://nicecrew.tv/static/streaming-playlists/hls/4c5a9a72-820e-418e-9e37-45a159afa626/ecf8b58a-bea1-456b-86ec-a2cb45fb8cf9-master.m3u8https://nicecrew.tv/videos/embed/aqRuWTR7zBZ1PdrkTLFZC319542024-01-07T14:54:06.430ZYESMark Frye NOhttps://nicecrew.tv/w/sLpPamkn9ubFRJjHwVUoPfhttps://nicecrew.tv/lazy-static/thumbnails/337cb9dd-9110-4914-ab86-b601af56ad7e.jpgRuth Chapter 1Ruth Chapter 1https://nicecrew.tv/static/streaming-playlists/hls/d8c101a3-5e87-410d-8970-21dd039b063c/60990bd6-ffea-4053-ae28-b4f31a611114-master.m3u8https://nicecrew.tv/videos/embed/sLpPamkn9ubFRJjHwVUoPf228042024-01-07T22:31:03.539ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/t8NNnwxM3j2X88b9ZjZNLEhttps://nicecrew.tv/lazy-static/thumbnails/b9ee6746-ab33-4c8e-b50c-9332b352f565.jpgRuth Chapter 2Ruth Chapter 2https://nicecrew.tv/static/streaming-playlists/hls/dbbdca9b-0530-4e41-b80d-2d13c591513e/57d85abb-e9ec-4999-bee1-eb2323f747f4-master.m3u8https://nicecrew.tv/videos/embed/t8NNnwxM3j2X88b9ZjZNLE247002024-01-07T22:32:33.198ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/a6sAypJeY2tnsgkkyWDrkuhttps://nicecrew.tv/lazy-static/thumbnails/d2b89cf8-8c76-4679-a06e-708ba5a50003.jpgRuth Chapter 3Ruth Chapter 3https://nicecrew.tv/static/streaming-playlists/hls/49a55b68-3c8a-4d54-9d89-c9695990f756/da9cec70-308c-4c50-a0e0-3516be24d77e-master.m3u8https://nicecrew.tv/videos/embed/a6sAypJeY2tnsgkkyWDrku174002024-01-07T22:33:04.547ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/5Q7vx4er1smCi5okefzsUXhttps://nicecrew.tv/lazy-static/thumbnails/5bb741a6-c315-4c0a-a0aa-7b7dc35996c1.jpgRuth Chapter 4Ruth Chapter 4https://nicecrew.tv/static/streaming-playlists/hls/271c445d-d1a7-412b-a0cd-40fcbfd07c8f/2678792c-0eb6-450d-8c8f-92bd3eb9848d-master.m3u8https://nicecrew.tv/videos/embed/5Q7vx4er1smCi5okefzsUX218002024-01-07T22:33:36.931ZbiblekjvYESAudio BibleNOhttps://nicecrew.tv/w/8kzkhYELNy7y91QiVbKhXuhttps://nicecrew.tv/lazy-static/thumbnails/a8e25161-2164-4253-abe9-4cf148f83486.jpgFirst Book of Samuel, Chapter 1First Book of Samuel, Chapter 1https://nicecrew.tv/static/streaming-playlists/hls/3b6ba4eb-4301-486e-a269-b9888670428a/8c38b83d-9f68-420a-8642-972b82984b25-master.m3u8https://nicecrew.tv/videos/embed/8kzkhYELNy7y91QiVbKhXu260012024-01-07T23:36:39.807ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/rcpvG5x6uwmThQCsRjDHoFhttps://nicecrew.tv/lazy-static/thumbnails/ce4cf70e-9684-487d-9297-59e63568c42c.jpgFirst Book of Samuel, Chapter 2First Book of Samuel, Chapter 2https://nicecrew.tv/static/streaming-playlists/hls/cc0c2340-6754-43c7-942e-ac400b424eef/797ad24d-7d88-4ed1-bd41-7fe1c9226c51-master.m3u8https://nicecrew.tv/videos/embed/rcpvG5x6uwmThQCsRjDHoF381002024-01-07T23:37:19.445ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/rweLXmxjrwEGAyqVqnP9B7https://nicecrew.tv/lazy-static/thumbnails/438426ff-e29a-41b9-a610-1de30c4edb4f.jpgFirst Book of Samuel, Chapter 3First Book of Samuel, Chapter 3https://nicecrew.tv/static/streaming-playlists/hls/cead44cf-87af-4932-b208-d7d2e74fe2fc/0dd8a01c-a508-4d26-85b7-4e4b3355985d-master.m3u8https://nicecrew.tv/videos/embed/rweLXmxjrwEGAyqVqnP9B7177002024-01-07T23:40:37.912ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/xryifjQ6uJdNNoNQ9WSNFZhttps://nicecrew.tv/lazy-static/thumbnails/edeb8dfc-9612-427e-92c9-26c0697a3eca.jpgFirst Book of Samuel, Chapter 4First Book of Samuel, Chapter 4https://nicecrew.tv/static/streaming-playlists/hls/fe9ccbf2-4d5c-414c-90e8-b3d639a7b8b7/886efd1b-ad79-4d2b-8b62-e28c88993898-master.m3u8https://nicecrew.tv/videos/embed/xryifjQ6uJdNNoNQ9WSNFZ234002024-01-07T23:41:05.010ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/6EB66W2fBbp4HAqunuDkmChttps://nicecrew.tv/lazy-static/thumbnails/c1f8f0b3-9c05-4f35-99d5-10994283e1ad.jpgFirst Book of Samuel, Chapter 5First Book of Samuel, Chapter 5https://nicecrew.tv/static/streaming-playlists/hls/2de1948d-df99-4fd6-9a55-fdaec6ab9500/00dee0d1-16bd-4190-8775-c2781e9882b3-master.m3u8https://nicecrew.tv/videos/embed/6EB66W2fBbp4HAqunuDkmC135002024-01-07T23:42:08.449ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/2GPfwk2MFk79hhTexTcLPNhttps://nicecrew.tv/lazy-static/thumbnails/fb4ab005-1d04-4ebe-8213-107aa7882b0f.jpgFirst Book of Samuel, Chapter 6First Book of Samuel, Chapter 6https://nicecrew.tv/static/streaming-playlists/hls/0dcc0230-5be7-4516-a020-74a3363cfe0c/41fb6118-c9cc-4745-a759-53edab794dcd-master.m3u8https://nicecrew.tv/videos/embed/2GPfwk2MFk79hhTexTcLPN240002024-01-07T23:42:55.565ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/3bs75cvhSKqkLZXSJVMEoshttps://nicecrew.tv/lazy-static/thumbnails/efbb34b9-b4c6-484d-a42a-842a79753dc1.jpgFirst Book of Samuel, Chapter 7First Book of Samuel, Chapter 7https://nicecrew.tv/static/streaming-playlists/hls/11a7cd77-e4ac-4d23-9484-f839751ad906/745ae7a0-b02e-42a8-9fc2-7796f422c9a9-master.m3u8https://nicecrew.tv/videos/embed/3bs75cvhSKqkLZXSJVMEos175002024-01-07T23:43:26.260ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/ofpZMBZdbh2iec6E59gzFyhttps://nicecrew.tv/lazy-static/thumbnails/f53f563a-331c-4701-b4c8-29342222a8b1.jpgFirst Book of Samuel, Chapter 8First Book of Samuel, Chapter 8https://nicecrew.tv/static/streaming-playlists/hls/b42c4066-10b4-4542-8559-49ffb9258cf2/98097b49-1f47-4666-b835-ada4a489ebae-master.m3u8https://nicecrew.tv/videos/embed/ofpZMBZdbh2iec6E59gzFy178002024-01-07T23:43:51.978ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/a5iSrduvE1rvvY8nmzC9M9https://nicecrew.tv/lazy-static/thumbnails/d34c7e6f-c3e8-47c5-9b30-394dbdb4d595.jpgFirst Book of Samuel, Chapter 9First Book of Samuel, Chapter 9https://nicecrew.tv/static/streaming-playlists/hls/497c3c4b-b80c-43ff-ac5a-63325a3c734a/f29494c5-ec08-4cce-8bda-b867db57153f-master.m3u8https://nicecrew.tv/videos/embed/a5iSrduvE1rvvY8nmzC9M9325002024-01-07T23:44:37.241ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/kduP4G8VwiDqBBg9vHbN4Hhttps://nicecrew.tv/lazy-static/thumbnails/324a801b-88b5-4049-a09c-a57ef8ac298a.jpgFirst Book of Samuel, Chapter 10First Book of Samuel, Chapter 10https://nicecrew.tv/static/streaming-playlists/hls/9b9c50c2-1e26-48f7-84dc-bb3f0a74860f/b8681e8d-98ad-417e-bfcd-9540944b2a72-master.m3u8https://nicecrew.tv/videos/embed/kduP4G8VwiDqBBg9vHbN4H284022024-01-07T23:45:16.444ZkjvbibleYESAudio BibleNOhttps://nicecrew.tv/w/tkZY7mZGRdHoFmZ2pBcLLshttps://nicecrew.tv/lazy-static/thumbnails/ab7e6448-7cf1-4349-bfa0-e42aeb134ea3.jpgJJr - 232 - Cut To The QuickSurprise Sunday night solo show I walk through the government's war on middle America, Brother Nathanael dropping truth MOAB's, jackrollling savages, MC Yidiot and oh so much more https://nicecrew.tv/static/streaming-playlists/hls/dd719960-dfec-4cdf-b2a3-d598914e2d4a/dbf77802-557f-4e85-b738-b136fb057afb-master.m3u8https://nicecrew.tv/videos/embed/tkZY7mZGRdHoFmZ2pBcLLs93175282024-01-12T04:21:36.322ZYESJust Joe Radio NOhttps://nicecrew.tv/w/9w7HJYV5B1oT1sXiMpGi9Hhttps://nicecrew.tv/lazy-static/thumbnails/34e24df2-df0e-4eed-a23b-d749bd9df79c.jpgJJR - 233 - Tripod Talks Talmudic TunnelsThe tripod is back in town!! Matty Boombalatty and Reeee'ing Radix join me for some talk on Talmudic tunnels, Ray Epps' sweetheart deal, stopping school shooters with interpretive dance, and oh so much morehttps://nicecrew.tv/static/streaming-playlists/hls/44fd9043-39a4-48f7-baf3-7c6fb75ef2ed/bd5e30ec-7bf9-4b1e-931e-9a48db6e7abb-master.m3u8https://nicecrew.tv/videos/embed/9w7HJYV5B1oT1sXiMpGi9H72705592024-01-14T04:13:47.982ZYESJust Joe Radio NOhttps://nicecrew.tv/w/vzuMs9qnb2scvBZjNaVL6thttps://nicecrew.tv/lazy-static/thumbnails/c0c67926-d71d-4d4b-879f-79277860a940.jpgI Attended Ray Epps Sentencing & I am STUNNED by what I Saw!I attended the sentencing of Ray Epps who was charged with only a misdemeanor in connection with his conduct leading up to and on January 6, 2021. My thread: https://twitter.com/NotRadix/status/1744781225166778863 Eric Molitor GSG Fundraiser: https://www.givesendgo.com/EricMolitor Support my documentary: https://www.kandkfilm.com/donatehttps://nicecrew.tv/static/streaming-playlists/hls/ef864dd9-2296-4f09-aed1-563996d4ee05/2c77a544-e37c-41ed-82f1-31d5e2be5cec-master.m3u8https://nicecrew.tv/videos/embed/vzuMs9qnb2scvBZjNaVL6t25805112024-01-12T17:04:39.260ZRay EppsJanuary 6FedsurrectionEpps SentencingJ6YESRadix Verum ☦NOhttps://nicecrew.tv/w/3q5kcn2nQoiiyyzqvpUNZHhttps://nicecrew.tv/lazy-static/thumbnails/ba578671-18c8-436d-8366-67ca9703c32c.jpgRay Epps Sentencing Hearing FARCE: Judge & Govt PRAISE Epps, Claim he is a "Victim"On January 9, 2024, I attended the sentencing hearing for Ray Epps who was charged with one misdemeanor in connection with his conduct leading up to and on January 6, 2021. There were maybe 12 of us in the gallery in attendance and I have not seen anyone reporting the details correctly. Here is my thread: https://twitter.com/NotRadix/status/1744781225166778863 Eric Molitor Fundraiser - Please help if you can! https://www.givesendgo.com/EricMolitorhttps://nicecrew.tv/static/streaming-playlists/hls/138ecbfe-724e-4e73-9fdf-3de308ac75bb/9de265d8-ef41-4be2-98d6-3d25345b8694-master.m3u8https://nicecrew.tv/videos/embed/3q5kcn2nQoiiyyzqvpUNZH1752052024-01-12T17:12:43.860ZRay EppsFBIFedsurrectionJanuary 6J6YESRadix Verum ☦NOhttps://nicecrew.tv/w/qHzpL7io5AJr8C4Fx6imzYhttps://nicecrew.tv/lazy-static/thumbnails/db57fa4c-4556-43ec-bfa9-a413242a53e6.jpgFramed by the FBI for a fake Kidnap Plot, then Acquitted - Eric Molitor needs your help!Eric Molitor is one of the five men that have been acquitted by 2 different juries in the FBI's Gov. Whitmer Kidnap plot hoax. He has had his life upended and destroyed and is trying to get back on his feet. Eric's GiveSendGo Fundraiser: https://www.givesendgo.com/EricMolitor https://nicecrew.tv/static/streaming-playlists/hls/c829696e-c639-4eb9-92b9-902cfbf28c1a/ba3e6b11-9f56-45ef-bad3-62751221b994-master.m3u8https://nicecrew.tv/videos/embed/qHzpL7io5AJr8C4Fx6imzY1040032024-01-12T17:43:08.943Zmichiganwhitmer kidnap plotFBIFednappingEric MolitorYESRadix Verum ☦NOhttps://nicecrew.tv/w/3HmNTGziuhzTCcQyiRMdYVhttps://nicecrew.tv/lazy-static/thumbnails/971aa56c-be40-46be-905a-b12f83cd5a0e.jpgCummins 4BT cold startCummins 4BT cold starthttps://nicecrew.tv/static/streaming-playlists/hls/15f89877-0a9b-450f-beb2-1447cd703a4d/124e5896-aaf5-462e-bd35-102f27287711-master.m3u8https://nicecrew.tv/videos/embed/3HmNTGziuhzTCcQyiRMdYV34062024-01-12T20:09:32.583ZYESBrother TylerNOhttps://nicecrew.tv/w/r9NrrC1guSn6JFzJra3Ukmhttps://nicecrew.tv/lazy-static/thumbnails/893e3836-dd6d-4d9a-8330-7fe117693a2b.jpgThis Veteran was Targeted & Framed by the FBI in the Whitmer Kidnap Plot Hoax & Rots in PrisonPaul Edward Bellar was just 14 years old when he convinced his older brother Tommy Jr. to take him down to the Milford Fire Department to enlist in the Cadet Explorer Program. Paul excelled at the program and was taken on many serious and dangerous calls including suicide calls, which gave him PTSD at a very young age. But Paul had always had a love of military and law enforcement and he always wanted to help people. That is what made him happy more than anything else. In 2015, Paul would enlist and join the US Army. His experience as a teenager handling first responder calls to suicides helped contribute to his continued drive to protect others. Paul needs our prayers and our help and so does his family. Please write to him if you can. https://nicecrew.tv/static/streaming-playlists/hls/cbaf0916-33de-4656-84da-5a702dc49e32/6d12517a-3fff-4b6e-a7e2-ea9aa71637ea-master.m3u8https://nicecrew.tv/videos/embed/r9NrrC1guSn6JFzJra3Ukm920012024-01-12T22:09:12.393Zpaul bellarmichiganwhitmerfednappingkidnap plot hoaxYESRadix Verum ☦NOhttps://nicecrew.tv/w/hLDATXDvzGDGqmPCTybYguhttps://nicecrew.tv/lazy-static/thumbnails/3fd6e1e9-2470-42a9-8e95-2fd6a53ff682.jpgJJR - 234 - Hangin' With HTOutspoken activist and ADL's Public Enemy Number One Handsome Truth joins us for a discussion on his trial and arrest, his popular Livestream, and the future of political dissidence. https://nicecrew.tv/static/streaming-playlists/hls/87ce1e06-2aa7-4a9f-8bfe-d80c3623f452/1ce4c0e4-0ae6-4e95-93f9-3d47608cb514-master.m3u8https://nicecrew.tv/videos/embed/hLDATXDvzGDGqmPCTybYgu54325352024-01-14T04:39:36.008ZYESJust Joe Radio NOhttps://nicecrew.tv/w/m4rv4pcPRXsV6CCa19pTfvhttps://nicecrew.tv/lazy-static/thumbnails/278aea1a-2e19-47cb-b53c-24e53a0ed37d.jpg1440p upload testAbout as good as it's going to get for a livestreamhttps://nicecrew.tv/static/streaming-playlists/hls/a271b856-3f3c-43ed-a546-442ae5f22fcd/a2cbc2a7-f8c0-412c-ab74-c07c37d73e6e-master.m3u8https://nicecrew.tv/videos/embed/m4rv4pcPRXsV6CCa19pTfv490292024-01-18T00:21:21.150ZYESGamingNOhttps://nicecrew.tv/w/wVkrCyU65MUUBVnQfPHpzshttps://nicecrew.tv/lazy-static/thumbnails/3253992f-88ac-47f1-92e1-e2166828b3ba.jpgFBI Arrests "Trans Nazi," Who Talked to FBI & FBI Informant, has "Bipolar, DID," & Cult Ties!There is a lot more here than meets the eye! Yesterday the FBI announced they had arrested "a transgender woman plotting violence against Jews, Black People, and allegedly targeting transphobic co-workers with Nazi imagery and stockpile of guns and ammunition." The individual in question is a "trans woman" named "Elizabeth West." An "anonymous source" contacted the FBI about "Wyona Wild" - a trans woman living in Oregon regarding "concerning" and "threatening" posts online. The FBI made contact with Wyona in September of 2023. One month later in October of 2023 - Wild legally changes its name to "Elizabeth Bellasteros West" and it creates a Twitter account and beings to post over-the-top white supremacist propaganda. The FBI used a CHS (Confidential Human Source) during the course of their "investigation," and the FBI agents themselves had numerous interviews with "Elizabeth West," prior to arresting it. It's all very suspicious to me. West appears to be mentally ill - but I think it was being groomed.https://nicecrew.tv/static/streaming-playlists/hls/fa648fa4-d8c3-42d0-a2e1-8a4213502668/707bcfaa-c1e1-446c-9975-16d963941552-master.m3u8https://nicecrew.tv/videos/embed/wVkrCyU65MUUBVnQfPHpzs21225132024-01-18T20:40:38.703Ztransfbielizabeth westfbi informantscultsYESRadix Verum ☦NOhttps://nicecrew.tv/w/5vmJ9UL5zdKTsfn7b7i1KChttps://nicecrew.tv/lazy-static/thumbnails/b084a9af-cae5-418a-885d-2dc7e5c9e3c9.jpgAlex Soros is an Unintelligent Sniveling Narcissist and BuffoonAlex Soros is a clown. He spoke today at the World Economic Forum 2024 in Davos and displayed his sniveling behavior while appearing to slur his words. Alex had a party boy image for a while then his father decided to rehabilitate him as some type of reformed aspiring intellectual. Alex changed his appearance and dress and took on the public mantle of “philanthropist” like his father. Alex recently took over his father’s 26-billion-dollar open society foundation and said he was more political than his father. Alex and his father like to use “kindness” – presented as a virtue – which serves as a tool for manipulating public opinion and perceptions. Beneath the surface, it's a calculated strategy to cultivate an image of benevolence, further obscuring the seething contempt hidden beneath the veneer of "charitable philanthropist."https://nicecrew.tv/static/streaming-playlists/hls/247de5b5-d7cb-4f50-9d54-5e4072a5a52a/af2af484-a207-4c1a-a315-50dd2b94f085-master.m3u8https://nicecrew.tv/videos/embed/5vmJ9UL5zdKTsfn7b7i1KC10755172024-01-19T21:58:53.101ZWEFDavosAlex SorosOpen Society FoundationNarcissismYESRadix Verum ☦NOhttps://nicecrew.tv/w/1PRDRM6UwjUSRXq1Wv7ZuUhttps://nicecrew.tv/lazy-static/thumbnails/2584ecf8-8e1a-4692-b68f-bd9c67819e99.jpgTaylor Swift Can't Handle Criticism or JokesThe thing about Taylor Swift that has always bothered me was her ability to appear so authentic, genuine, and perfect. You will never see Taylor getting arrested for DUI or anything like what has befallen many of her peers in the industry. Taylor always appears well put together and she comes off as so sweet and innocent. Now I have no bias against Taylor, I find some of her music quite catchy. I think some of the criticisms of her have been unfair. Yet there is something about Swift that is different from other celebrities who have management teams dedicated to cultivating public personas. What is it about Taylor that seems like a red flag? Well, she seems a little too perfect. To a certain extent, this is to be expected with the music industry – they are selling a product at the end of the day. Celebrities are always presented to the public as idealized “characters” designed to be marketed to a demographic, expected to generate revenue, and create a brand that can last and generate revenue for some time. But compared to her peers – Taylor outshines and outperforms them on every metric. She was recently minted as a billionaire following her Eras tour. She has amassed so much power that one could argue she is the music industry, yet simultaneously she’s been able to maintain this victimized narrative. When Taylor first appeared on the scene as a talented young country music artist she was sold as an average American small-town girl that grew up on a Christmas tree farm. There is some truth to this – Taylor did grow up on a Christmas tree farm that sprawled across 11 acres, and she was born rich. Her father Scott Swift was a successful financial adviser and marketing executive. Scott Swift comes from 3 generations of Bank Presidents. Taylor has always presented herself as sincere. She posts pictures and videos of herself hanging out with her friends, she lip-syncs on Instagram, she takes silly selfies, she even cringe Tumblr posts. To her fans, she f...https://nicecrew.tv/static/streaming-playlists/hls/06ae8e88-8aa5-46ad-87c8-71d5e7ac3010/fef95633-2943-42a5-80d3-34098fb657eb-master.m3u8https://nicecrew.tv/videos/embed/1PRDRM6UwjUSRXq1Wv7ZuU1748552024-01-20T16:33:04.895Ztaylor swiftgolden globeshollywoodmusic industrynarcissismYESRadix Verum ☦NOhttps://nicecrew.tv/w/mA4AquB71BSZhmcUGUHUG4https://nicecrew.tv/lazy-static/thumbnails/6224e845-39b1-4130-ae72-61df366b6960.jpgJJR - Fedjacketing of Patriot FrontSpurred by the recent massive coordinated effort to castigate activist organization Patriot Front as a "Fed" op, I passionately express my disdain (to put it politely) for a merry band of internet ignoramuses, grifters, and gatekeepers. Also out with the New Twitter, in with the Old Twitter. https://nicecrew.tv/static/streaming-playlists/hls/a6b846a4-5af4-4945-8397-36610eb51d8b/8e5a1e71-c952-4616-b8f5-3cbb2f9b6e78-master.m3u8https://nicecrew.tv/videos/embed/mA4AquB71BSZhmcUGUHUG454505962024-01-24T03:41:25.206ZYESJust Joe Radio NOhttps://nicecrew.tv/w/ox4DvU3TLupDAdSbPhtAkjhttps://nicecrew.tv/lazy-static/thumbnails/068f31fd-9b37-449d-a55f-2bb4f3da7feb.jpgEric Dondero's Ass DamageI had to ask him a couple questions.https://nicecrew.tv/static/streaming-playlists/hls/b67f5ad5-950d-4a26-8395-096baf88a640/7031c516-4373-493b-9598-dc65f6a7bc72-master.m3u8https://nicecrew.tv/videos/embed/ox4DvU3TLupDAdSbPhtAkj19451402024-01-22T03:43:06.274ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/hPTDv2nmiwYRnmo6UiV5jQhttps://nicecrew.tv/lazy-static/thumbnails/8dc3b0c0-3469-40d1-a366-eb609f640ab0.jpgFederal Judge SLAMS FBI for "Invented Conspiracy," Releases Final "Newburgh Four" PrisonerU.S. District Judge Colleen McMahon on Friday granted James Cromitie, 58, compassionate release from prison six months after she ordered the release of his three co-defendants, known as the "Newburgh Four," for similar reasons after one of the prisoners provided evidence of being "framed" by the US Government. In a scathing ruling, McMahon wrote that the FBI invented the conspiracy and identified the targets. Cromitie and his co-defendants, she wrote, “would not have, and could not have, devised on their own a crime involving missiles that would have warranted the 25-year sentence the court was forced to impose." https://abcnews.go.com/US/wireStory/judge-orders-release-newburgh-defendant-blasts-fbis-role-106538808 https://www.cbsnews.com/news/gretchen-whitmer-michigan-governor-face-the-nation-transcript-01-21-2024/https://nicecrew.tv/static/streaming-playlists/hls/8842010a-e591-4ccc-82ae-b009885785ec/8a538694-2cc7-4080-838c-34746c53f072-master.m3u8https://nicecrew.tv/videos/embed/hPTDv2nmiwYRnmo6UiV5jQ1514062024-01-22T20:33:20.805Znewburgh fourfbijames cromitieterrorismconfidential informantsYESRadix Verum ☦NOhttps://nicecrew.tv/w/3DTJGXdT4eMcxsYpsMpbSchttps://nicecrew.tv/lazy-static/thumbnails/ea008ae8-db24-4edb-aaab-0a4ec2cf190d.jpgChanging the Engine Oil on a Branson TractorBranson Tractor 2510H Oil Change I hate my tractor.https://nicecrew.tv/static/streaming-playlists/hls/157cae31-a1b9-4991-8d35-50886c8f462f/3d39733f-d8f6-4dc3-907b-9b04dbd36be0-master.m3u8https://nicecrew.tv/videos/embed/3DTJGXdT4eMcxsYpsMpbSc272022024-01-24T12:11:50.829ZYESBrother TylerNOhttps://nicecrew.tv/w/w7faCNRQLeHjThGVmtDDDUhttps://nicecrew.tv/lazy-static/thumbnails/96a314d4-ce98-4414-b1f5-e5c0a39f3bd0.jpgHome made hot wire sheep dehorner - DIYI made this from a backup UPS battery, some steel, wire, and nichrome wire to make a tool to remove and cauterize a horn. Should work with any horn.https://nicecrew.tv/static/streaming-playlists/hls/f3d15a43-d7ae-47a3-9778-3143c5143502/65099921-8db4-408a-9456-db074c3f20d1-master.m3u8https://nicecrew.tv/videos/embed/w7faCNRQLeHjThGVmtDDDU98032024-01-24T12:11:32.206ZYESBrother TylerNOhttps://nicecrew.tv/w/2UfjQm6R3ACYXSe2q3A2Z4https://nicecrew.tv/lazy-static/thumbnails/5fd0ae65-fd7a-482a-b56b-657f00b586a8.jpgHow to check your Chevy brake switch contacts - Cruise Control FixThis fixed my 03 Silverado's cruise control, the contacts got arc soot on them and they had to be cleaned. This is just showing you the continuity check, but you should clean it with a burnishing tool. I made my own by polishing down an old screwdr…https://nicecrew.tv/static/streaming-playlists/hls/0f64a482-c270-48eb-a080-8ef9fb83cb41/ff1146b1-cba3-4864-9205-a05c4fc7eec3-master.m3u8https://nicecrew.tv/videos/embed/2UfjQm6R3ACYXSe2q3A2Z451012024-01-24T12:11:28.108ZYESBrother TylerNOhttps://nicecrew.tv/w/5GYZtSGw2URCfzfATDGa6Whttps://nicecrew.tv/lazy-static/thumbnails/f69ea13c-4c29-493f-9752-a2ce0f88ee38.jpgMaking a Circuit Breaker Panel Interlock for a GeneratorPower goes out here all the damn time, so I needed to make an interlock to make it safer to turn on. If my wife tries to run it the way I had it set up, someone would probably die!https://nicecrew.tv/static/streaming-playlists/hls/261d6d6b-56a9-4867-ad9c-101e8a222c8c/379120bd-47b3-43bf-83e8-618b0a40a257-master.m3u8https://nicecrew.tv/videos/embed/5GYZtSGw2URCfzfATDGa6W568052024-01-24T12:13:59.695ZYESBrother TylerNOhttps://nicecrew.tv/w/jYHUjrgFS4CNJTgHyXbXYVhttps://nicecrew.tv/lazy-static/thumbnails/7030b3ef-cf51-42ed-989b-fe4ea3fb1b09.jpgWooden Fence PreservationTL;DW: Char and apply Motor oil. Some chatting. Sheep are the best animal.https://nicecrew.tv/static/streaming-playlists/hls/99aff854-d6af-4302-81bb-dff2eb728461/f194f09b-28af-475e-a52d-c333b270b50d-master.m3u8https://nicecrew.tv/videos/embed/jYHUjrgFS4CNJTgHyXbXYV521042024-01-24T12:14:01.517ZYESBrother TylerNOhttps://nicecrew.tv/w/cC1XHR8q2hWiayXpzjt5DBhttps://nicecrew.tv/lazy-static/thumbnails/08886d5f-a6bc-441b-91c1-6d0d566b5bd0.jpgHomeschool Yer ChildrenThey'll get molested by pedophile homosexual teachers in the public school system. This was done for a my final college speech class. Homeschool your children.https://nicecrew.tv/static/streaming-playlists/hls/5e1be49e-6416-49a3-97fd-eb152f9ea34d/b37996b8-1e00-47fb-bb35-3c3f777a091a-master.m3u8https://nicecrew.tv/videos/embed/cC1XHR8q2hWiayXpzjt5DB4055132024-01-24T12:13:35.731ZYESBrother TylerNOhttps://nicecrew.tv/w/gBZ5pTuKw1rhQyJxRmVJQqhttps://nicecrew.tv/lazy-static/thumbnails/75fb3477-9241-4cf3-bb65-e9eeada7bf7a.jpgHow to Reduce a Water Heater's Current Consumption for a Solar InverterIf you are running your whole house on electricity and have problems with your water heater causing your inverter to experience overload, you can use a 3-way switch to reduce the consumption from 4400W to 1100W by replacing one hot of the wire with …https://nicecrew.tv/static/streaming-playlists/hls/7e7f4946-14dd-4dad-af09-cb79ba2e08c8/f70a15c1-2ac2-45e3-869f-8e1c29f93a7d-master.m3u8https://nicecrew.tv/videos/embed/gBZ5pTuKw1rhQyJxRmVJQq5320122024-01-24T12:14:21.144ZYESBrother TylerNOhttps://nicecrew.tv/w/wg8N6bbaE8A3dHhcVQ5Ew2https://nicecrew.tv/lazy-static/thumbnails/d05dec5b-57c3-4599-8c04-0faad8fa8026.jpgKarlin Younger, Capitol Police, & The J6 "Pipe Bombs,": Anatomy of a HOAXA deep dive into Karlin Younger, the woman who allegedly "discovered" the RNC "pipe bomb" on her way to do "laundry" on her lunch break. Karlin glows like the sun and has a background in "counterterrorism." Karlin was working for a company called "FirstNet" which is almost identical to Carbyne 911 at the time she "discovered" the device. FirstNet just received a $92 million contract with the FBI in the weeks prior, which we are supposed to believe is a coincidence.https://nicecrew.tv/static/streaming-playlists/hls/f50f1eb6-405c-450e-af0e-b374002b45a5/beed87c3-d5e0-4663-8e4e-a16e576f7302-master.m3u8https://nicecrew.tv/videos/embed/wg8N6bbaE8A3dHhcVQ5Ew232565382024-01-24T19:33:18.661ZKarlin YoungerRNC Pipe bombJanuary 6FirstNetCarbyne 911YESRadix Verum ☦NOhttps://nicecrew.tv/w/dcP8gLDyEZ1kgMqUBaBFaQhttps://nicecrew.tv/lazy-static/thumbnails/0ca830bc-d420-423f-9a0f-cb9fa0df05ad.jpgJJR - 237 - Life, Liberty, VictoryNoted activist and outspoken advocate for Nationalism, Thomas Rousseau, stops by for a discussion on the recent Patriot Front demonstrations in Washington D.C. and NYC, as well as the histrionic meltdown within the media and Conservative Inc afterword. Later we get into a myriad of items from 3rd world invasion to religion's role in Nationalism, what's next for Patriot Front, as well as some live calls. https://nicecrew.tv/static/streaming-playlists/hls/62d3e32e-faf9-4c67-8ed7-58b01b09d09e/5a67a842-eafb-4c47-ae6c-27d4721c30ed-master.m3u8https://nicecrew.tv/videos/embed/dcP8gLDyEZ1kgMqUBaBFaQ107095262024-01-27T06:05:39.224ZYESJust Joe Radio NOhttps://nicecrew.tv/w/mfzF6a6uE6maHhzmMJgygqhttps://nicecrew.tv/lazy-static/thumbnails/667cbffe-db10-490f-8cc3-40cbad143b92.jpgJJR - 238 - Showdown or Circus??Joined by Nick, host of Night Nation Review, we do our best to decipher whether the showdown between the Biden administration and Texas is serious or just more circus. Also Spaceman tours the Sad Place, Benminem's fire bars, America's refusal to deal with reality, and apparently there IS crying footyball. https://nicecrew.tv/static/streaming-playlists/hls/a3fff033-9049-4f1c-b719-19fe2fa52796/0b2140df-4e7f-4524-86bf-2114fc251f91-master.m3u8https://nicecrew.tv/videos/embed/mfzF6a6uE6maHhzmMJgygq108855262024-01-28T06:10:22.956ZYESJust Joe Radio NOhttps://nicecrew.tv/w/ck1USni1gre3dJTZAGyrikhttps://nicecrew.tv/lazy-static/thumbnails/c724ad5b-0908-4a2f-88ae-f353695ef9c8.jpgThe Narcissistic Smirk and SneerWe are going to talk about the smug, self-satisfied smirk of the narcissist and their contemptuous sneer. A smirk is a smile that shows a smug, condescending, or self-satisfied attitude. It’s a smile with one side of the lip curling upward like a half-smile. It’s a display of both pleasure and contempt. A sneer is a scornful facial expression characterized by a slight raising of one corner of the upper lip, and a contemptuous grin marked by a slight turning up of the nose. The sneer is a manifestation of their condescension. The smirk and sneer are both micro-expressions, a facial expression that lasts for a short moment, that reveals the true feelings of the narcissist.https://nicecrew.tv/static/streaming-playlists/hls/5bbc37f8-9103-4d6f-9b06-56611a5a18f1/4df8e862-62a5-4ac5-8f5f-55dfccaf49d5-master.m3u8https://nicecrew.tv/videos/embed/ck1USni1gre3dJTZAGyrik69551372024-01-29T01:42:04.646ZnarcissismnpdmanipulationnarcissistYESRadix Verum ☦NOhttps://nicecrew.tv/w/5Ry6K9eAScKZN1gWsHnkEthttps://nicecrew.tv/lazy-static/thumbnails/65817389-e10f-48aa-99eb-d0e3cea9168b.jpgWhy we might call God the TrinityWhy we might call God the Trinityhttps://nicecrew.tv/static/streaming-playlists/hls/274fc7f6-3bad-4967-a0fe-23b3d7dfd87b/b7a99ad4-822f-4393-9fa1-6e7112a83fc3-master.m3u8https://nicecrew.tv/videos/embed/5Ry6K9eAScKZN1gWsHnkEt7215562024-01-31T03:02:19.277ZYESBrother TylerNOhttps://nicecrew.tv/w/kG3Z3LhHi6w3NT9hpWzvFZhttps://nicecrew.tv/lazy-static/thumbnails/b613bc9a-1f63-4480-ba1b-30b07c5a37f6.jpgMan Allegedly Beheads His FatherOn 01/30/2024, a man allegedly beheads his father and goes on an anti-government rant. Coincidentally, this is when the government is trying to pass anti-militia bills. https://nicecrew.tv/static/streaming-playlists/hls/9f75395a-72b7-4ea1-b995-9ff6aa56f70b/d7a05873-f104-446f-9772-d78fb4f00296-master.m3u8https://nicecrew.tv/videos/embed/kG3Z3LhHi6w3NT9hpWzvFZ8750462024-01-31T13:54:03.405ZviolencedeathgorepennsylvaniaNOMatty's Autism EmporiumNOhttps://nicecrew.tv/w/huEcsJ6KLu8MrTCEan837fhttps://nicecrew.tv/lazy-static/thumbnails/33a55c9d-7275-4902-bf88-6638f97e6652.jpgMentally Ill Man Allegedly Beheaded his Father, Claims to be Militia Leader & Calls for RevolutionJustin Mohn is accused of decapitating his father Michael Mohn before displaying the severed head in a YouTube video manifesto where he referred to himself as a national militia leader, claimed there was a cult that believes he is a "God," that this cult and both political parties wanted him to be president in 2020. He claims to have had contact with the FBI. He claims he reported "labor racketeering" to them and that agents actually came to his house. He claims the "FBI" betrayed him. He claims to be an "IRS Whistleblower" and to have worked as a contractor for Microsoft. https://nicecrew.tv/static/streaming-playlists/hls/8592958f-e888-4650-90e2-8561279a183a/7cf973ed-64cf-4bf1-9c3e-3f73df236d92-master.m3u8https://nicecrew.tv/videos/embed/huEcsJ6KLu8MrTCEan837f30185622024-01-31T20:11:52.495Zjustin mohnmilitiabeheadingfbiYESRadix Verum ☦NOhttps://nicecrew.tv/w/w7Z4TCgqYz6gPALk1pWoBQhttps://nicecrew.tv/lazy-static/thumbnails/5fe836c1-7978-4d03-ba4d-87e9f827fe37.jpgBrief Introduction to Spur Climbing ConifersI briefly show you how to spur climb a tree. I am not an expert climber.https://nicecrew.tv/static/streaming-playlists/hls/f3ebca8f-74b8-4e4b-91ee-5529410f5ad6/9dc43eb1-d461-4266-8966-e2d212fb3f4f-master.m3u8https://nicecrew.tv/videos/embed/w7Z4TCgqYz6gPALk1pWoBQ13485512024-01-31T23:39:39.514ZtreesclimbingtradesYESBrother TylerNOhttps://nicecrew.tv/w/qckcVL9TqYiynrnry33gBXhttps://nicecrew.tv/lazy-static/thumbnails/39a4898b-7d93-4b9f-ba90-35c8532742fc.jpgLive Test Stream - 1/31/2024, 11:07:55 PMLive Test Stream - 1/31/2024, 11:07:55 PMhttps://nicecrew.tv/static/streaming-playlists/hls/c3f0585f-4670-464e-b9a2-3f78d767ab71/e9d872cd-4868-4971-bdc1-07629556c8dc-master.m3u8https://nicecrew.tv/videos/embed/qckcVL9TqYiynrnry33gBX3033012024-02-01T00:20:41.624ZYESKracalactakaNOhttps://nicecrew.tv/w/fVTtDNnXHdvnT9dbNHQ3v2https://nicecrew.tv/lazy-static/thumbnails/c03bf3da-47b5-4dcd-ae51-9feb1764bf6d.jpgLive Test Stream - 1/31/2024, 11:59:13 PMLive Test Stream - 1/31/2024, 11:59:13 PMhttps://nicecrew.tv/static/streaming-playlists/hls/78e615b0-a2db-4900-bb01-33d29cccd12b/db9d8e35-c8fc-449a-909b-369c7141e64a-master.m3u8https://nicecrew.tv/videos/embed/fVTtDNnXHdvnT9dbNHQ3v2917032024-02-01T00:21:01.825ZYESKracalactakaNOhttps://nicecrew.tv/w/2Ez752yShDGLfVX1ZupDSXhttps://nicecrew.tv/lazy-static/thumbnails/fdab1581-2ec4-4787-b269-dd76a3517e91.jpgBlood Tribe InitiationA very serious organization that you should take very seriously and definitely isn't a gayop /s [Source](https://x.com/ChudsOfTikTok/status/1698092744529358860)https://nicecrew.tv/static/streaming-playlists/hls/0d7bcdaa-7ad9-41a2-ba08-b47924322c37/76dc4032-a636-49b7-8ef2-b684c57719c5-master.m3u8https://nicecrew.tv/videos/embed/2Ez752yShDGLfVX1ZupDSX685432024-02-03T21:29:56.973Zblood triberitualinitiationlmaoYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/qutkeLqLLsamPj1tskMVYXhttps://nicecrew.tv/lazy-static/thumbnails/c5bea646-a020-4464-b28d-67b266f45942.jpgDoors - Die at the end, got overconfident.Fun game. It randomizes every play through. I noticed something was off, ended up noticing my graphic got turned all the way down somehow.https://nicecrew.tv/static/streaming-playlists/hls/c654ff44-e4e7-49ca-b190-b7a9eb322193/8011be0b-d1ac-44e2-bb8c-a8a6124b62ba-master.m3u8https://nicecrew.tv/videos/embed/qutkeLqLLsamPj1tskMVYX1764002024-02-06T07:06:38.323ZYESMain omega_variant channelNOhttps://nicecrew.tv/w/7vgANvHmMyoiBBBmJXd63hhttps://nicecrew.tv/lazy-static/thumbnails/e1c2efe1-d3a4-4a04-bddf-8dc0988a38a8.jpgTucker Carlson Announces He Will Interview Vladimir PutinRUSSIAhttps://nicecrew.tv/static/streaming-playlists/hls/34ad03e1-01da-4a9a-8df0-a2d3aa55e848/830935c9-a5bb-44db-addd-f4fe5bf1e9cc-master.m3u8https://nicecrew.tv/videos/embed/7vgANvHmMyoiBBBmJXd63h2680152024-02-07T05:10:36.839ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/fAFGaqRVZnuJpmJdFtaSPRhttps://nicecrew.tv/lazy-static/thumbnails/72397098-4c4e-4422-9be5-15cdceb29a1a.jpgCold War Stasi Spymaster Who Helped Create DHS: Markus Wolf, the Man without a FaceWe talk about Markus Wolf, a founder and chief of the East German Stasi. Wolf was credited by the Jerusalem Post as being the "best espionage chief in the world" during the Cold War. Dubbed "The Man Without a Face" due to his elusiveness the West didn't even know what he looked like until 1978 when he was photographed by the Swedish Secret Service.https://nicecrew.tv/static/streaming-playlists/hls/7637b0d6-0dba-4077-8032-4491eafc1957/e258c810-1262-4257-85f7-2b668e61fee4-master.m3u8https://nicecrew.tv/videos/embed/fAFGaqRVZnuJpmJdFtaSPR1480022024-02-07T21:08:23.727Zstasimarkus wolfeast germanyespionagecold warYESRadix Verum ☦NOhttps://nicecrew.tv/w/g97vbxRSsBsUw3R32hP1SDhttps://nicecrew.tv/lazy-static/thumbnails/36b8a884-1e8a-4bee-8dae-0d8f2bf60ff9.jpgThoughts on "tipping" and the "service industry"I wanted to share my thoughts on "tipping culture" and the "srevice industry" and ask folks how they are surviving. https://nicecrew.tv/static/streaming-playlists/hls/7a9b09aa-9f99-4cc3-81ba-4b1765954c71/0ea6a1a1-bf4f-4165-9345-d7298c733409-master.m3u8https://nicecrew.tv/videos/embed/g97vbxRSsBsUw3R32hP1SD26955172024-02-08T21:05:59.006Ztippingservice industryfine dininginflationrecessionYESRadix Verum ☦NOhttps://nicecrew.tv/w/kT4oZxUftKxaGiu3opehYZhttps://nicecrew.tv/lazy-static/thumbnails/73dd929f-570a-4b1e-9dbf-09c2c5654548.jpgI am so sick of Taylor Swift's narcissism: a rantTaylor Swift's mask fell at the 2024 Grammys. She is usually very good at facade management but her narcissism at times causes her to drop the mask for a brief moment. Her behavior towards Celine Dion and Lana Del Ray has finally revealed some of her self-aggrandizement although there will still be unhinged swifties denying this in the comments and excusing away her rudeness. https://nicecrew.tv/static/streaming-playlists/hls/a0fea8f0-f52c-46c2-842e-6d7b1bfd1ae1/9a62fc4b-61d5-426a-b412-bfc68e8b3435-master.m3u8https://nicecrew.tv/videos/embed/kT4oZxUftKxaGiu3opehYZ10180212024-02-09T20:09:16.007Ztaylor swiftlana del raygrammysnarcissismceline dionYESRadix Verum ☦NOhttps://nicecrew.tv/w/jckhGZkxbH3erfipVG5nP1https://nicecrew.tv/lazy-static/thumbnails/580b4c28-d3a2-4134-b4da-e0f4ecfa6c89.jpgFBI Warns Sheriffs of "Imminent" Cyber Attacks on US Elections and GridWhat is really going on here? Butler County Sheriff Rick Jones held a press conference sharing what information he learned from a meeting held between FBI director Chris Wray and the National Sheriffs Assocation. Wray warned of an "imminent" cyber attack. I thought about the WEF and the Cyber Polygon simulation.https://nicecrew.tv/static/streaming-playlists/hls/93599064-5303-4e72-99dd-a6447a515a1a/f1c2d362-9fe5-4df0-8bac-578586a93abf-master.m3u8https://nicecrew.tv/videos/embed/jckhGZkxbH3erfipVG5nP11271542024-02-10T23:28:25.054Zcyber polygonsheriffsbutler countyfbicyber attacksYESRadix Verum ☦NOhttps://nicecrew.tv/w/nDdJgJTd3xc2PsQMC3xY9nhttps://nicecrew.tv/lazy-static/thumbnails/bae080a2-20bf-44ad-ae62-f671e7632d2f.jpgJJR - 239 - Where's Your HumanityBack in action, Matty stops by to help with the heavy lifting. We go over the significance and impact of the Tucker/Putin interview, also babblin' Biden completely blows it, no more militias, illegal arm gestures, Australian upset with Barbara, Dystopia Goggles., eThots get dignified and more https://nicecrew.tv/static/streaming-playlists/hls/af424698-52cf-4f12-8225-6c60ea468e7d/e462cf6b-bf24-4057-83f6-7033bd050f9a-master.m3u8https://nicecrew.tv/videos/embed/nDdJgJTd3xc2PsQMC3xY9n90505292024-02-11T06:02:17.375ZYESJust Joe Radio NOhttps://nicecrew.tv/w/k2V8eWemWXSwV5X28KK541https://nicecrew.tv/lazy-static/thumbnails/f4ad9b79-1e36-43c7-89a3-cb4ae79cc787.jpgTucker Carlson Interviews Vladimir PutinTucker Carlson Interviews Vladimir Putinhttps://nicecrew.tv/static/streaming-playlists/hls/9a221e1e-5cca-4047-a65f-f07402a308c6/589585c7-7f64-4a48-ac21-5b36565da612-master.m3u8https://nicecrew.tv/videos/embed/k2V8eWemWXSwV5X28KK5417639052024-02-11T02:39:56.979ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/aSKBg2Jz41jqxDriDhmsrYhttps://nicecrew.tv/lazy-static/thumbnails/6eda8db3-76ee-4cfc-a22d-b4a4824fde30.jpgJJR - 240 - Enough About "The Big Game"Just Joe Radio "Fuck the Superbowl" special, I got longtime pal Cino sitting in with me. We go over the propaganda, idol worship, and over all hilarity surrounding Taylor Swift Superbowl bread and circus. Also Hawley, Mayorkas and HIAS, Kwanez outta control, musician not magician, ow my balls and more.https://nicecrew.tv/static/streaming-playlists/hls/4ff84f8e-d30e-4b33-97c7-07ae97ef038a/1bf42a4a-22d3-4a25-8a29-08d796452b9d-master.m3u8https://nicecrew.tv/videos/embed/aSKBg2Jz41jqxDriDhmsrY94665342024-02-12T05:41:51.898ZYESJust Joe Radio NOhttps://nicecrew.tv/w/wP6XuXiYaQmBtRiMkDaQSUhttps://nicecrew.tv/lazy-static/thumbnails/6ae5d2d6-21dd-4197-a946-15fa1fb52b33.jpgNem azért mert... Gemini:hu: A pillanat univerzális szépsége a szinkronicitásban :en: the universal beauty of the moment in sincronicityhttps://nicecrew.tv/static/streaming-playlists/hls/f985c9bd-9612-4fa3-811c-47deb418b2a0/1c6a93e1-d854-4518-8ea1-ddfffa2014be-master.m3u8https://nicecrew.tv/videos/embed/wP6XuXiYaQmBtRiMkDaQSU39542024-02-24T01:30:14.899Zmomentheatradiokitchenart of momentYESSzeklerland channelNOhttps://nicecrew.tv/w/rqWGN86wFgWGmmuAopdDv5https://nicecrew.tv/lazy-static/thumbnails/e8392797-059a-47bc-badd-f8099f18f106.jpgJJR - 242 - Brave Resistance or Abject SubmissionThe gang's all here! Karl Dahl returns to Just Joe Radio after a lengthy lengthy hiatus, joining myself and Matty,. We go over Gemini missing the mark, the political persecution of Rundo and Rousseau, breaking bad news for Belly Willis, wax on wax off an sheit, and so very much.https://nicecrew.tv/static/streaming-playlists/hls/cdf00774-d885-4d4c-beed-d467e802055a/4bdf0b6a-2f6f-4c8c-85b1-dd44d0329405-master.m3u8https://nicecrew.tv/videos/embed/rqWGN86wFgWGmmuAopdDv579815252024-03-01T23:14:32.035ZYESJust Joe Radio NOhttps://nicecrew.tv/w/imMfazu2WLS3Sq83hQ193phttps://nicecrew.tv/lazy-static/thumbnails/3e572de5-eac8-45d1-94bd-7ee1c9c24777.jpgHellDivers 2 - Made with ClipchampThis mission was a cakewalk compared to higher difficulties where it becomes absolutely insane.https://nicecrew.tv/static/streaming-playlists/hls/8c921d88-8efa-4763-b750-9d9f650af0ab/b3d58c58-be66-45a8-a5c4-e190357ff76d-master.m3u8https://nicecrew.tv/videos/embed/imMfazu2WLS3Sq83hQ193p1275582024-02-26T03:55:20.593ZYESMain omega_variant channelNOhttps://nicecrew.tv/w/mMUqt29gWXf9TwofyptTqfhttps://nicecrew.tv/lazy-static/thumbnails/73d1e441-e793-4934-83c6-9d1b3d0666fc.jpgMan Sets Himself on Fire to Protest GenocideA man in the US Air Force self immolates to protest the Israeli genocide of Palestinians. Towards the end of the video, a jewish security guard can be seen pointing his weapon at him as he lays burning. https://nicecrew.tv/static/streaming-playlists/hls/a85f8c87-d07a-420f-96bf-fd54c00f70d2/5be660c2-56df-4e55-8f73-106d4804953d-master.m3u8https://nicecrew.tv/videos/embed/mMUqt29gWXf9TwofyptTqf1895972024-02-26T12:35:58.097ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/9tP9t1jo5YV25f7w77nWGkhttps://nicecrew.tv/lazy-static/thumbnails/b6bc61d8-9235-4835-bef0-d41cb059c557.jpgLog Splitter Engine RepairDANG OL DEMON BRAPS PUTTIN PLASTIC IN MY EXAUST INTAKEhttps://nicecrew.tv/static/streaming-playlists/hls/44ab3eec-b506-45c6-9940-6c9f273540a3/83d0499f-113d-4208-adcd-9f7c4dbed809-master.m3u8https://nicecrew.tv/videos/embed/9tP9t1jo5YV25f7w77nWGk11755392024-02-29T01:28:35.132ZenginemechanicsfuelforrestryfirewoodYESBrother TylerNOhttps://nicecrew.tv/w/8GwYgATPTJvJwR3aWQ1V5Mhttps://nicecrew.tv/lazy-static/thumbnails/a4c09e29-296d-451a-86d3-cabd208db7f0.jpgDagger Advert (oblivion)Contact @rose to buy (if it's not already sold)https://nicecrew.tv/static/streaming-playlists/hls/3e58ceb5-7194-4396-a33c-26b370657689/d8ce9eae-a889-4fc8-8308-ca9b401961f0-master.m3u8https://nicecrew.tv/videos/embed/8GwYgATPTJvJwR3aWQ1V5M535782024-03-01T02:20:20.177ZYESBrother TylerNOhttps://nicecrew.tv/w/mLN9aiTN43J6gwUDDtUPaqhttps://nicecrew.tv/lazy-static/thumbnails/66d5af9b-09a4-4512-8fd9-47dae7381003.jpgHelldivers 2Helldivers 2https://nicecrew.tv/static/streaming-playlists/hls/a837ef2d-fa60-4ed4-b714-4590c1e22dee/17ab3d7d-ab0b-4049-ada1-c60ea9d60144-master.m3u8https://nicecrew.tv/videos/embed/mLN9aiTN43J6gwUDDtUPaq24905152024-03-03T07:37:14.898ZYESMain omega_variant channelNOhttps://nicecrew.tv/w/iqLahhbMwapJSWmxqUo8Efhttps://nicecrew.tv/lazy-static/thumbnails/519e80e9-1ebe-45eb-9646-a84052131610.jpgfirewire 2023-06-02Do you even GPS bro? Fira gets gold and dengue fever, and AI helps us with eating disordershttps://nicecrew.tv/static/streaming-playlists/hls/8d206c1a-24c8-4832-951c-5ca93b5fe016/d7265f92-163b-47a6-a3b2-88177002292f-master.m3u8https://nicecrew.tv/videos/embed/iqLahhbMwapJSWmxqUo8Ef4295372024-03-05T08:36:46.352ZComedyNewsFirewireYESThe FirewireNOhttps://nicecrew.tv/w/wz5Bn4Xy7kMVh8FKLF8zpNhttps://nicecrew.tv/lazy-static/thumbnails/3f4dec13-7375-4004-9c18-86aaedd41535.jpgWelcome to #darkfediWelcome to #darkfedihttps://nicecrew.tv/static/streaming-playlists/hls/f7908b88-1336-41fb-9798-2105d27bfc50/ea97bf97-492b-4485-b405-84ea3525ae51-master.m3u8https://nicecrew.tv/videos/embed/wz5Bn4Xy7kMVh8FKLF8zpN49359922024-03-05T08:53:42.082ZintoductionfediverseYESBrother TylerNOhttps://nicecrew.tv/w/ifpCUHqTzSLZ1kM1eBPt3ihttps://nicecrew.tv/lazy-static/thumbnails/19a6f8c9-7b59-492e-82ef-689e97c0580e.jpgfirewire 2023-04-21Does Hitler really run the yom-yacocoa factory? Just how many inventions is Fat Albert responsible for? Don't forget to stay for the musical finale!https://nicecrew.tv/static/streaming-playlists/hls/8bae561f-e37f-4e8c-8a02-e56d645b8279/437cf7b4-7b01-4d12-bc5a-f1810c3d310b-master.m3u8https://nicecrew.tv/videos/embed/ifpCUHqTzSLZ1kM1eBPt3i3775472024-03-06T06:11:52.700ZComedyNewsFirewireYESThe FirewireNOhttps://nicecrew.tv/w/4ZbtCvTojjbcTHt9bGuX2ahttps://nicecrew.tv/lazy-static/thumbnails/972abc4e-89d4-44ae-ae14-3f80ce353da3.jpgNiceCrew: Not just a name (the song)Happy birthday to the NiceCrew. Cover Art by @ThatMushroomhttps://nicecrew.tv/static/streaming-playlists/hls/20474464-d4fd-40ff-9993-8e153e1e929f/1375ddb3-cfea-4619-9b2b-94d454650345-master.m3u8https://nicecrew.tv/videos/embed/4ZbtCvTojjbcTHt9bGuX2a1105592024-03-07T00:39:07.888ZmusicYESBrother TylerNOhttps://nicecrew.tv/w/sW5MBo99KhV84dtzg5LhuShttps://nicecrew.tv/lazy-static/thumbnails/a26f5109-567f-4652-a109-34d9e453fe17.jpgMeanCrew gaming ep1 tuxkart ScotlandThis video is intentionally this way.https://nicecrew.tv/static/streaming-playlists/hls/da1ab7ec-68fe-4dc3-9b81-a6970cae380a/222d3d6f-6dc7-4546-82c6-29bc049fb8ab-master.m3u8https://nicecrew.tv/videos/embed/sW5MBo99KhV84dtzg5LhuS785132024-03-09T08:21:01.585ZYESBrother TylerNOhttps://nicecrew.tv/w/8D7YeqviZ84YZ9rWWVdnvjhttps://nicecrew.tv/lazy-static/thumbnails/e6262180-252a-4925-a810-7732ad0d4d4d.jpgHelldivers 2: Automoton MissionThis is after the recent game patch/content update. I swear it seems like they make more enemies spawn now.https://nicecrew.tv/static/streaming-playlists/hls/3ddec904-44de-4e65-a2b6-1aab1ba30a88/300ffe04-d13b-4b2a-88e0-1437312f6e6b-master.m3u8https://nicecrew.tv/videos/embed/8D7YeqviZ84YZ9rWWVdnvj1914042024-03-10T03:26:51.258ZYESMain omega_variant channelNOhttps://nicecrew.tv/w/2FmUxNESbzYg2jYYEQ3cYEhttps://nicecrew.tv/lazy-static/thumbnails/a33afa2a-0092-4ddc-bbc1-15f2f427142b.jpgThey are CENSORING my Documentary BEFORE its even released!This is heartbreakinghttps://nicecrew.tv/static/streaming-playlists/hls/0d98078b-9c42-4d53-84cc-bec57fd29c72/87cc629a-52cc-443f-926a-b9632e060c50-master.m3u8https://nicecrew.tv/videos/embed/2FmUxNESbzYg2jYYEQ3cYE453062024-03-10T19:19:29.909Zdocumentaryfilmcensorshipwhitmer fednappingYESRadix Verum ☦NOhttps://nicecrew.tv/w/c7yQHwjRciqJSJ6vsj1DFahttps://nicecrew.tv/lazy-static/thumbnails/7558cfa4-d50a-4048-a3e1-b59fc9b4516a.jpgThe Preemptive Censoring of our Documentary Film!Going live to talk about the censorship of our independent documentary film.https://nicecrew.tv/static/streaming-playlists/hls/59ff39e8-9ad1-46cd-bf87-0fbfe3e34c33/18a1bdc8-cfc2-46dc-9b2c-1bb2da17ee3a-master.m3u8https://nicecrew.tv/videos/embed/c7yQHwjRciqJSJ6vsj1DFa3668002024-03-10T20:05:27.717ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/i1zmSHcA6HcQ2p9i2UnSFrhttps://nicecrew.tv/lazy-static/thumbnails/50d53aff-ed79-4c27-8d2c-e9feb20ec854.jpgCensoring independent documentary films BEFORE they can even be released!This is heartbreaking, please help us spread the word if you can. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #documentary #indie #indiefilm #independentfilmmaker #filmmaking #film #moviehttps://nicecrew.tv/static/streaming-playlists/hls/89bfea7e-504b-458d-9874-f2add75e735f/4de0cb09-ca21-4af1-bf86-b97e364ded49-master.m3u8https://nicecrew.tv/videos/embed/i1zmSHcA6HcQ2p9i2UnSFr4530142024-03-10T19:53:35.694ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/g9DABJbM32ADvsjp9h9Wk7https://nicecrew.tv/lazy-static/thumbnails/a55e81ba-4b2a-4933-879f-f1848731420c.jpg7 Bodies Found on Property of Convicted Sex Offender Jesse McFadden, Including Missing GirlsSeven bodies were found on a piece of property in rural Oklahoma on Monday afternoon during a search for two teenage girls (Ivy Webster and Brittany Brewer) who had been reported missing and were said to have been seen with a convicted sex offender, according to officials with the Okmulgee County Sheriff’s Office. The Oklahoma Highway Patrol issued a missing-persons alert earlier on Monday saying it was believed that the girls had last been seen about 1:30 a.m. in Henryetta in a white Chevrolet pickup with Jesse L. McFadden. Mr. McFadden, 39, is a registered sex offender and rapist who was scheduled to go on trial on Monday in Muskogee County on several charges, including child pornography and soliciting sexual conduct or communication with a minor using technology. A bench warrant was issued after Mr. McFadden failed to appear in court on Monday morning. Other probable victims: Holly Guess, Rylee Elizabeth Allen, Tiffany Dore Guess, and Michael James Mayo. This is still unconfirmed at this time. Sources: https://twitter.com/NatlyDenise_/status/1653181597938581504 https://twitter.com/GlenntheGolden1/status/1653257007313428481?t=cjGdej6JYOi4RvZhSsSnnA&s=19 https://archive.is/CPKDJ https://twitter.com/OHPAlerts/status/1653072044018262017 https://sors.doc.ok.gov/ords/svorp/sors/r/sors/offender-profile?o=05CCA621603D24FCAD73818B60073075&p216_reg_id=1&clear=RP,216 https://oscn.net/dockets/GetPartyRecord.aspx?db=muskogee&cn=CF-2017-01028&id=664549 https://oscn.net/dockets/GetCaseInformation.aspx?db=muskogee&number=CF-2017-01028&cmid=354561 https://www.oklahoman.com/story/news/2023/05/01/jesse-mcfadden-oklahoma-criminal-history-seven-bodies-found/70172765007/ https://nypost.com/2023/05/01/oklahoma-cops-find-7-bodies-including-2-missing-teen-girls/ https://twitter.com/NewsNation/status/1653244990250967046 https://twitter.com/iamlegacy23/status/1653225894834569219 https://twitter.com/iamlegacy23/status/1653364944316801024 https://twitter.com/CAVDEF_George/status/1653...https://nicecrew.tv/static/streaming-playlists/hls/7aae332e-7a84-4da6-bafb-6ab9d8a545ec/eccafb20-585a-4088-8679-ad583b45e2e0-master.m3u8https://nicecrew.tv/videos/embed/g9DABJbM32ADvsjp9h9Wk72960002024-03-10T21:38:16.172Zjesse mcfaddenholly guessivy websterbrittany brewermissing girlsYESRadix Verum ☦NOhttps://nicecrew.tv/w/gKanrTC5Cy3wuzNkuhRXU1https://nicecrew.tv/lazy-static/thumbnails/21c0a54f-05c2-4127-a07e-ca8c7649d060.jpgDocumentary Film Update!!I have an update on the status of the documentary! Official YouTube Channel for the Doc: https://www.youtube.com/channel/UCa86C9KrP8u1ptZU_eOJRmA Trailer: https://youtu.be/APGf2vabwmw Fundraiser for doc: https://www.givesendgo.com/RadixVerum Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #Michigan #Documentary #Film #Indie #Fundraising #Whitmer #FBI #IndependentFilm #KidnapandKill #FBITerrorPlot #gretchenwhitmer #AdamFox #BarryCroft #BrandonCaserta #DanielHarris #GrandRapidshttps://nicecrew.tv/static/streaming-playlists/hls/7f7fd619-e7bd-4817-89d7-99b0a065096c/c6e5bc06-d680-4988-b031-a5645779b31a-master.m3u8https://nicecrew.tv/videos/embed/gKanrTC5Cy3wuzNkuhRXU1281022024-03-10T20:56:52.120Ztrailerindependent filmdocumentaryindie filmmichiganYESRadix Verum ☦NOhttps://nicecrew.tv/w/eUiisJHU5THEtgmqamUKdWhttps://nicecrew.tv/lazy-static/thumbnails/db14dcb7-7657-48b2-baf0-7f9fcb0b5e4a.jpgDark Knights: Adam Lanza's Creepy 2011 Call to an Oregon Radio ShowAdam Lanza, the alleged Sandy Hook Shooter called into a radio program called Anarchy Radio back in 2011. He talked about Travis the Chimp and he likened his attack to those of teen mall shooters. Adam Lanza's psychiatrist was convicted of child sex crimes. His father Peter Lanza was involved in the #LIBOR banking scandal, as was the father of Aurora "dark knight" shooter and obvious MKUltra victim James Holmes. Was Adam a victim of child sexual abuse? Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #AdamLanza #SandyHook #TravisTheChimp #Radio #Radiocall #Oregon #peterlanza #libor #nancylanzahttps://nicecrew.tv/static/streaming-playlists/hls/70942409-9ab6-4e71-9fcd-9d5334a494fa/c5bc89a0-5d7e-492e-bc94-af08810a9c0a-master.m3u8https://nicecrew.tv/videos/embed/eUiisJHU5THEtgmqamUKdW1001532024-03-10T21:11:01.266Zadam lanzasandy hookradio calloregon radio showanarchy radioYESRadix Verum ☦NOhttps://nicecrew.tv/w/wYNR8mz1YD9MtQ3GDL58jHhttps://nicecrew.tv/lazy-static/thumbnails/fba8da47-f770-43b7-be17-95fc9619d157.jpgIt's been far too long since we have talkedIt's been a while... Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/fae0ae71-64c0-431a-a067-ad22b51508b9/a0be8883-f8fc-45a3-9abc-e9a94cc34a9d-master.m3u8https://nicecrew.tv/videos/embed/wYNR8mz1YD9MtQ3GDL58jH470012024-03-10T21:00:35.693ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/9zxQqeXgzZCuGK3iZqYdHBhttps://nicecrew.tv/lazy-static/thumbnails/71fbd597-2a09-4500-ab39-95b3aa54be62.jpgI Need Your HelpHello everyone, we are approaching completing the interviews for the documentary I am working on. I have a few more interviews I need to do, in about 5 different locations so I have decided to try to make it a road trip and get it all knocked out at once. I am looking at renting a van that has a bed in it and driving to each location for filming. We have come so far and I am so proud of the work we are doing. This documentary is going to be amazing. I am so excited to share it with you once it is complete! Donate to the film: https://kandkfilm.com/donate https://givesendgo.com/RadixVerum #film #filmmaking #documentary #indiefilmhttps://nicecrew.tv/static/streaming-playlists/hls/457845c7-a549-4574-8ef7-4a3d2ec4843d/4008021e-7b8e-4a59-bb4b-3269c28bc436-master.m3u8https://nicecrew.tv/videos/embed/9zxQqeXgzZCuGK3iZqYdHB610002024-03-10T21:04:07.661ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/8Pr4cfnY4ijPkUmwNqRiX8https://nicecrew.tv/lazy-static/thumbnails/58e702dd-eb73-448f-ade5-bd6f0bd065dd.jpgOn Wheat Waffles and His LiesI wanted to make a quick video addressing one of your comments about my prior video on Wheat Waffles' "face ratings" which I thought was very insightful. My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://kandkfilm.com https://cash.app/$RadixVerum Thanks for watching my content friends! #blackpill #redpill #wheatwaffles #looksmaxxing #looksmaxing #mogged #gymcels #dating #relationships #SMVhttps://nicecrew.tv/static/streaming-playlists/hls/3f4f5e58-e6e5-480c-af63-893c08a99549/8507d3f5-3dbe-4f24-b6c4-cfc8d718acff-master.m3u8https://nicecrew.tv/videos/embed/8Pr4cfnY4ijPkUmwNqRiX81019022024-03-10T21:12:16.474ZblackpillredpillpuadatingrelationshipsYESRadix Verum ☦NOhttps://nicecrew.tv/w/3RBhZVCXBdvPr5JsMoWnLzhttps://nicecrew.tv/lazy-static/thumbnails/78d72f20-c69c-457d-94e0-dcb0ce60fe2e.jpgGames Are Fun ꟾ Analysis of Catherine Tramell from Basic InstinctWe are going to be embarking on a character analysis of Catherine Tramell, the main antagonist in Basic Instinct, a 1992 neo-noir psychosexual thriller starring Michael Douglas and Sharon Stone. We will also touch on some elements from the 2006 sequel, Risk Addiction. Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix K and K Film: https://kandkfilm.com https://givesendgo.com/RadixVerum My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #basicinstinct #catherinetramell #antisocialpersonalitydisorder #femalepsychology #femalepsychopathy #noir #film #review #analysis #thriller #narcissisticpersonalitydisorder #pathological #mindgames #sociopathy #riskaddiction #deception #manipulationhttps://nicecrew.tv/static/streaming-playlists/hls/171f78e1-0cbb-439b-8ffe-6db0632c7c7d/ea7d16d6-4928-47f2-bdfa-5126b6a93d94-master.m3u8https://nicecrew.tv/videos/embed/3RBhZVCXBdvPr5JsMoWnLz939002024-03-10T21:11:08.718Zbasic instinctcatherine tramellbasic instinct 2risk addictionpathological narcissismYESRadix Verum ☦NOhttps://nicecrew.tv/w/m3jfKrvdeUKT2FexbPkzs1https://nicecrew.tv/lazy-static/thumbnails/e80c13de-6be7-4d3a-a58f-9ed578514db2.jpgThe Fed Was "Simulating" a Financial Crisis Due to the Housing Sector in 2005? The "Teal Book."The publication of a CNN article last week has received little attention or coverage, despite a very interesting revelation buried about 3 paragraphs into the article about the Fed. Current Fed Chairman Jerome Powell recently spoke at a European Central Bank Conference in Portugal where we mentioned the "Teal Book." When asked how the Fed plans for the worst-case scenarios on the geopolitical front, he first responded in Fedspeak. “We use our tools to achieve our legal mandates,” he said. But when pushed, he opened up about a top-secret Fed tool: the Teal Book. At every Fed policy meeting, he said, “our staff works up six or seven or eight alternative simulations,” he said. “All the participants read those and think about them and talk about them. It’s very helpful because you can’t get too focused on the modal paths in a world where it’s very hard to predict the economy,” he said. The policy scenarios considered by the Fed are quite sensitive. “Imagine how the market would have reacted if it knew that [former Fed Chair Ben Bernanke] was gaming out a financial crisis due to the housing sector in 2005,” said Brusuelas. Source: https://www.cnn.com/2023/06/29/investing/premarket-stocks-trading/index.html Support my work!: Venmo: https://venmo.com/RadixVerum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #federalreserve #fed #banking #centralbank #stresstest #wargaming #financialcrisis #globalfinance #markets #economiccollapse #economicnews #analysis #housingmarket #subprime #lehmanbrothers #wallstreet #janetyellen #benbernanke #jeromepowell #inflation #recession #depression #bidenomics #joebidenhttps://nicecrew.tv/static/streaming-playlists/hls/a24982a6-1d28-4e86-9346-15a76418b5f0/152cfa4e-9105-42ca-906b-479837247e98-master.m3u8https://nicecrew.tv/videos/embed/m3jfKrvdeUKT2FexbPkzs1851002024-03-10T21:09:53.385Zfederal reservethe fedjanet yellenben bernankejerome powellYESRadix Verum ☦NOhttps://nicecrew.tv/w/ed3Jdgjk8rKyLLb1TWhjjLhttps://nicecrew.tv/lazy-static/thumbnails/cf37c0e5-d586-495a-8b12-1c9a41bcb1b9.jpgThe Covert Narcissist ꟾ The Hidden PredatorThere are some people out there who are very good at concealing their true nature. A profoundly destructive person can hide behind the mask of "normalcy." These individuals can be hypersensitive. They seem to oscillate internally between grandiosity and feelings of deep insecurity, inferiority, and inadequacy. These simmering feelings seem to manifest in a far more subtle way, making it hard to pick up on. Eventually, though, you might start to notice the levels of self-referencing (all about them). This is what makes them so painfully sensitive to any type of criticism. They view this as a "betrayal," you "owed" them adoration and constant praise. Their black-and-white thinking causes them to view you as an "enemy." You're either for them or against them. They are super sensitive to insults or feeling like they have been "slighted." They may not acknowledge these feelings to anyone, but rather bottle them up inside while they brood and seethe about it. The interesting thing about them is their latent rage. There is this perpetual self-victimization, "If only people appreciated me," "If only people gave me the respect I deserve," "If only others saw my specialness," "If only others recognized my greatness," etc. (special boy syndrome) Their greatest fear is being exposed because they are so painfully self-aware. They tend to guilt trip and they are prone to envy and bitterness. They allow these feelings to fester, turning into rage and contempt. They want to be seen as humble, meek, and non-threatening. They are very aware of and focused on how other people perceive them. They take pleasure in the misfortune of others. They delight in it. They don't outwardly express these feelings because they know it would contradict that veneer of meekness, they worked so hard to construct. Music Credit: @vibeaimusic Support my work!: Venmo: https://venmo.com/RadixVerum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix https://radixverum.locals...https://nicecrew.tv/static/streaming-playlists/hls/6af568ac-1cf3-49c9-960b-75f61186f888/3b108929-d4d2-4778-a9a4-4d037a4dabc6-master.m3u8https://nicecrew.tv/videos/embed/ed3Jdgjk8rKyLLb1TWhjjL1719012024-03-10T21:26:10.608Znarcissismcovert narcissismvulnerable narcissismnpdself careYESRadix Verum ☦NOhttps://nicecrew.tv/w/4dpkC5Pe5BcqEF5JLnWADNhttps://nicecrew.tv/lazy-static/thumbnails/dd70846d-46e2-4b26-bd6d-3de2401f8e09.jpgDocumentary Update: Trip was BIG SUCCESS!!!Hello everyone! I wanted to give you all an update about how my last trip went, how the interviews went, and what our current status is. I am SO EXCITED to get this film completed and share all these interviews with you. SUPPORT THE FILM: @kandkfilmofficial https://kandkfilm.com https://givesendgo.com/radixverum Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #kandkfilm #documentary #film #indiefilm #filmmakinghttps://nicecrew.tv/static/streaming-playlists/hls/1a06b955-d669-42d6-8d5e-9ef8acc21118/d613837c-be19-4dc2-b4b5-4b1ca2a7fb06-master.m3u8https://nicecrew.tv/videos/embed/4dpkC5Pe5BcqEF5JLnWADN308012024-03-10T20:58:43.993ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/9bnd1dz96RkohB9JT1pwVWhttps://nicecrew.tv/lazy-static/thumbnails/8aefe231-b708-4521-8cf6-9e487615548b.jpgThe Execution of Craig Robertson by the Cowards at the FBIOn August 9th, news broke that a “Utah man” was shot and killed during an FBI raid. The deceased suspect was Craig Robertson. The FBI confirmed that the raid was related to an investigation into threats against President Joe Biden and others. The shooting occurred at 6:15 AM in Provo, Utah while the agents were “attempting to serve a warrant,” the FBI said. Initial media reports make it sound as if there was a shootout, but the FBI has not made that claim. We still do not know if Robertson was armed when he died or if he brandished a gun or shot at agents. My article: https://thebreakdownnews.com/radix-verum-the-execution-of-craig-robertson-by-the-cowards-at-the-fbi/ Other Links: https://twitter.com/NotRadix/status/1689445201331236865 https://twitter.com/Mrgunsngear/status/1689642980477734914 Support my work!: Venmo: https://venmo.com/RadixVerum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #fbi #craigrobertson #utah #provo #swat #raid #murder #homicide #news #useofforcehttps://nicecrew.tv/static/streaming-playlists/hls/423b9dc1-828a-40aa-b64f-75853a9bbc68/d9d6388c-5a28-4dba-bb20-99a7c27c1877-master.m3u8https://nicecrew.tv/videos/embed/9bnd1dz96RkohB9JT1pwVW985012024-03-10T21:12:28.178Zfbicraig robertsonswatraidlaw enforcementYESRadix Verum ☦NOhttps://nicecrew.tv/w/cJfRzgrMz9YmA9a1uLauJUhttps://nicecrew.tv/lazy-static/thumbnails/a2922966-ee12-44bc-bad9-ff8705ed61ec.jpgFBI Agent from Whitmer Fednapping Hoax DIDN'T Share Intel with Chief of Capitol Police about J6!!Tucker Carlson just released an explosive interview with the former head of the U.S. Capitol Police on January 6, Chief Steven Sund. During the 55-minute interview, Sund reveals that Steven D'Antuono, the former Director of the FBI Detriot Field Office during the Gov. Whitmer Fednapping Hoax who was then promoted to be Assistant Director of the Washington DC Field Office on January 6, had intelligence on expected J6 violence for DAYS leading up to the rally but did not pass that intelligence on. The set up is being exposed. I wanted to give people more information on D'Antuono and his role in the fednapping hoax. @kandkfilmofficial Official Trailer for Kidnap and Kill: an FBI Terror Plot: https://youtu.be/APGf2vabwmw Links: https://twitter.com/TuckerCarlson/status/1689783814594174976 https://twitter.com/NoVA_Campaigns/status/1689800767069102080 https://archive.is/P1S0a https://twitter.com/NotRadix/status/1666224622491009024 https://www.revolver.news/2023/06/steven-d-antuono-former-head-of-fbi-jan-6-pipe-bomb-investigation-comes-clean-with-stunning-admission/ https://www.theblaze.com/news/dantuono-testimony-mar-a-lago-raid Support my work!: Venmo: https://venmo.com/RadixVerum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #Tucker #TuckerCarlson #StevenSund #J6 #FBI #DOJ #News #BreakingNews #DChttps://nicecrew.tv/static/streaming-playlists/hls/5efaeb0b-7f3a-42e1-b4bc-8d77f46f8bd0/eea986eb-5fb8-4212-b12d-6bd0b954208a-master.m3u8https://nicecrew.tv/videos/embed/cJfRzgrMz9YmA9a1uLauJU1441012024-03-10T21:22:35.520ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/k7QWZ51RKTU3GSG8TcGkjqhttps://nicecrew.tv/lazy-static/thumbnails/c1757a1d-0ff0-4b22-b459-f81aac008c41.jpg3rd Whitmer Fednapping Trial to Begin Monday, Adam and Barry's Appeals!The third trial in the Gov. Whitmer "kidnapping plot" begins on Monday, August 21 in Antrim County. Eric Molitor and William and Michael Null are facing charges of "providing material support" but these men are innocent. They are family men. This farce must end. @kandkfilmofficial K and K Film website: https://kandkfilm.com Null Brothers GiveSendGo: https://www.givesendgo.com/TEAMNULLFAMILYSTRONG Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #michigan #whitmer #fbi #trial #court #appeal #documentary #film #kandkfilmhttps://nicecrew.tv/static/streaming-playlists/hls/9ad2432f-02c0-4d98-9be0-e6740ce51c68/a0a372fb-9cc3-44c3-aac2-fa721da9e540-master.m3u8https://nicecrew.tv/videos/embed/k7QWZ51RKTU3GSG8TcGkjq545002024-03-10T21:03:53.091Zmichigangovernorgretchen whitmerwhitmerfbiYESRadix Verum ☦NOhttps://nicecrew.tv/w/hB5tbQYQiGmpjEZJoPhijhhttps://nicecrew.tv/lazy-static/thumbnails/b64f4ffa-e186-4eb8-a371-737f039094d8.jpgTrial by Media: High Profile Cases are Tried in the Court of Public OpinionMusings about whether or not a fair trial is possible in the age of mass communications and mass media: High-profile cases are often tried by the media in the court of public opinion. We all know the court of public opinion is based on reputation, looks, revenge, "shaming", cancel culture, and the whims of the mob. In the social media age, it's more important to have a good story than it is to even have the law on your side. As FBI Special Agent Henrik Impola said to FBI CHS Steve Robeson during a December 2020 interrogation "We have a saying in our office, never let the facts get in the way of a good story." Indeed, having a good story and a sympathetic victim matters more than having facts on your side in the court of public opinion for which there are no rules or procedures or "fairness." There are no standards of evidence and accuracy - there is only how you are portrayed over the airwaves. The speed of the internet and the 24-hour news cycle exacerbate this as a good story that resonates with people emotionally can spread faster than the actual facts. The media has been around for a long time, that isn't new. But the internet and social media are a relatively new phenomenon. This has changed how the media is used and by whom. Now powerful corporations and government entities with resources are using the court of public opinion as an alternative to actual legal proceedings. They are creating a new framework for dispute resolution and "social" justice. It's more effective to present your case on social media than it is in court sometimes. All of this highlights the massive failings of the current criminal justice system that must be reformed. What do you think? Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum Donorbox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #co...https://nicecrew.tv/static/streaming-playlists/hls/86780124-e5de-4d29-b093-d21633349ab8/b014368d-60ed-43f1-b69b-a06a33e54f08-master.m3u8https://nicecrew.tv/videos/embed/hB5tbQYQiGmpjEZJoPhijh934002024-03-10T21:11:53.272Zmediamass mediapublic opinionfair trialcourtYESRadix Verum ☦NOhttps://nicecrew.tv/w/3niiRN88hZSopS57wxAS7Phttps://nicecrew.tv/lazy-static/thumbnails/0729ff87-a1a8-4bbb-9062-75dfff78c2c8.jpgThey Shut Down my Gov. Whitmer "Kidnapping Plot" Trial Streams: GO HERE INSTEAD!Please head over to my Twitter or Odysee to continue our coverage of this trial. https://t.co/kHAHwgrsxR Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/132b9017-fb3e-4b1b-bba7-688f936ab913/0e792ca4-502e-49c6-9fc6-1d00cae77ffa-master.m3u8https://nicecrew.tv/videos/embed/3niiRN88hZSopS57wxAS7P216022024-03-10T20:57:38.658ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/cUNyVqqbLJHVgSix2AufhBhttps://nicecrew.tv/lazy-static/thumbnails/d0850251-1755-42ad-8709-d9257adbcbf8.jpgFBI & BOP Hit? Derek Chauvin Stabbed 22 Times by "Former" FBI InformantJohn Turscak, a 52-year-old former Mexican Mafia FBI snitch, has been charged with attempted murder for stabbing former Minneapolis police officer Derek Chauvin in a federal prison in Tucson. The complaint says Turscak attacked Chauvin inside the law library at the Federal Correctional Institution in Tucson, Arizona. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #minneapolis #georgefloyd #derekchauvin #fallofminneapolis #FBI #BOP #prison #federalprisonhttps://nicecrew.tv/static/streaming-playlists/hls/6073e64c-8f5c-4653-a0ef-25df668dd21b/9a81559f-c98a-45df-a183-3541f93c551e-master.m3u8https://nicecrew.tv/videos/embed/cUNyVqqbLJHVgSix2AufhB2053002024-03-10T21:24:02.574Zderek chauvingeorge floydblmfbibopYESRadix Verum ☦NOhttps://nicecrew.tv/w/ahUtHNy5xNhwNd35k2ijrNhttps://nicecrew.tv/lazy-static/thumbnails/a95c4e90-076d-436c-96ba-5191779dca6d.jpgThe Dissolution of Destiny and Melina's "Open Marriage"Streaming couple Destiny and Melina Göransson are planning to divorce after flaunting their "open" marriage publicly for years. Destiny is an almost 35-year-old man who is known for his obnoxious personality and progressive views. Melina is a decade younger than him and a Swedish influencer. Both Göransson and Destiny are also "bisexual" and extremely online. According to Destiny's fans on his subreddit, the streamer revealed that he was done with Göransson after she fell for an abusive guy. "I'll have a small convo when I'm back about things, I'm not gonna 'nuke' Melina or anything, but the last two months (and two weeks) have been a massive mindf*ck for me, watching her become obsessed with a toxic/abusive guy (when I visited Sweden last, he gave Mel an ultimatum to divorce me and then threatened to yeet himself when she didn't do it, among 20 other abusive/manipulative things he's done) and endlessly make excuses for him, so I'm out," a screenshot of a Discord message showed. The divorce rumors come after Göransson has reportedly been in Sweden for six months due to a trial, frequently streaming with a man who goes by Memetix. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #destiny #melina #marriage #relationships #toxicrelationships #dating #influencers #redpillhttps://nicecrew.tv/static/streaming-playlists/hls/4b3e7d2b-4a23-4361-92f8-5c2f973494f8/617b23b3-55b3-4ae1-b546-4ab8a40cc48c-master.m3u8https://nicecrew.tv/videos/embed/ahUtHNy5xNhwNd35k2ijrN2661002024-03-10T21:33:19.442ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/vSKy4F8LbKWoW9C7Yyhcgqhttps://nicecrew.tv/lazy-static/thumbnails/03f8d4aa-819a-4ad3-bf62-37a270b8e76e.jpgWomen, we need to be less prideful.We are going to be talking about pride and women being too prideful. Oxford defines pride as "the quality of having an excessively high opinion of oneself or one's own importance.” In ancient Greek, hubris referred to "outrage": actions that violated natural order, or which shamed and humiliated the victim, sometimes for the pleasure or gratification of the abuser. While pride and hubris are connected, they are two different things. Now pride is a complex emotion, and it isn’t bad on its own. We all take pride in our work at times and in our families and children. But there is a huge difference between Godly confidence and pride. Remember that pride is a sin. In relationships, the manifestation of pride can lead to resistance, hindering the growth of love and understanding. I wanted to talk about how particularly it may contribute to women being resistant to men during moments of anger. Whether it stems from a desire to assert independence, fear of vulnerability, or a need to protect oneself emotionally, this resistance may hinder the development of a deep and meaningful connection. Pride is that resistance to submission to a man or to God’s will. Unfortunately, society is selling women liberalism as “freedom,” and devaluing and degrading yourself as “empowerment.” “She’s a strong independent woman who don’t need no man,” – is the prideful attitude so many women have been indoctrinated with, and yet - It’s estimated that 45% of women ages 25–44 will be single and childless by 2030, according to a study by Morgan Stanley. Proverbs 31:10-31: "Who can find a virtuous woman? for her price is far above rubies..." Proverbs 31:26: "She openeth her mouth with wisdom, and in her tongue is the law of kindness." Proverbs 31:30: "Favour is deceitful, and beauty is vain: but a woman that feareth the Lord, she shall be praised." Women need to start enforcing these standards on themselves and other women. If you have a friend and you hear her smearing men or being a...https://nicecrew.tv/static/streaming-playlists/hls/f1ef0ccd-e1b6-4256-812f-4897d8a12f0a/31c8cc88-f1aa-4437-b1e6-96d3cfc8f9ff-master.m3u8https://nicecrew.tv/videos/embed/vSKy4F8LbKWoW9C7Yyhcgq1179022024-03-10T21:17:27.448ZrelationshipsdatingredpillwomenprideYESRadix Verum ☦NOhttps://nicecrew.tv/w/rafn8U4KDLjxXJR2hwh3u9https://nicecrew.tv/lazy-static/thumbnails/a6fae09a-8178-432b-a210-03c9cd264feb.jpgVivek Ramaswamy @vivek-2024 Calls Whitmer Hoax "Entrapment" on CNN & The FBI Charges my Friend.I am so pleased that @vivek-2024 brought attention to the FBI's Governor Gretchen Whitmer "kidnapping plot" hoax! I was also very happy to see him mention federal involvement on the infamous day in January 2021. It is important for the @CNN audience to be exposed to facts and truth. The government finally replied to Adam Fox & Barry Croft's Appeals Briefs. The FBI announced they are charging my friend the journalist Steve Baker for doing journalism on that infamous day. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #cnn #townhall #vivek #whitmer #fbi #debatehttps://nicecrew.tv/static/streaming-playlists/hls/cbbf0347-e951-4468-9474-a1833e8d99c8/e7eb4a3b-3f6a-4597-abc1-df5e0d011315-master.m3u8https://nicecrew.tv/videos/embed/rafn8U4KDLjxXJR2hwh3u91832002024-03-10T21:23:22.652Zvivekvivek ramaswamycnntownhalldebateYESRadix Verum ☦NOhttps://nicecrew.tv/w/rqLhuhQzDb2iEe3KmuUZSThttps://nicecrew.tv/lazy-static/thumbnails/2590a31a-1b8a-400c-b83d-1886cf1a760f.jpgWhitmer & Husband Cry "Threats" in Latest Ploy for Sympathy as Fednapping Hoax CollapsesOn January 2, 2024, Michigan Governor Gretchen Whitmer and her husband Dr. Marc Mallory did a sit-down interview with Michigan public broadcasting TV. They blamed her husband's early retirement on "threats" they received in the form of "crank calls" during the "kidnap plot" trial. Meanwhile, the families of the men who were targeted and victimized were disarmed, doxed, and had no private security detail let alone a team of federal, state, and local law enforcement assisting them. Whitmer must have forgotten the interview she did a year before where she and her husband blamed "covid" for his early retirement. https://www.fox2detroit.com/news/michigans-first-gentleman-says-he-retired-from-dental-practice-early-due-to-threats-at-time-of-kidnap-trial Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #whitmer #michigan #marcmallory #firstgentleman #trial #court #acquittals #kidnapplot #covidhttps://nicecrew.tv/static/streaming-playlists/hls/cde99bae-8811-451d-89f9-3e89e940fdab/d9403c79-2707-4f65-9bab-cc48f32c651a-master.m3u8https://nicecrew.tv/videos/embed/rqLhuhQzDb2iEe3KmuUZST1161002024-03-10T21:23:41.777Zgretchen whitmermichiganmarc mallorykidnap plotfednappingYESRadix Verum ☦NOhttps://nicecrew.tv/w/iyvGzYESYwNveoPdZvTJQzhttps://nicecrew.tv/lazy-static/thumbnails/764cc5fe-425a-4a12-b421-18de14e7c211.jpgEmerald Robinson Show: Joshua Schulte and Vault 7Emerald Robinson Show: Joshua Schulte and Vault 7https://nicecrew.tv/static/streaming-playlists/hls/8e357603-128a-4350-a00d-1f130ca4d8d1/6bee5806-8981-44ac-b813-4d0b55f0c070-master.m3u8https://nicecrew.tv/videos/embed/iyvGzYESYwNveoPdZvTJQz479002024-03-10T21:12:16.207ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/85n2YceAHQpY68mpyNdwdqhttps://nicecrew.tv/lazy-static/thumbnails/fb08419a-3a19-402d-b45d-df0d5bd1b209.jpgBridgit Mendler: Former Disney Child Star Turned CIA-Backed Female Elon Musk "Space CEO"Former Disney child star Bridgit Mendler announced the launch of her new "space" startup - Northwood Space - which is backed by Silicon Valley venture capital firms like Founders Fund, Andreessen Horowitz, and Also Capital. Northwood Space aims to "build satellite ground stations that are designed with mass production and customer flexibility first in mind." Mendler and those around her seem to glow like the sun, with intel connections abounding. Her husband worked for Lockheed Martin and intel-cut out Mitre Corporation and grew up in Northern Virginia. He and his entire family appear to be extremely well-connected. Is she aiming to be the new Elizabeth Holmes and Theranos? Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #bridgitmendler #disney #northwoodspace #siliconvalley #startup #vc #space #lockheedmartin #mitre #christineblaseyfordhttps://nicecrew.tv/static/streaming-playlists/hls/394be888-49e0-45cc-a63b-27319760b688/41bbfaf8-b512-47a4-83bb-8af213abb235-master.m3u8https://nicecrew.tv/videos/embed/85n2YceAHQpY68mpyNdwdq1616002024-03-10T21:23:58.739Zbridgit mendlergriffin cleverlynorthwood spacespacechristine blasey fordYESRadix Verum ☦NOhttps://nicecrew.tv/w/urV8MXojD7U5A9knqHGP5Ehttps://nicecrew.tv/lazy-static/thumbnails/fde30ff6-3b8d-43f7-8ba2-3a33d48f8f35.jpgSomething Strange Is Going On ꟾ The Pentagon Leaks & Jack TeixeiraThere is something very strange going on with the so-called "Pentagon Leaks," story. It's very clear that there is much more to the story than the "official narrative," but there are many possible explanations. The "leak" could be real. The "leak" could be a psyop. The leak could be real but could also be psyop. This kid might have just been a "special boy" wanting to flex to his Discord gamer friends. This kid might be a patsy being framed and set up as a fall guy. It is still too soon to tell, but it is very important that we start asking these questions. Sources: https://twitter.com/GonzaloLira1968/status/1646577687673159680 https://redstate.com/jenvanlaar/2023/04/13/how-did-jack-teixeira-gain-access-to-the-documents-he-leaked-and-why-were-msm-stories-about-him-stealth-edited-n730910 https://twitter.com/GonzaloLira1968/status/1646930517726736387 https://www.moonofalabama.org/ https://twitter.com/bidetmarxman/status/1646925163475402752 https://twitter.com/Kanthan2030/status/1647022046130348035 https://greenwald.locals.com/post/3847099/the-same-establishment-playbook-is-used-to-malign-the-character-of-leakers-and-distract-attention-fr https://twitter.com/ggreenwald/status/1647220760518197248 https://twitter.com/MLiamMcCollum/status/1646891987919048704 https://twitter.com/KimDotcom/status/1646646117541740544 https://twitter.com/imetatronink/status/1646604825583587329 https://twitter.com/kgosztola/status/1646911252906508289 https://twitter.com/realjoshuareid/status/1646876054982733825 https://archive.is/blNwS https://twitter.com/ClimateAudit/status/1646875035137724422 https://archive.is/Tq7JG Teixeira Indictment: https://assets.bwbx.io/documents/users/iqjWHBFdfxIU/rW0LJFqDuks8/v0 Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #Pentagon #...https://nicecrew.tv/static/streaming-playlists/hls/e65e38d0-d68e-4250-b792-5839de86f63a/becd985e-c6c7-47d0-939c-7ff59612e32c-master.m3u8https://nicecrew.tv/videos/embed/urV8MXojD7U5A9knqHGP5E4388012024-03-10T22:16:01.767ZPentagon LeaksPentagonLeaksJack TeixeiraAir National GuardYESRadix Verum ☦NOhttps://nicecrew.tv/w/vgik3Sc1B8pt1L2ASLh5jPhttps://nicecrew.tv/lazy-static/thumbnails/34b961cd-156c-4d8b-a5ed-0dd399deac86.jpgAll The World Is A Stage ꟾ Pentagon Leaks ꟾ Jack Teixeira ꟾ PSYWARAll the world is a stage. Who is pulling the strings? Support my work: Cash App: https://cash.app/$RadixVerum Venmo: https://venmo.com/radixverum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #Psywar #PentagonLeak #JackTeixeira #PentagonLeaks #Russia #Ukraine #China #WWIII #Psyops #Mindwar #Censorship #Discord #DiscordLeaks #Mindcontrolhttps://nicecrew.tv/static/streaming-playlists/hls/ecfbdb51-f006-4221-ba9a-9a9d24c23253/9c038378-0a6b-475f-b7f1-05257bf0602c-master.m3u8https://nicecrew.tv/videos/embed/vgik3Sc1B8pt1L2ASLh5jP212012024-03-10T22:27:51.125Zpentagon leakpentagon leaksjack teixeirarussiaukraineYESRadix Verum ☦NOhttps://nicecrew.tv/w/6Cxuc5LMHoJaMhANWj1hXHhttps://nicecrew.tv/lazy-static/thumbnails/6284eb24-6d64-47a0-a7aa-78b97597b472.jpgThe FBI Wants to Destroy This Family. Are You Next?Hello friends, I wanted to share some behind-the-scenes footage from my documentary, "Kidnap and Kill: an FBI Terror Plot." This is Eric Molitor, one of the men who was framed by the FBI in the Gov. Whitmer "kidnapping plot" hoax with his mother Sue, and his two wonderful children. Eric is a family man, as all of these men are. To donate to the documentary: https://kandkfilm.com/donate Official Trailer: https://youtu.be/APGf2vabwmw @kandkfilmofficial © K and K Film #michigan #film #documentary #indiefilm #family #kandkfilmhttps://nicecrew.tv/static/streaming-playlists/hls/2d97df7c-3dfb-4826-bf41-ad5be787f43f/de7ae3d3-fa0b-4644-bc42-8614b11f0dc9-master.m3u8https://nicecrew.tv/videos/embed/6Cxuc5LMHoJaMhANWj1hXH141002024-03-10T22:29:04.607Zmichiganwhitmereric molitordocumentaryfilmYESRadix Verum ☦NOhttps://nicecrew.tv/w/8GJrfwKxC14FeExxhk21arhttps://nicecrew.tv/lazy-static/thumbnails/0d43d87c-dfad-4a93-baae-5caede29411c.jpgFBI's Gov. Whitmer "Kidnapping Plot" Final Trial, Day 9 CommentaryMy Commentary on day 9! Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #news #michigan #trial #whitmer #courthttps://nicecrew.tv/static/streaming-playlists/hls/3e5fdf85-d555-4f5f-aeda-5292dc79c1bb/62bb6af4-fb38-4795-ab63-377d959310b0-master.m3u8https://nicecrew.tv/videos/embed/8GJrfwKxC14FeExxhk21ar564002024-03-10T22:34:17.631ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/oyoTUFDFB9f3CdYsQWuWszhttps://nicecrew.tv/lazy-static/thumbnails/dfca11a4-de16-4000-8aeb-f3477b871d42.jpgBureaucratic Sadism: A Carnival of the GrotesqueWe are going to talk today about something I have been thinking about for a while and this will lend itself to several other videos I will be doing in the future. I want to talk about bureaucratic, institutional, or administrative sadism. The word “bureaucracy” entered our lexicon in the 18th century via French literature. This neologism was coined by the political economist Vincent de Gournay, who considered the absurd possibility of “rule by office,” or “rule by a desk.” Gournay’s model followed the form of more serious government terms, such as “rule by the best,” or “aristocracy,” and “rule by the people,” or “democracy.” Bureaucracy developed more during the French Revolution, whose terror was infamously bureaucratic, with Dossier’s the way to “denunciation,” and then to “condemnation,” and eventually “execution.” The term sadism was coined by Richard von Krafft-Ebing (1867, 1937) in response to the works of the famous French author, the Marquis de Sade, who derived sexual pleasure by dominating others and causing them pain. Krafft-Ebing defined sadism as “the experience of sexual, pleasurable sensations (including orgasm) produced by acts of cruelty, bodily punishment, afflicted on one’s own person or when witnessed in others, be they animals or human beings” (1937, p. 80). Furthermore, he held that the “innate desire to humiliate and hurt” (p. 82) was characteristic of all humans. Sadistic traits and behaviors are quite common. Theodore Millon claimed there were four subtypes of sadism, which he termed enforcing sadism, explosive sadism, spineless sadism, and tyrannical sadism. For the purposes of this video, we are going to focus on enforcing sadism... Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https:/...https://nicecrew.tv/static/streaming-playlists/hls/b6aef5ef-982d-4e8f-8901-2ce7db22b1dd/d8a6a71b-dc47-4ecc-b21b-4c4a3b6fa0ad-master.m3u8https://nicecrew.tv/videos/embed/oyoTUFDFB9f3CdYsQWuWsz1048012024-03-10T22:40:16.625Zsadismbureaucracybureaucratic sadismnarcicissmpersonality disorderYESRadix Verum ☦NOhttps://nicecrew.tv/w/uK3msaJHxZ8bZ7H9H9Bw3khttps://nicecrew.tv/lazy-static/thumbnails/a1782068-ad54-4520-8dd3-1552c3546b60.jpgLucy Letby Part 1: Could She Be Innocent?Lucy Letby is a nurse who has been found guilty of 7 counts of murder and 6 counts of attempted murder of babies at the Countess of Chester Hospital during 2015-16. In part one of a three-part series, we will look at whether convicted neonatal nurse Lucy Letby is innocent and being scapegoated to cover up corruption and failures at the NHS. Sources: https://rexvlucyletby2023.com https://gill1109.com/2023/05/24/the-lucy-letby-case/?amp=1 https://www.chimpinvestor.com/post/do-statistics-prove-accused-nurse-lucy-letby-innocent https://twitter.com/profnfenton/status/1694095193669030110 https://www.normanfenton.com/post/the-lucy-letby-trial-and-verdict-not-everybody-is-convinced-that-justice-was-done https://youtu.be/k12f_VFCbtI?si=bBX2Jq1gfeZdbOz1 https://lawhealthandtech.substack.com/ https://www.dailymail.co.uk/news/article-12440411/Nursing-colleagues-Lucy-Letby-insist-innocent-working-hospitals-baby-unit.html https://themessenger.com/news/internet-sleuths-working-to-prove-lucy-letbys-innocence-insist-evidence-against-baby-killing-nurse-doesnt-add-up https://www.dailymail.co.uk/news/article-12452335/Sudden-unexpected-deaths-three-children-identified-hospital-nurse-arrested-suspicion-poisoning.html https://youtu.be/57KpGQ0Nf8c?si=ysv0q_lr_BRMU5th https://www.chimpinvestor.com/post/the-parallel-universe-of-the-lucy-letby-case https://twitter.com/LawHealthTech/status/1698716451484365300?t=6bPpYbwVDZPYdQnSpyXrhQ&s=19 https://www.chimpinvestor.com/post/sepsis-and-scapegoating-in-lucy-letby-case https://www.nursingtimes.net/news/children/lucy-letby-appeals-murder-conviction-15-09-2023/ https://www.theguardian.com/world/2023/sep/24/texas-death-row-robert-roberson-supreme-court-shaken-baby-syndrome?CMP=share_btn_tw https://www.reddit.com/r/lucyletby/comments/15xuet6/is_there_anyone_here_who_still_thinks_lucy_a/?rdt=64196 Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/ra...https://nicecrew.tv/static/streaming-playlists/hls/e8c2507e-ce05-4550-8f4b-6abf7a7fddd7/64123012-2bc5-4f93-be6f-3bf0fd64dc87-master.m3u8https://nicecrew.tv/videos/embed/uK3msaJHxZ8bZ7H9H9Bw3k4421012024-03-10T23:08:34.234Zlucy letbynursecountess of chester hospitalneonatal nurseserial killerYESRadix Verum ☦NOhttps://nicecrew.tv/w/qNHx9J4z2HajFX3FEFjy7jhttps://nicecrew.tv/lazy-static/thumbnails/df84d971-d455-4584-9d3e-58e384f739da.jpgLucy Letby Part 2: What Do Her Notes Reveal?In August 2023, 33-year-old neo-natal nurse Lucy Letby was found guilty of seven counts of murdering babies and seven counts of attempted murder on six more newborns by a Manchester Crown Court jury after a 10-month trial and twenty-two (22) days of deliberations. Lucy, a Band 5 nurse, was accused of going on a 13-month murder spree between June 2015 and June 2016. She is allegedly the most prolific child serial killer in modern times in the UK. What can we learn from her notes? Dr. Van Der Vaart's Video: https://youtu.be/APOs3zAj0XY?si=LneGe8zuFhJKO5YI Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #lucyletby #trial #truecrime #notes #handwriting #analysishttps://nicecrew.tv/static/streaming-playlists/hls/c8e123af-3c0d-4510-b3fb-2637bbf8c5ae/446af5ba-18be-4eb6-be36-027504314c95-master.m3u8https://nicecrew.tv/videos/embed/qNHx9J4z2HajFX3FEFjy7j1480032024-03-10T22:44:41.348Zlucy letbycountess of chester hospitalserial killertrue crimetrialYESRadix Verum ☦NOhttps://nicecrew.tv/w/346tcACpzwXXo3Pb6ob1z1https://nicecrew.tv/lazy-static/thumbnails/920647f7-a3dd-477e-9cdf-adfffd3fb7fa.jpgThe Trevor Bauer False Accusations Are Worse Than We Thought...Trevor Bauer, a former MLB player who had his life derailed by predatory Instagram model Lindsey Hill who accused him of "violent rape," exposed his accuser in a viral video posted to X which quickly racked up over 60 million views and even drew the attention of Elon Musk. Lindsey Hill appears to have planned and executed an extortion scheme; she just wasn't very good at it because she is not very smart. She took a video of herself that contradicted her false accusations and then withheld that exculpatory evidence for years. But was @BauerOutage actually the victim of a more coordinated attack? Sources: https://www.informationliberation.com/?id=64013 https://www.documentcloud.org/documents/21746980-trevor-bauer-v-lindsey-hill-niranjan-fred-thiagarajah-complaint https://www.nbcnews.com/news/us-news/san-diego-padres-pitcher-jacob-nix-arrested-after-climbing-through-n1064946 Lindsey Hill on @PrimeTimeAlexStein https://youtu.be/i2oAHrj6ojQ @iTalkStudios analysis https://youtu.be/fH3JWNVPG_Q?si=gxx1136PupvJbJT2   Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #trevorbauer #lindseyhill #metoo #believeallwomen #crime #falseaccusations #cancelculture #modernwomen #instagrammodels #narcissim #predatorywomenhttps://nicecrew.tv/static/streaming-playlists/hls/10a0e106-1731-4e1a-8a9c-fa6e8736568a/6e0e4ee1-2199-470b-8017-a5f5054fe949-master.m3u8https://nicecrew.tv/videos/embed/346tcACpzwXXo3Pb6ob1z11888012024-03-10T22:53:08.039Ztrevor bauermlblindsey hillinstagram modelsfalse accusationsYESRadix Verum ☦NOhttps://nicecrew.tv/w/dLyzPwgVK2faNvANpHciUZhttps://nicecrew.tv/lazy-static/thumbnails/1d53c05e-85e0-4e23-943e-84391aa4c5f3.jpgPaul Bellar, Framed in FBI's "Whitmer Kidnapping Plot," UNABLE to Speak to Appeals Lawyer!Ronald Ambrose, Appellate lawyer for Paul Bellar, has filed a Motion on Bellar's placement in Federal Prison, asking for an abeyance on the Appeal until he is able to communicate with Mr. Bellar. Paul Bellar, a member of the Wolverine Watchmen, was convicted in connection with the FBI's Governor Gretchen Whitmer "Kidnapping Plot" case after a jury deliberated for just 5 hours. Five other men have been acquitted in this case. It is my belief all these men are innocent, and I aim to prove it in my forthcoming documentary on the case, @kandkfilmofficial Sources: https://www.documentcloud.org/documents/24018004-people-v-paul-bellar-jackson-cc-motion-to-hold-hearing-on-bellars-placement-in-federal-prison-09-24-23 Documentary Trailer: https://youtu.be/APGf2vabwmw?si=6RzwJhqLd1rw-8ou Documentary Website: www.kandkfilm.com Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #PaulBellar #Framed #Appeals #Court #Trial #Legal #Michigan #Whitmer #FBI #Prison #BOP #Corruption #GretchenWhitmerhttps://nicecrew.tv/static/streaming-playlists/hls/67667847-afd3-4fdb-a5ed-90a1c269858d/f54d27f8-8c2f-4670-b56a-def5fc96b8fb-master.m3u8https://nicecrew.tv/videos/embed/dLyzPwgVK2faNvANpHciUZ657002024-03-10T22:38:02.892Zpaul bellargretchen whitmermichiganwhitmer kidnapping plotwhitmerYESRadix Verum ☦NOhttps://nicecrew.tv/w/6EeHfTyjTzoLJfgtpP6EVXhttps://nicecrew.tv/lazy-static/thumbnails/505080f0-813c-4417-8a78-6858246d69cd.jpgJF Gariépy & the Disappearance of Mama JF (Élora Patoine)On October 3, 2023, the RCMP on PEI put out a call for information regarding a missing woman, Élora Patoine, also known as "Mama JF," who was last seen in mid-June and was reported missing by a "concerned citizen." "RCMP Cpl. Gavin Moore says the investigation began this weekend when police got a call expressing worry about Patoine." The Prince District RCMP and the Major Crimes Unit are investigating. Please pray for Elora and her family. Thanks for watching my content friends! #JFGariepy #MamaJF #EloraPatoine #missing #missingperson #missing411 #canada #RCMP #MajorCrimesUnithttps://nicecrew.tv/static/streaming-playlists/hls/2dd4680d-eff0-46e5-bd66-3d49fe2061e9/4412c073-1604-49e3-adfa-83a6a12b86a9-master.m3u8https://nicecrew.tv/videos/embed/6EeHfTyjTzoLJfgtpP6EVX40510402024-03-10T23:07:13.895ZJean-Francois GariepyElora PatoineMama JFmama jfJF GariepyYESRadix Verum ☦NOhttps://nicecrew.tv/w/wb9wtmFXZ6DxhceqW56fnrhttps://nicecrew.tv/lazy-static/thumbnails/c1e01ab3-2641-467f-bf08-4e7dacf1c9d5.jpgThe Ride is OverEverything is spiraling out of control and things are unsustainable by design. We are in the age of data harvesting/analytics. It seems like the goal is to destroy the US Dollar as the world reserve currency. We already have inflation now, and it is going to get much, much worse. Americans are projected to run out of savings by January 2024 according to a report just released by the Federal Reserve Bank of San Fransisco. Food and utilities are up 20 percent, and gas is up 40 percent in some places. The average cost of a new car is up 8 percent from just last year. The cost of living has simply become too expensive. American credit card debt is over $1 trillion dollars for the first time in history. Interest rates have gone up so most folks are paying around 20 percent interest on these credit cards. The US government has accumulated over $33 trillion in debt that it can’t pay back. The debt has been accelerating at an alarming rate – they have been printing money and the printer can no longer go burrrrrrrr. The government is spending more than they have coming in, so they have to borrow and they have to pay interest on that. We are going to be paying more on debt than defense in the next decade. If you know how much we spend on defense that should make you sick. Right now, on social media, people are being manipulated, nudged, and steered down a primrose path laid out and planned for them in dark rooms by men in suits decades ago. I am reminded of the quote from Cormac McCarthy’s Blood Meridian, from the epigraph. It’s from the French poet Paul Valéry, taken from the 1895 essay “Le Yalou,” about the atrocities of the Sino-French war. It was about the inability of the West to see their own culture for what it really was. A clash is seemingly being set up, a clash of civilizations – so the elites can bring forward order out of chaos. Music Credit: Secrets of the Carnival by Erik M Music Link: https://youtu.be/UYODOfLu7bE?si=hEg36qTwZQnBtgSd License: h...https://nicecrew.tv/static/streaming-playlists/hls/f45cd9f8-7bef-4c8f-894e-5809f991411b/97d156ff-3add-441f-af27-ff16d66744b9-master.m3u8https://nicecrew.tv/videos/embed/wb9wtmFXZ6DxhceqW56fnr313022024-03-10T22:33:56.687ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/8juyVCPCibHEPKAuAJ9qdChttps://nicecrew.tv/lazy-static/thumbnails/ab8d1df7-8772-4646-b59e-a6eb4bf2205a.jpgIs Whitmer Trying to Derail Fednapping Hoax Appeals? Today's Hearing and Request for Help....Today there was a hearing on the placement of Whitmer fednapping defendants Joe Morrison and Paul Bellar's placement in federal prison. Pete Musico had no representation today. Michigan AG claims they have no clue why men charged at the state level were moved to federal prisons outside Michigan and why they are not getting their legal mail while they are trying to appeal. Jada Morrison Give Send Go: https://www.givesendgo.com/GB9U8?utm_source=sharelink&utm_medium=copy_link&utm_campaign=GB9U8 Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #michigan #whitmer #trial #court #news #legal #prisonhttps://nicecrew.tv/static/streaming-playlists/hls/3b44f6c4-2b4d-4890-90f9-4578d6e3585c/6b0c7a91-4848-4c08-a247-9b8d84d0d791-master.m3u8https://nicecrew.tv/videos/embed/8juyVCPCibHEPKAuAJ9qdC819002024-03-10T22:40:58.262ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/qYgfC5CKBA9Apgx9cno2rXhttps://nicecrew.tv/lazy-static/thumbnails/646b4581-eafd-4b87-b183-8103e0d1dfbf.jpgHappy Halloween!!!Happy Halloween everyone!!! Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #halloween #halloween2023 #spooky #cosplay #anime #demonslayerhttps://nicecrew.tv/static/streaming-playlists/hls/ca3660df-0795-496b-bb92-1f1a10a41725/2ab91310-674f-423d-a402-f24ff9117c31-master.m3u8https://nicecrew.tv/videos/embed/qYgfC5CKBA9Apgx9cno2rX33002024-03-10T22:29:41.844ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/r2syhApqXq5Ef2nRBGqNb1https://nicecrew.tv/lazy-static/thumbnails/5952671a-0a71-48fe-ab11-89334bfdf9dd.jpgToday's DISGRACEFUL BOP "Oversight" HearingToday's BOP Oversight hearing was incredibly disappointing... Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #oversight #bop #prison #supermax #congress #news #hearinghttps://nicecrew.tv/static/streaming-playlists/hls/caa8938e-5b14-45b5-bf85-933bc04d259c/cd0e676a-3392-41c4-b5be-75aad24275ea-master.m3u8https://nicecrew.tv/videos/embed/r2syhApqXq5Ef2nRBGqNb11122022024-03-10T22:46:34.685ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/gT31NJsLen4N3EXTCjxPonhttps://nicecrew.tv/lazy-static/thumbnails/23390e7e-9e95-4ad0-ab5b-b773fe5a6d07.jpgMassive New FBI Headquarters in Maryland...The Federal Bureau of Investigation (FBI) has secured approval for a jaw-dropping $300 million sprawling new headquarters in Maryland, in a move that has ignited concerns about the unchecked expansion of government surveillance. From the days of J. Edgar Hoover and his notorious political blackmail files to the present, the FBI has been no stranger to controversy and intrigue. The shadows of the past loom large, reminding us of a history marked by abuse of power and political maneuvering. Now, as the agency gears up for a headquarters twice the size of the Pentagon and bigger than the Kremlin in Moscow3, questions about the extent of government reach and potential abuses of power become more pressing than ever... Donate to Documentary: https://www.kandkfilm.com/donate Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #FBI #Maryland #HQ #Virginia #washingtondc #contract #corruption #oversighthttps://nicecrew.tv/static/streaming-playlists/hls/809940d6-9d64-4f9c-84be-dba107a5e965/54391271-b8ed-4e4c-bec7-91f0bab67c31-master.m3u8https://nicecrew.tv/videos/embed/gT31NJsLen4N3EXTCjxPon1625012024-03-10T22:51:00.947ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/ifhGrHCbytkntsHwtnvaVDhttps://nicecrew.tv/lazy-static/thumbnails/d587499f-468c-475a-93ed-941cfed5b4f0.jpgPeter Nygard, Former Bill Gates Business Partner & Canadian Fashion Mogul, Found GUILTY in Toronto!"Former Canadian fashion executive Peter Nygard has been found guilty of four out of five counts of sexual assault for attacking women at his Toronto office building. Nygard—who is most famous for founding Nygard International, a women’s apparel company—reportedly showed little emotion as the Toronto jury’s verdict was read. He was also found not guilty of one count of forcible confinement. Five women testified during the six-week trial that Nygard attacked and assaulted them between the late 1980s to 2005 in his private bedroom suite. Four of the women were in their 20s, while one was 16 at the time." - DB Nygard faces additional charges in Manitoba, Quebec, and the United States. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #PeterNygard #Nygard #BillGates #PrinceAndrew #JeffreyEpstein #Epstein #Bush #DiNiro #Branson #Fashionhttps://nicecrew.tv/static/streaming-playlists/hls/8baa0f61-2eaf-4844-a9dc-59e5d25b5123/a03bd680-7b22-48f5-a236-d85f7f5b47a7-master.m3u8https://nicecrew.tv/videos/embed/ifhGrHCbytkntsHwtnvaVD2143012024-03-10T22:18:37.140ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/igxGN5hUb53b7SxK3cNqquhttps://nicecrew.tv/lazy-static/thumbnails/906fbb47-33f8-4c09-90eb-aaf95d065263.jpgNo Charges Filed After Brutal Lynching of White Teen by Mob of 15 Black TeensA White student at a Las Vegas High School has died from his injuries, days after he fell victim to a targeted beatdown by up to 15 non-White students, according to Police. The brutal attack—which was recorded and passed around social media—has so far not resulted in any criminal charges and has since been referred to as a modern-day “lynching.” Jonathan Lewis Jr, the victim, was critically injured after attempting to help a smaller friend, after being punched, kicked, and beaten while on the ground by a mob of teens. He was found unconscious and bleeding from the head before being transported to the University Medical Center where he later passed away. Please pray for his family. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #jonathanlewis #lewis #lasvegas #mob #lynching #ranchohighschool #teens #urban #crime #justicehttps://nicecrew.tv/static/streaming-playlists/hls/8bd70d39-371d-4aa7-9bef-f9969713a74c/11e65dac-94de-475e-b2fe-0f21f341afb3-master.m3u8https://nicecrew.tv/videos/embed/igxGN5hUb53b7SxK3cNqqu1023002024-03-10T22:18:47.778Zjonathan lewisjonathan lewis jrlas vegasrancho highmobYESRadix Verum ☦NOhttps://nicecrew.tv/w/mC7zsndoJkK6eoZPy9n1nKhttps://nicecrew.tv/lazy-static/thumbnails/cc89f738-8759-4e47-ba4d-afef88ee1d97.jpgOdysee For Sale, Omegle Shutting Down, YouTube Dying...My rambling thoughts on this concerning situation... Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #internet #technology #odysee #omegle #youtube #tiktok #rumble #alttechhttps://nicecrew.tv/static/streaming-playlists/hls/a7019a1d-e61a-4059-91e4-454eef9a86f5/ddebd5f0-64d5-4624-a6d3-428deb3f601f-master.m3u8https://nicecrew.tv/videos/embed/mC7zsndoJkK6eoZPy9n1nK2299592024-03-10T22:59:49.527Zomegleodyseeyoutubesocial mediatechYESRadix Verum ☦NOhttps://nicecrew.tv/w/kiFzMZyoYGc2W7HfHAuDTshttps://nicecrew.tv/lazy-static/thumbnails/063e77c1-8ea8-4a2e-a02d-1592f6cba54f.jpgThe Glass Eyes of Jeffrey Epstein & Jimmy SavileIn this video, I discuss disgraced "financier" and sex trafficker Jeffrey Epstein's glass eye collection that he had framed and mounted in the entranceway to his New York Townhouse in "row upon row." Elite child sex predator Jimmy Savile also had a glass eye he stole from the corpse of a victim which he had turned into a ring and then a necklace. Is there a deeper meaning to the glass eyes? What do you guys think? Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #epstein #jeffreyepstein #jimmysavile #eyes #glasseyes #allseeingeye #symbolism #crimehttps://nicecrew.tv/static/streaming-playlists/hls/9c55ac1b-a562-4837-ae16-8a855cbf24fc/0a81e874-8cb0-41c5-990a-28faa4c1267c-master.m3u8https://nicecrew.tv/videos/embed/kiFzMZyoYGc2W7HfHAuDTs809002024-03-10T22:19:09.187ZEpsteinJeffrey EpsteinJimmy SavileLeslie WexnerVicky WardYESRadix Verum ☦NOhttps://nicecrew.tv/w/9Ze8vmZj6Rqpq6DqVth5dshttps://nicecrew.tv/lazy-static/thumbnails/b4662b9d-cf85-42b3-ad7d-3c839e0d857a.jpgThe Grandiosity and Lies of Prince AndrewWe talk about the narcissistic lies of Prince Andrew, former Duke of York. We discuss the renewed calls for him to speak to the FBI after this third pedo friend was convicted of child s*x crimes, Peter Nygard. This comes on the heels of the Jeffrey Epstein scandal and the conviction of Ghislaine Maxwell. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #PrinceAndrew #JeffreyEpstein #GhislaineMaxwell #PeterNygard #Narcissism #Deceptionhttps://nicecrew.tv/static/streaming-playlists/hls/48c69870-24de-4bdc-a5f6-f87f30cbb032/3e32d2b8-e113-474e-930c-a7818c1c8518-master.m3u8https://nicecrew.tv/videos/embed/9Ze8vmZj6Rqpq6DqVth5ds605002024-03-10T22:19:18.941Zepsteinjeffrey epsteinprince andrewduke of yorkghislaine maxwellYESRadix Verum ☦NOhttps://nicecrew.tv/w/ixGXVWP7yqdLXTWiKgLWG6https://nicecrew.tv/lazy-static/thumbnails/e9ad408b-8ef3-460c-a5e2-e1d0d8eb6f53.jpgThe Delusions of Megan FoxMegan Fox, the film actress most well known for her role in Transformers and Jennifer’s Body recently talked about how she was addicted to “falling in love” with every co-star. She admits to hurting a lot of people because she didn’t "respect their feelings." She recently published a book of poems titled "Pretty Boys are Poisonous," and is engaged in a very public and toxic relationship with Machine Gun Kelly. Fox is being presented as "stunning and brave" for "sharing her truth," but I wonder if this is not simply another manifestation of narcissism. What do you guys think? Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #meganfox #hollywood #mgk #machinegunkelly #dating #relationships #narcissism #loveaddiction #toxicrelationshipshttps://nicecrew.tv/static/streaming-playlists/hls/8e18a8c4-3655-402c-b1eb-f06306e14d9d/35d8a449-c45f-4661-8617-b663b104905f-master.m3u8https://nicecrew.tv/videos/embed/ixGXVWP7yqdLXTWiKgLWG63982022024-03-10T23:07:22.755Zmegan foxmachine gun kellymgkpoem bookpretty boys are poisonousYESRadix Verum ☦NOhttps://nicecrew.tv/w/tmu9cyFKdMv25TLm6m6EDfhttps://nicecrew.tv/lazy-static/thumbnails/1bb9f378-130a-4262-b409-92051b14dafd.jpgHigh-End Trafficking Ring Serviced "Well-Connected" Clientele in Boston & Virginia, See VA LocationsI would like to take you on a journey to the locations in Virginia where a recent trafficking ring was operating. This is exclusive footage that we obtained visiting the two Virginia locations listed in the criminal complaint. According to the Justice Department, three individuals were arrested on charges of operating a "high-end brothel network" in Massachusetts and Virginia with a clientele that included elected officials, military officers, and government contractors with security clearances. The arrests were made after investigators identified several buyers through surveillance phone records and interviews. The network was described as "sophisticated" and "high-end." As a journalist, it is important to shed light on such issues and bring them to the forefront of public attention. Timestamps: 0:00-0:55 - Intro 0:56-9:10 - Headlines, Breakdown of News Articles 9:11-9:43 - Criminal Complaint 9:43-12:17 - Mosaic District Location, Avalon Apartments 12:18-14:49 - Tysons Location, Hanover Tysons Apartments https://www.cnn.com/2023/11/08/politics/high-end-brothel-network-arrests/index.html Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #boston #virginia #cambridge #fairfaxcounty #northernva #elite #trafficking #news #breakingnews #military #beltway #mosaic #avalon #hanovertysons #tysons #hanleehttps://nicecrew.tv/static/streaming-playlists/hls/dd82f642-a1cf-4c15-a97f-0d83b14371f0/acc28690-0105-4932-84d8-c49b358e111d-master.m3u8https://nicecrew.tv/videos/embed/tmu9cyFKdMv25TLm6m6EDf889012024-03-10T22:19:40.833Zbostonvirginiafairfax countyhigh end brothelhan leeYESRadix Verum ☦NOhttps://nicecrew.tv/w/djnaapeuEC2uLf3t9x8yUihttps://nicecrew.tv/lazy-static/thumbnails/695f9a7b-2eca-4af6-b9f3-0f23a4d3b3df.jpgThis has to be said, sorry.I had to go on a rant, it's tough love but for a good cause. Support the documentary: https://www.kandkfilm.com/donate Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/63be1741-4e52-4b59-96c6-11f131c7e521/f5a37434-c5d4-42f4-925e-d9c44be77997-master.m3u8https://nicecrew.tv/videos/embed/djnaapeuEC2uLf3t9x8yUi1524002024-03-10T22:19:51.774ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/2sztBMMcH77fPPvkoqQ8eShttps://nicecrew.tv/lazy-static/thumbnails/0d43f97f-34ad-43a2-9dd9-ad0e2bf9d8dc.jpgToxic Narcissistic Mother Uses YouTube to Smear DaughterI recently came across a channel called "estranged parents." This channel is run by a woman whose daughter has gone "no contact" with her. The video is a perfect display of the mother's toxic, narcissistic, and abusive behavior. Rather than doing any self-reflection or addressing any points in her daughter's letter that explained why she was going no contact, the mother looks for all kinds of external reasons this could be happening. Anything to justify her abuse and avoid taking accountability for how she treated her daughter growing up, and how she continues to treat her now. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #narcissism #mother #daughter #relationships #abuse #narcissisticabuse #npd #borderlinehttps://nicecrew.tv/static/streaming-playlists/hls/0bcf1b6a-86f6-4800-b8ba-920f1ebb6020/1fa55d17-d73d-463e-b7a3-eaa5d8f50958-master.m3u8https://nicecrew.tv/videos/embed/2sztBMMcH77fPPvkoqQ8eS4781012024-03-10T22:20:00.577Znarcissismabusenarcissistic abusenpdborderlineYESRadix Verum ☦NOhttps://nicecrew.tv/w/npzHvq7m6kCXzvEMbT59EMhttps://nicecrew.tv/lazy-static/thumbnails/e4a87cc9-d0df-4df3-81a7-3488a6b6103e.jpgPlease help us give Adam Fox a Merry Christmas!Please help us give Adam Fox a Merry Christmas this year, if you are able! Adam's Christmas GSG: https://www.givesendgo.com/GBDFC?utm_source=sharelink&utm_medium=copy_link&utm_campaign=GBDFC Write to Adam: Adam Fox No. 11843-509 USP Florence Admax U.S. Penitentiary P.O. Box 8500 Florence, CO 81226 @kandkfilmofficial Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #adamfox #christmas #merrychristmas #whitmer #florence #supermax #court #legal #kandkfilm #documentaryhttps://nicecrew.tv/static/streaming-playlists/hls/ad5acbec-1f07-4266-a105-34e24acf1839/c32e1373-6946-4159-b400-3c8cc9f8ce06-master.m3u8https://nicecrew.tv/videos/embed/npzHvq7m6kCXzvEMbT59EM568012024-03-10T22:20:13.029ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/nupVjNPQcuUESeVbwct7xMhttps://nicecrew.tv/lazy-static/thumbnails/60a132c5-366f-42fc-8834-e6b7245d540d.jpgRadix Reacts to "I 'Used' to Hit my Husband."I came across an article from the Guardian about a woman who admits to psychologically, emotionally, and physically abusing her husband for over ten years, but she is looked at as the victim in need of aid. Source: https://www.theguardian.com/lifeandstyle/2010/apr/17/i-used-to-hit-my-husband Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #misandry #feminism #relationships #marriage #abuse #narcissism #toxicrelationships #maleabusehttps://nicecrew.tv/static/streaming-playlists/hls/ae077a6f-7f88-4f69-91a5-f8bbb244d4b3/9cefed2b-9564-42b5-ad10-f46413e0e61a-master.m3u8https://nicecrew.tv/videos/embed/nupVjNPQcuUESeVbwct7xM1644572024-03-10T22:54:33.952Zmale abusemisandryfeminismrelationshipsmarriageYESRadix Verum ☦NOhttps://nicecrew.tv/w/1vfj4no8N73TEnXXipEmR8https://nicecrew.tv/lazy-static/thumbnails/08b10aa6-890d-46bf-8a59-6c81a3bc3c35.jpg13k Subscribers!!! Thank you so much!!You guys are amazing, and I love you all! Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #youtube #contentcreator #celebration #thankyou #gratitudehttps://nicecrew.tv/static/streaming-playlists/hls/04156396-309a-4188-abb7-6adaa3ef5631/9bb675f9-86af-4983-9d9f-ba3eb997f808-master.m3u8https://nicecrew.tv/videos/embed/1vfj4no8N73TEnXXipEmR8246002024-03-10T22:20:34.452ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/n3EaZXGuKxnFNZ9ztFyocbhttps://nicecrew.tv/lazy-static/thumbnails/8a0158d7-83f6-4363-ae9f-a4a9dac8590d.jpg"Estranged Parents" Abusing Copyright System to Attack Creators & Avoid CriticismI received a notification from YouTube that Diane from the "Estranged Parents" YouTube channel was attempting to falsely copyright strike my channel over a review/commentary/educational video I did that falls under fair use. It has come to my attention that she got @SocietalNarcissism two (2) copyright strikes on his channel. I have noticed what appears to be almost bot-like activity on my video where I talk about her video. I saw @LiveAbuseFree did a video on her as well so she might also get a copyright strike or an attempted strike.   Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #estrangedparents #narcissism #npd #narcissisticabuseawareness #toxic #toxicparents #copyright #contentcreator #youtubehttps://nicecrew.tv/static/streaming-playlists/hls/aa6eec89-d84e-492c-86d5-3f1ddbd68930/28a09fc4-3cc8-4453-89ac-f829ee153772-master.m3u8https://nicecrew.tv/videos/embed/n3EaZXGuKxnFNZ9ztFyocb907002024-03-10T22:20:43.609Zestranged parentsnarcissismnpdnarcissistic abuseabuse recoveryYESRadix Verum ☦NOhttps://nicecrew.tv/w/9GckWzFhi7PwgW8BjgiCPMhttps://nicecrew.tv/lazy-static/thumbnails/119baba1-1c36-48f3-a04c-387b29fe5be9.jpgWhitmer "Kidnapping Plot" Hoax Inmates to Remain in Out-of-State GulagsIn October, Mich. Judge Thomas Wilson demanded answers from prosecutors about why the men convicted on state charges of assisting the Gov. Gretchen Whitmer kidnap plot were transferred to federal prisons outside of Michigan—where they’re unable to regularly communicate with their attorneys or review records for their pending appeals. This is clearly political and done with the intentional design to destroy their chances of being able to appeal because they know all this will be overturned and these men will be released and sent home. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #michigan #whitmer #gulag #prison #federalprison #bop #mdoc #corruption #fbi #joemorrison #petemusico #paulbellarhttps://nicecrew.tv/static/streaming-playlists/hls/4665d9d7-fbed-4a31-9534-4dde449379fb/7334836c-4f47-4218-b4ea-09b1715e1adf-master.m3u8https://nicecrew.tv/videos/embed/9GckWzFhi7PwgW8BjgiCPM657002024-03-10T22:20:53.349Zmichiganwhitmerpaul bellarjoseph morrisonpete musicoYESRadix Verum ☦NOhttps://nicecrew.tv/w/7BrKTB9rrtFmonBxkPboTBhttps://nicecrew.tv/lazy-static/thumbnails/39f47d3d-3f86-47e6-928c-9867ed90a6f9.jpgThe Narcissists Inability to Handle Feedback and CriticismNarcissistic Personality Disorder (NPD) is characterized by a pervasive pattern of grandiosity, a constant need for admiration, and a lack of empathy. The fragile ego of the narcissist is characterized by a deep-seated vulnerability masked by a facade of superiority. Driven by an intense need for admiration, they often seek external validation for their sense of self-worth. Paradoxically, any perceived "criticism" or "threat" to their fabricated self-image can trigger a disproportionate emotional response. The fragility lies in the delicate balance between maintaining this grandiose self-perception and the narcissist's fear of being exposed. Despite projecting confidence, the narcissist's ego remains fragile and brittle, reliant on constant affirmation to shield against the underlying insecurities that drive their behavior. Sources for more information: 1. American Psychiatric Association. (2013). Diagnostic and statistical manual of mental disorders (5th ed.). Arlington, VA: American Psychiatric Publishing. 2. Campbell, W. K., & Foster, J. D. (2007). The Narcissistic Self: Background, an Extended Agency Model, and Ongoing Controversies. In C. Sedikides & S. Spencer (Eds.), Frontiers in Social Psychology: The Self (pp. 115-138). Psychology Press. 3. Kernberg, O. F. (1975). Borderline conditions and pathological narcissism. New York, NY: Jason Aronson. 4. Ronningstam, E. (2005). Identifying and Understanding the Narcissistic Personality. Oxford University Press. 5. Rhodewalt, F., & Morf, C. C. (1998). On self-aggrandizement and anger: A temporal analysis of narcissism and affective reactions to success and failure. Journal of Personality and Social Psychology, 74(3), 672-685. 6. Ritter, K., Dziobek, I., Preißler, S., Rüter, A., Vater, A., Fydrich, T., ... & Roepke, S. (2011). Lack of empathy in patients with narcissistic personality disorder. Psychiatry Research, 187(1-2), 241-247. 7. Twenge, J. M., & Campbell, W. K. (2003). "Isn't it fun to get the r...https://nicecrew.tv/static/streaming-playlists/hls/3589bcaf-7a7f-489a-b574-9dae45afcd69/9990b265-f369-48fa-9466-0ef27ba97469-master.m3u8https://nicecrew.tv/videos/embed/7BrKTB9rrtFmonBxkPboTB1455042024-03-10T22:21:03.441ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/9MXKF1g6aRx1fyopXrQjdWhttps://nicecrew.tv/lazy-static/thumbnails/dae71559-bcfc-47c7-9250-b469f784f91f.jpgIt's Time to Pass the "End Solitary Confinement Act"Democratic-aligned senators introduced legislation Tuesday that would largely ban the use of solitary confinement in federal institutions and give states and local jurisdictions incentives to do the same. The End Solitary Confinement Act, a companion to a bill that over a dozen House Democrats introduced in July, would also prevent inmates and detainees from being segregated alone for more than four hours to de-escalate emergency situations and, even then, require staff members to meet with them at least once an hour. And, similar to the House bill, incarcerated people would also be entitled to at least 14 hours of daily time out of their cells, including access to seven hours of programming meant to address topics such as mental health, substance abuse, and violence prevention. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #prison #prisonreform #federalprison #solitaryconfinement #restrictivehousing #bop #legislation #jail #inmatehttps://nicecrew.tv/static/streaming-playlists/hls/4733f01b-95e3-4356-a8a4-80e8f8656da6/63452484-2978-40f7-8dc8-d35289663020-master.m3u8https://nicecrew.tv/videos/embed/9MXKF1g6aRx1fyopXrQjdW569002024-03-10T22:21:13.502Zprisonprison reformsolitary confinementtorturerestrictive housingYESRadix Verum ☦NOhttps://nicecrew.tv/w/68ZgB4ecuiShdNqPs1bZCmhttps://nicecrew.tv/lazy-static/thumbnails/e7b6ec1a-c983-4d2d-a7b6-a2541c347990.jpgThe FBI's Favorite Informant: NO Jail for FeloniesFBI Informant Steve “Robey” Robeson, Key Architect of the Governor Gretchen Whitmer Kidnap Plot, Pleads Guilty to Felony Theft in Another Sweetheart Deal. Link to full video: https://tinyurl.com/mcat5a92 or go to Rumble - find Radix Verum channel Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/299b3167-d7da-4c42-a649-e77436ffb4d0/dd77723b-9481-4879-bd3e-9e0ce483cb99-master.m3u8https://nicecrew.tv/videos/embed/68ZgB4ecuiShdNqPs1bZCm264002024-03-10T22:21:23.407ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/rVft3EufFj5cRyAMabHpT6https://nicecrew.tv/lazy-static/thumbnails/ace0d9ae-1537-4332-8567-f0b974bd1b3f.jpgSam Altman is not your friend.Join me for a deep dive into Sam Altman. We cover how he commercialized OpenAI, we talk about Worldcoin, his dystopian eyeball scanning protocol and crypto currency that involves UBI and biometrics for verification. Altman recently attended the Annual Bilderberg Meeting. Worldcoin's "world ID" reminds me of Ghislaine Maxwell's "Terra Mar Project" which aimed to create digital ID's to be a "global citizen of the oceans." Sources: https://twitter.com/sama/status/1451203161029427208 https://twitter.com/nullagent/status/1451228747189800960 https://twitter.com/AaronRDay/status/1641121073398792209 https://twitter.com/mishadavinci/status/1645094220343181313 https://twitter.com/kerikukral/status/1652636737162600449 https://twitter.com/Chad_GPT_DAO/status/1658143533193199618 https://twitter.com/kepano/status/1685378433617207296 https://twitter.com/SovereignHRZN/status/1640373676775288834 https://twitter.com/sashayanshin/status/1683494363186307072 https://twitter.com/SkallasTown/status/1734700542947975611 https://twitter.com/FaceLikeTheSun/status/1734631308242964642 https://archive.is/CGj2c https://worldcoin.org/blog/announcements/introducing-world-id-2.0 https://read.cash/@Unity/biometrics-is-a-security-hole-on-the-worldcoin-crypto-project-c9cabecf https://reclaimthenet.org/worldcoin-integrates-with-reddit-telegram-and-more https://www.treehugger.com/terramar-project-launches-to-celebrate-and-protect-the-worlds-oceans-4862102 https://www.businessinsider.com/ghislaine-maxwell-terramar-project-charity-jeffrey-epstin-2019-7 Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #siliconvalley #samaltman #openai #chatgpt #worldcoin #cr...https://nicecrew.tv/static/streaming-playlists/hls/d1e3cd2e-6925-46f9-b471-06703d6473b7/70e84ba9-f9ab-423d-bb4f-fe86a636f7c4-master.m3u8https://nicecrew.tv/videos/embed/rVft3EufFj5cRyAMabHpT63998002024-03-10T22:21:33.482ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/mfNsiytoT8beo7N2dhiHLthttps://nicecrew.tv/lazy-static/thumbnails/e8147724-600f-4e4a-94e6-ab6fe9fbdc4f.jpgA rambling rant on gatekeeping.I felt the need to do another rant lol sorry - which has already been demonetized. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/a407d05f-ed77-4d53-98a1-b404620b553f/4d21e579-3fe0-40d8-a372-a929f4c05bcc-master.m3u8https://nicecrew.tv/videos/embed/mfNsiytoT8beo7N2dhiHLt1868002024-03-10T22:21:45.803ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/pYP2A1nuJ5gWnguzvPekHchttps://nicecrew.tv/lazy-static/thumbnails/09919b15-9ec4-463e-bd16-eabf9e3fe26e.jpgWhitmer Kidnap Inmates Sue MDOC - Who is listening in to privileged legal calls?Two men convicted in the 2020 conspiracy to kidnap Michigan’s Gov. Gretchen Whitmer have sued the MDOC for being placed in out-of-state federal prisons, where their ability to communicate with lawyers or prepare their appeals has effectively been eliminated. The men—Joe Morrison and Paul Bellar—are all incarcerated in federal prisons outside of Michigan, despite the fact that they were convicted of state crimes. Pete Musico is in a similar situation, but his lawyer hasn’t joined the lawsuit. In the lawsuit, Morrison and Bellar’s attorneys detailed how they haven’t been able to communicate with their clients. Their lawyers note that a "third party" is listening in to all privileged attorney/client phone calls - GEE, I wonder who that could be? See Headline USA article by Ken Silva and documents posted by Eric VonDussen. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #michigan #whitmer #fbi #mdoc #prisons #jail #trial #appeals #court #corruptionhttps://nicecrew.tv/static/streaming-playlists/hls/c230d26a-45e2-497b-ae70-9d266b438559/48979673-eb09-4918-bc66-4bf128e3025a-master.m3u8https://nicecrew.tv/videos/embed/pYP2A1nuJ5gWnguzvPekHc1198002024-03-10T22:21:57.442ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/oPwjahmmuSvBLjE8F3xPVchttps://nicecrew.tv/lazy-static/thumbnails/9c85acfb-db25-4db8-939a-556d17c9eb30.jpgI Attended Ray Epps Sentencing & I am STUNNED by what I Saw!I attended the sentencing of Ray Epps who was charged with only a misdemeanor in connection with his conduct leading up to and on January 6, 2021. My thread: https://twitter.com/NotRadix/status/1744781225166778863 Eric Molitor GSG Fundraiser: https://www.givesendgo.com/EricMolitor?utm_source=sharelink&utm_medium=copy_link&utm_campaign=EricMolitor Support my documentary: https://www.kandkfilm.com/donate Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #rayepps #breakingnews #trial #court #sentencing #j6 #january2021https://nicecrew.tv/static/streaming-playlists/hls/b8cbb056-c2a1-4dd4-93ec-a3aba9787ec1/a572f361-f39f-4a8b-bd48-fbf7d2995c92-master.m3u8https://nicecrew.tv/videos/embed/oPwjahmmuSvBLjE8F3xPVc2580002024-03-10T22:22:07.836ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/ue3rWM5Jr584aNEs6wny1ohttps://nicecrew.tv/lazy-static/thumbnails/29029d00-110e-4ae1-9083-08053d72092b.jpgRay Epps Sentencing Hearing FARCE: Judge & Govt PRAISE Epps, Claim he is a "Victim"On January 9, 2024, I attended the sentencing hearing for Ray Epps who was charged with one misdemeanor in connection with his conduct leading up to and on January 6, 2021. There were maybe 12 of us in the gallery in attendance and I have not seen anyone reporting the details correctly. Here is my thread: https://twitter.com/NotRadix/status/1744781225166778863 Eric Molitor Fundraiser - Please help if you can! https://www.givesendgo.com/EricMolitor Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #rayepps #epps #j6 #jan6 #january2021 #court #trial #sentencing #hearing #boasberg #fisa #judgehttps://nicecrew.tv/static/streaming-playlists/hls/e4920f48-b0a8-4621-8c94-cc0ce4fa4b5e/e8edc214-70e7-438d-ad77-438826e53451-master.m3u8https://nicecrew.tv/videos/embed/ue3rWM5Jr584aNEs6wny1o1752012024-03-10T22:22:18.392ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/vBRtZ7YBwffsYirrMQhTTAhttps://nicecrew.tv/lazy-static/thumbnails/407e7874-99a6-49e1-9fc1-28b1a5da4fbe.jpgFramed by the FBI for a fake Kidnap Plot, then Acquitted - Eric Molitor needs your help!Eric Molitor is one of the five men that have been acquitted by 2 different juries in the FBI's Gov. Whitmer Kidnap plot hoax. Eric's GiveSendGo Fundraiser: https://www.givesendgo.com/EricMolitor Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #michigan #whitmer #kidnapping #fbi #fednapping #ericmolitor #acquitted #falselyaccusedhttps://nicecrew.tv/static/streaming-playlists/hls/efda8c3a-21bc-4470-b8c7-0ca98b96283c/7b3f1aa6-6346-4263-8bf1-234883682c13-master.m3u8https://nicecrew.tv/videos/embed/vBRtZ7YBwffsYirrMQhTTA1040002024-03-10T22:22:28.762ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/eCbR5QAbdHqdsVJmGJVAdFhttps://nicecrew.tv/lazy-static/thumbnails/5407978e-e3fe-462b-bb88-a06d37efe08c.jpgThis Veteran was Targeted & Framed by the FBI in the Whitmer Kidnap Plot Hoax & Rots in PrisonPaul Edward Bellar was just 14 years old when he convinced his older brother Tommy Jr. to take him down to the Milford Fire Department to enlist in the Cadet Explorer Program. Paul excelled at the program and was taken on many serious and dangerous calls including suicide calls, which gave him PTSD at a very young age. But Paul had always had a love of military and law enforcement and he always wanted to help people. That is what made him happy more than anything else. In 2015, Paul would enlist and join the US Army. His experience as a teenager handling first responder calls to suicides helped contribute to his continued drive to protect others. Paul needs our prayers and our help and so does his family. Please write to him if you can. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #michigan #whitmer #fednapping #kidnapping #court #trial #appeal #paulbellarhttps://nicecrew.tv/static/streaming-playlists/hls/6e544336-6222-4fcc-b2af-afce2773008f/dc9f8520-ce7f-4245-be2d-219b34119ad4-master.m3u8https://nicecrew.tv/videos/embed/eCbR5QAbdHqdsVJmGJVAdF920002024-03-10T22:22:39.912Zpaul bellargretchen whitmerfbicorruptionkidnap plotYESRadix Verum ☦NOhttps://nicecrew.tv/w/iRYnfGteqJ9cZBrvt9fxJHhttps://nicecrew.tv/lazy-static/thumbnails/367c9e2e-5e49-4b61-980f-e210080cc9be.jpgFBI Arrests "Trans Nazi," Who Talked to FBI & FBI Informant, has "Bipolar, DID," & Cult Ties!There is a lot more here than meets the eye! Yesterday the FBI announced they had arrested "a transgender woman plotting violence against Jews, Black People, and allegedly targeting transphobic co-workers with Nazi imagery and stockpile of guns and ammunition." The individual in question is a "trans woman" named "Elizabeth West." An "anonymous source" contacted the FBI about "Wyona Wild" - a trans woman living in Oregon regarding "concerning" and "threatening" posts online. The FBI made contact with Wyona in September of 2023. One month later in October of 2023 - Wild legally changes its name to "Elizabeth Bellasteros West" and it creates a Twitter account and beings to post over-the-top white supremacist propaganda. The FBI used a CHS (Confidential Human Source) during the course of their "investigation," and the FBI agents themselves had numerous interviews with "Elizabeth West," prior to arresting it. It's all very suspicious to me. West appears to be mentally ill - but I think it was being groomed. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/90a589fc-00d2-4384-b8be-2882a7c73459/da6e8ef0-326a-4d3c-aaa2-8d084b35c4d5-master.m3u8https://nicecrew.tv/videos/embed/iRYnfGteqJ9cZBrvt9fxJH2122002024-03-10T22:22:49.708ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/433um9ZcD14YBbArMx7wUzhttps://nicecrew.tv/lazy-static/thumbnails/5ab1113d-f451-43a2-a883-1b2c4f690aa2.jpgAlex Soros is an Unintelligent Sniveling Narcissist and BuffoonAlex Soros is a clown. He spoke today at the World Economic Forum 2024 in Davos and displayed his sniveling behavior while appearing to slur his words. Alex had a party boy image for a while then his father decided to rehabilitate him as some type of reformed aspiring intellectual. Alex changed his appearance and dress and took on the public mantle of “philanthropist” like his father. Alex recently took over his father’s 26-billion-dollar open society foundation and said he was more political than his father. Alex and his father like to use “kindness” – presented as a virtue – which serves as a tool for manipulating public opinion and perceptions. Beneath the surface, it's a calculated strategy to cultivate an image of benevolence, further obscuring the seething contempt hidden beneath the veneer of "charitable philanthropist." Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #WEF #davos #soros #alexsoros #narcissism #opensociety #foundationshttps://nicecrew.tv/static/streaming-playlists/hls/18946ff0-b4d5-4662-ac5c-8dbf4fbce661/34dbbc0d-482d-4c86-bcae-3e353962e1e3-master.m3u8https://nicecrew.tv/videos/embed/433um9ZcD14YBbArMx7wUz1075012024-03-10T22:23:00.429ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/4XRi8NWGRTM1uUgfFkrd4khttps://nicecrew.tv/lazy-static/thumbnails/e8c1dba7-34f7-4593-854f-1fe40ec608ad.jpgTaylor Swift Can't Handle Criticism or JokesThe thing about Taylor Swift that has always bothered me was her ability to appear so authentic, genuine, and perfect. You will never see Taylor getting arrested for DUI or anything like what has befallen many of her peers in the industry. Taylor always appears well put together and she comes off as so sweet and innocent. Now I have no bias against Taylor, I find some of her music quite catchy. I think some of the criticisms of her have been unfair. Yet there is something about Swift that is different from other celebrities who have management teams dedicated to cultivating public personas. What is it about Taylor that seems like a red flag? Well, she seems a little too perfect. To a certain extent, this is to be expected with the music industry – they are selling a product at the end of the day. Celebrities are always presented to the public as idealized “characters” designed to be marketed to a demographic, expected to generate revenue, and create a brand that can last and generate revenue for some time. But compared to her peers – Taylor outshines and outperforms them on every metric. She was recently minted as a billionaire following her Eras tour. She has amassed so much power that one could argue she is the music industry, yet simultaneously she’s been able to maintain this victimized narrative. When Taylor first appeared on the scene as a talented young country music artist she was sold as an average American small-town girl that grew up on a Christmas tree farm. There is some truth to this – Taylor did grow up on a Christmas tree farm that sprawled across 11 acres, and she was born rich. Her father Scott was a successful financial adviser and marketing executive. Scott Swift comes from 3 generations of Bank Presidents. Taylor took the country world by storm as this sweet little girl singing about “tear drops on my guitar,” and then made the effortless shapeshifting into a full-blown pop star. Taylor has managed to maintain this image of b...https://nicecrew.tv/static/streaming-playlists/hls/2017b3e5-2089-432b-be05-9cf7d18e08e9/d973ce4d-0eb6-449e-848d-1b31f01a08df-master.m3u8https://nicecrew.tv/videos/embed/4XRi8NWGRTM1uUgfFkrd4k1748032024-03-10T22:23:12.408Ztaylor swiftgolden globesgolden globes 2024hollywoodcelebritiesYESRadix Verum ☦NOhttps://nicecrew.tv/w/dLYnS2sAdazaKCBsnFJKdqhttps://nicecrew.tv/lazy-static/thumbnails/b3504075-419c-4502-9a9a-a51f395ea43c.jpgFederal Judge SLAMS FBI for "Invented Conspiracy," Releases Final "Newburgh Four" PrisonerU.S. District Judge Colleen McMahon on Friday granted James Cromitie, 58, compassionate release from prison six months after she ordered the release of his three co-defendants, known as the "Newburgh Four," for similar reasons after one of the prisoners provided evidence of being "framed" by the US Government. In a scathing ruling, McMahon wrote that the FBI invented the conspiracy and identified the targets. Cromitie and his co-defendants, she wrote, “would not have, and could not have, devised on their own a crime involving missiles that would have warranted the 25-year sentence the court was forced to impose." https://abcnews.go.com/US/wireStory/judge-orders-release-newburgh-defendant-blasts-fbis-role-106538808 https://www.cbsnews.com/news/gretchen-whitmer-michigan-governor-face-the-nation-transcript-01-21-2024/ Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #newburghfour #fbi #entrapment #jamescromitie #cromitie #law #legalprecedent #federalcourt #confidentialinformants #informants #prisonhttps://nicecrew.tv/static/streaming-playlists/hls/67752221-7bae-477d-a8eb-4cc0a355d5fc/ac7f2e44-ba4d-4af5-8d14-c37770cc506f-master.m3u8https://nicecrew.tv/videos/embed/dLYnS2sAdazaKCBsnFJKdq1514002024-03-10T22:23:22.276Zjames cromitiecromitienewburgh fourfbientrapmentYESRadix Verum ☦NOhttps://nicecrew.tv/w/c5scmEkSKgfJFPrVGNJdAjhttps://nicecrew.tv/lazy-static/thumbnails/4c65589b-d06d-43c1-a791-49503d0b4fe4.jpgThe LA Innocence Project claims "New Evidence" Could Prove Scott Peterson is InnocentThe Los Angeles Innocence Project (LAIP) has agreed to examine the Scott Peterson case. The project has filed court papers in an effort to exonerate Peterson, claiming key evidence was withheld from the 2004 trial that found him guilty of killing his pregnant wife, Laci, and their unborn son. The trial became a media frenzy and a national sensation. Peterson was almost universally reviled and though there was no smoking gun, lots of circumstantial evidence seemed to point to him alone. Peterson did NOT get a fair trial due to the lies of Richelle Nice an alternate juror who became juror no 7. I want to know what you all think! Sources: https://lamag.com/crimeinla/los-angeles-innocence-project-scott-peterson-conviction https://www.sfchronicle.com/crime/article/innocence-project-scott-patterson-18615334.php https://www.reddit.com/r/RedditCrimeCommunity/comments/nljdg7/a_partial_list_of_evidence_in_the_scott_peterson/ https://pwc-sii.com/Research/sightings/Walk.htm Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #scottpeterson #lacipeterson #petersoncase #amberfrey #truecrime #lainnocenceprojecthttps://nicecrew.tv/static/streaming-playlists/hls/59b3a4e1-fe1f-4384-836d-16e7ffbcc8a6/82398ca8-e57f-4a18-94fa-76bb89ba0afc-master.m3u8https://nicecrew.tv/videos/embed/c5scmEkSKgfJFPrVGNJdAj1551002024-03-10T22:23:33.753ZScott PetersonLaci PetersonConnor PetersonTrue CrimeLA Innocence ProjectYESRadix Verum ☦NOhttps://nicecrew.tv/w/4C1waV5Ltd5jaTtzEMQYrphttps://nicecrew.tv/lazy-static/thumbnails/6d7b648d-2086-442c-a0f6-f2caa816c83b.jpgKarlin Younger, Capitol Police, & The J6 "Pipe Bombs,": Anatomy of a HOAXA deep dive into Karlin Younger, the woman who allegedly "discovered" the RNC "pipe bomb" on her way to do "laundry" on her lunch break. Karlin glows like the sun and has a background in "counterterrorism." Karlin was working for a company called "FirstNet" which is almost identical to Carbyne 911 at the time she "discovered" the device. FirstNet just received a $92 million contract with the FBI in the weeks prior, which we are supposed to believe is a coincidence. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #karlinyounger #pendulum #firstnet #carbynehttps://nicecrew.tv/static/streaming-playlists/hls/1d528324-a1e1-4e24-abed-0af745343d71/0072c58b-5d43-4846-8a79-62b4898333d6-master.m3u8https://nicecrew.tv/videos/embed/4C1waV5Ltd5jaTtzEMQYrp1994002024-03-10T22:23:43.275ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/eZEKNSUuDyXTeadURtt1rXhttps://nicecrew.tv/lazy-static/thumbnails/da63d66d-4248-4330-83b8-dddff2a45f9b.jpgThe Narcissistic Smirk and SneerWe are going to talk about the smug, self-satisfied smirk of the narcissist and their contemptuous sneer. A smirk is a smile that shows a smug, condescending, or self-satisfied attitude. It’s a smile with one side of the lip curling upward like a half-smile. It’s a display of both pleasure and contempt. A sneer is a scornful facial expression characterized by a slight raising of one corner of the upper lip, and a contemptuous grin marked by a slight turning up of the nose. The sneer is a manifestation of their condescension. The smirk and sneer are both micro-expressions, a facial expression that lasts for a short moment, that reveals the true feelings of the narcissist. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #narcissism #smirk #sneer #npd #narcissisthttps://nicecrew.tv/static/streaming-playlists/hls/715414ce-d440-4927-8e1f-646f1171ee69/07753e1d-27ed-4cce-8237-e300022c1a84-master.m3u8https://nicecrew.tv/videos/embed/eZEKNSUuDyXTeadURtt1rX695042024-03-10T22:23:53.437ZnarcissismsmirksneercontemptnpdYESRadix Verum ☦NOhttps://nicecrew.tv/w/oZbCvk4VZ1YsAP67LDdQHUhttps://nicecrew.tv/lazy-static/thumbnails/fa99da17-39af-41fb-afca-40d984869a5f.jpgBooz Allen New "Persistent Eyes in the Sky" Spying on You from SpaceBooz Allen Hamilton's (of Edward Snowden/NSA fame) venture capital arm Booz Allen Ventures chose remote-sensing startup Albedo as its first investment in a space company because of its potential to transform intelligence gathering, a senior executive said on Jan. 23. Albedo promises more persistent "eyes in the sky" that can watch adversary movements or track "targets of interest." Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #surveillance #boozallen #satellite #spying #space #aihttps://nicecrew.tv/static/streaming-playlists/hls/ba24fefa-da8d-490e-8886-d71a657039ee/ff19d0e0-b1cf-4b54-9c8f-17165c505ec7-master.m3u8https://nicecrew.tv/videos/embed/oZbCvk4VZ1YsAP67LDdQHU464002024-03-10T22:24:02.356ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/s97nV6g3m7UMwQcnheLcU2https://nicecrew.tv/lazy-static/thumbnails/d6c8b1f2-66f8-4e75-b17c-2c616df2d585.jpgThere is something very strange about this...Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/d3af7c5e-0be0-4b2e-9029-3737c10085c5/afd09874-ccd4-4ec5-b1d5-701114300b43-master.m3u8https://nicecrew.tv/videos/embed/s97nV6g3m7UMwQcnheLcU2190012024-03-10T22:24:12.636ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/pfM47kSoz4uU4oKqaPWUQuhttps://nicecrew.tv/lazy-static/thumbnails/41a7e174-3df5-4bf1-ab80-c65305290e7d.jpgThe Internet has made People Classless and Vile...I had thoughts. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/bc525e02-fe0d-4590-b724-073615b9a0cc/6ae96dbc-8db7-4524-8660-3054fb4cadd9-master.m3u8https://nicecrew.tv/videos/embed/pfM47kSoz4uU4oKqaPWUQu1217032024-03-10T22:24:20.546ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/2zRmexcTCsigwDeGjVAumahttps://nicecrew.tv/lazy-static/thumbnails/838995f5-d83a-4666-b2e5-db7c4c02f7ad.jpgCIA "Vault 7" Whistleblower Joshua Schulte Sentenced to 40 YearsUpdate on the USA vs. Joshua Adam Schulte case. Schulte was accused of leaking the CIA's entire cyber arsenal to Wikileaks. Wikileaks published the Vault 7 leaks in 2017. The 2017 WikiLeaks publications, based on material Schulte has alleged to have leaked exposing CIA spying, were no less damning than the Snowden revelations. US prosecutors have stated that they constituted the ‘the single biggest leak of classified national defense information in the history of the CIA.’ Dubbed Vault 7, the documents detailed the activities of a secret division within the CIA responsible for offensive hacking operations. They reveal the agency to be the biggest purveyor of malicious computer viruses in the world. https://twitter.com/innercitypress/status/1753135182448599216 https://archive.is/PUYeD https://archive.is/pqxOY Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #joshuaschulte #wikileaks #cia #vault7 #court #truecrime #crimehttps://nicecrew.tv/static/streaming-playlists/hls/0cd3186a-dc8c-4f36-b538-f1ddcd981ee1/6e2807a9-f96c-41a1-b9cf-86ef4fbfab96-master.m3u8https://nicecrew.tv/videos/embed/2zRmexcTCsigwDeGjVAuma1001002024-03-10T22:24:30.669ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/1LwpwWF7PfaTNSgmJDTGq8https://nicecrew.tv/lazy-static/thumbnails/3fb1f4a7-9320-4c2c-b268-f5d4e5497e42.jpgCold War Stasi Spymaster Who Helped Create DHS: Markus Wolf, the Man without a FaceWe talk about Markus Wolf, a founder and chief of the East German Stasi. Wolf was credited by the Jerusalem Post as being the "best espionage chief in the world" during the Cold War. Dubbed "The Man Without a Face" due to his elusiveness the West didn't even know what he looked like until 1978 when he was photographed by the Swedish Secret Service. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #markuswolf #germany #eastgermany #stasi #dhs #espionage #intelligence #spymaster #coldwarhttps://nicecrew.tv/static/streaming-playlists/hls/063776ce-8be3-4edc-a78c-b162463a651f/2af7ba44-e73f-436b-9bb1-6125e0d9ff4b-master.m3u8https://nicecrew.tv/videos/embed/1LwpwWF7PfaTNSgmJDTGq81480002024-03-10T22:24:40.991ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/dZ1fborf6dwRMLD63c5esdhttps://nicecrew.tv/lazy-static/thumbnails/b8e7814d-8427-496b-b087-163bbc1b9fcc.jpgThoughts on "tipping" and the "service industry"I wanted to share my thoughts on the critiques of tipping culture and the service industry as well as ask people how they are surviving as inflation continues to rise while wages remain stagnant. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #tipping #tippingculture #tiktok #service #serviceindustry #inflation #recessionhttps://nicecrew.tv/static/streaming-playlists/hls/6923359f-b160-40b8-aeb3-acacf1dcea14/350cc68e-21c4-4cec-a830-defe6050c074-master.m3u8https://nicecrew.tv/videos/embed/dZ1fborf6dwRMLD63c5esd2695002024-03-10T22:24:52.679ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/kwvTTZfEn6WQPhSdiiMK3nhttps://nicecrew.tv/lazy-static/thumbnails/eed451d1-6b31-4603-86c7-c86640e3c5c5.jpgFor a brief moment, Taylor Swift's mask fell: a rant.Taylor Swift's mask fell at the 2024 Grammys. She is usually very good at facade management but her narcissism at times causes her to drop the mask for a brief moment. Her behavior towards Celine Dion and Lana Del Ray has finally revealed some of her self-aggrandizement although there will still be unhinged swifties denying this in the comments and excusing away her rudeness. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #grammys #grammys2024 #taylorswift #lanadelrey #celinedion #narcissism #popculture #npdhttps://nicecrew.tv/static/streaming-playlists/hls/9e205ef6-1ce2-4700-a57f-2f68b987ea4d/66960e79-51b4-421d-9821-ff2692818e6a-master.m3u8https://nicecrew.tv/videos/embed/kwvTTZfEn6WQPhSdiiMK3n1018012024-03-10T22:25:03.309Ztaylor swiftgrammys2024 grammysgrammys 2024lana del rayYESRadix Verum ☦NOhttps://nicecrew.tv/w/9oSWGMHZFPTZNY7g4QtBqKhttps://nicecrew.tv/lazy-static/thumbnails/8e946ba1-8f57-4060-9d17-8e64e47a97f8.jpgFBI Warns Sheriffs of "Imminent" Cyber Attacks on US Elections and GridWhat is really going on here? Butler County Sheriff Rick Jones held a press conference sharing what information he learned from a meeting held between FBI director Chris Wray and the National Sheriffs Assocation. Wray warned of an "imminent" cyber attack. I thought about the WEF and the Cyber Polygon simulation. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #china #cyber #cyberattack #power #grid #elections #cyberpolygon #wef #fbi #sheriffshttps://nicecrew.tv/static/streaming-playlists/hls/43faddf7-7926-4483-8d09-cac32d51345f/c61ca42d-a5c8-4d1c-9c3c-0d689ba30b51-master.m3u8https://nicecrew.tv/videos/embed/9oSWGMHZFPTZNY7g4QtBqK1271012024-03-10T22:25:12.970ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/u4F8cXrNECpvUfAEaPF487https://nicecrew.tv/lazy-static/thumbnails/91aef8b4-2104-4aa3-9204-afa92dca0e91.jpgThe Vampire as a Metaphor for the Narcissist, A Leitmotif.Narcissists dread being exposed in the same way a vampire dreads being pierced by the sun's rays. That sunlight is all it takes to reduce the predatory vampire to a smoldering pile of ashes. "If there's one thing real vampires seem to have in common, it is their reluctance to tell the world about who, and what, they are." Throughout history, stories, folktales, and myths about the supernatural vampire can be found. The myth of the vampire is so pervasive in fact, that some psychologists have deemed the vampire an "archetype," or an "intrapsychic psychological structure grounded in the collective unconscious." While the origins of the myths and folklore about the vampire are vague, there is a popular theory linking rabies to stories of vampirism, and the medical theory is indeed an interesting one. I think however another, more obvious explanation, is the classical narcissist. Vampires and narcissists have many things in common... Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #vampire #narcissism #vampires #narcissist #folktales #myths #npd #metaphorhttps://nicecrew.tv/static/streaming-playlists/hls/e3433997-152c-477e-a249-558b981c0230/01eb37be-d90b-4b01-958e-5a68498fe74e-master.m3u8https://nicecrew.tv/videos/embed/u4F8cXrNECpvUfAEaPF4871875012024-03-10T22:25:23.022Znarcissismvampirevampire mythologyvampire folklorefolktalesYESRadix Verum ☦NOhttps://nicecrew.tv/w/6ckAWYmiyVhzF6zLfVv7eYhttps://nicecrew.tv/lazy-static/thumbnails/16aad2db-d507-4b99-9a38-3ff690c645b6.jpgEric Molitor Acquitted in FBI's Whitmer Hoax Speaks at GNP DinnerEric Molitor Acquitted in FBI's Whitmer Hoax Speaks at GNP Dinnerhttps://nicecrew.tv/static/streaming-playlists/hls/2a12f48c-88ed-44a7-beb3-c6fe42bce81a/0bd78d26-b915-4e29-a8e1-cc7e48d25d76-master.m3u8https://nicecrew.tv/videos/embed/6ckAWYmiyVhzF6zLfVv7eY154002024-03-10T22:25:32.243ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/hf9u6Ged1F8SrDivTHWMuMhttps://nicecrew.tv/lazy-static/thumbnails/f4bb37be-5f41-4123-9655-f703d0c5ff6e.jpgEric Molitor and Mike and Bill Null speak at the GNP Washington Day Dinner in DetroitEric Molitor and Mike and Bill Null speak at the GNP Washington Day Dinner in Detroithttps://nicecrew.tv/static/streaming-playlists/hls/838bdc2d-74d9-4323-b837-26f0799e6779/e637ee01-d046-4dfe-8017-d88d04225a44-master.m3u8https://nicecrew.tv/videos/embed/hf9u6Ged1F8SrDivTHWMuM117002024-03-10T22:25:41.719ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/mwpTLyNh5f8GhXYSAGQmgBhttps://nicecrew.tv/lazy-static/thumbnails/4ae4ca35-1718-49f2-bb26-937a755fa7d0.jpgBill Null speaks at the GNP Washington Day Dinner in DetroitBill Null speaks at the GNP Washington Day Dinner in Detroithttps://nicecrew.tv/static/streaming-playlists/hls/a635cf84-4293-4adc-8761-561a46b12f19/f0c22f93-6895-4f4e-92b1-c659d2b3d4a5-master.m3u8https://nicecrew.tv/videos/embed/mwpTLyNh5f8GhXYSAGQmgB83002024-03-10T22:25:50.393ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/2dFZvUK7G26FcTp822f8xBhttps://nicecrew.tv/lazy-static/thumbnails/7287d597-9242-45f9-912b-f9d086123efc.jpgThe Intercept Whitmer Article: Bombshell Exposé or Damage Control?My thoughts on the recent Whitmer exposé published by the Intercept. source: https://theintercept.com/2024/03/06/gretchen-whitmer-kidnapping-informant/ See also: https://radixverum.substack.com/p/pedophile-fbi-informant-steve-robey Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #whitmer #intercept #journalism #mediahttps://nicecrew.tv/static/streaming-playlists/hls/09deb5aa-4ba5-446e-94e1-eb07c0e07645/f67ca147-a661-4793-892b-30e11b72b6be-master.m3u8https://nicecrew.tv/videos/embed/2dFZvUK7G26FcTp822f8xB2165012024-03-10T22:26:01.247ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/rZDvhAT8ugC2Ds63D1wfeShttps://nicecrew.tv/lazy-static/thumbnails/2e6aa393-64ce-422a-abcf-6791d6dbf947.jpgJJR - 244 - American Muscle In ActionSunday night solo show I go over SOTU sideshow, American Muscle live in action, South Dakota safer for the Chosen, airline industry's diversity disaster, levels of unsustainably never before seen and oh so much more. https://nicecrew.tv/static/streaming-playlists/hls/d280f981-2a49-4beb-8039-f6935d3c5cec/fbea3bbf-7b01-4a42-a89c-4fc33ac634d2-master.m3u8https://nicecrew.tv/videos/embed/rZDvhAT8ugC2Ds63D1wfeS769951112024-03-11T04:11:01.406ZYESJust Joe Radio NOhttps://nicecrew.tv/w/7GtoCbwHSfqqYcHNzoQjNPhttps://nicecrew.tv/lazy-static/thumbnails/f6a129ab-4e77-4b0b-8371-cd9e87c9f37d.jpgNCD Bible Study: Matt 3:13-Matt 4:10Most important key takeaway for believers: In these verses, Jesus Christ, God in the flesh, used the authority of Scripture when dealing with Satan himself; The Bible should matter more than anything to believers. You can participate weekly by subscribing to @nice-verse on NCD.https://nicecrew.tv/static/streaming-playlists/hls/363d7665-990f-4783-9f50-e0e080def0a3/ae78c827-eb62-4e3f-b1cb-4746d7232c4f-master.m3u8https://nicecrew.tv/videos/embed/7GtoCbwHSfqqYcHNzoQjNP14205122024-03-11T01:33:15.126Zbiblebible studysermonYESBrother TylerNOhttps://nicecrew.tv/w/8g4QkMPBBSUdTLWULqQNGXhttps://nicecrew.tv/lazy-static/thumbnails/27a1c80a-85ff-4b6d-beaa-3360b1f7bfee.jpgAI Translated Hitler SpeechArtificial intelligence has its uses. https://nicecrew.tv/static/streaming-playlists/hls/3aca7d58-56a4-4dd7-98b1-11c1e48b843f/b33d5cd7-2f6e-4eea-9a76-3673d8fa480b-master.m3u8https://nicecrew.tv/videos/embed/8g4QkMPBBSUdTLWULqQNGX2075202024-03-11T11:23:32.615ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/7V3NtEXzA1gWWej29tYJdUhttps://nicecrew.tv/lazy-static/thumbnails/9af957d5-6f6f-49b8-a337-ab35f2654847.jpgTalking Heads Call for TikTok BanNormies are beginning to notice that it's not exactly "China" that controls the bulk of US political discourse.https://nicecrew.tv/static/streaming-playlists/hls/37fefa68-1118-4845-99e5-9ee23105cd84/158c5e67-f933-484a-bb3f-e5357ea80168-master.m3u8https://nicecrew.tv/videos/embed/7V3NtEXzA1gWWej29tYJdU1220182024-03-13T18:26:59.094Ztiktoknoticingjewish powerforeign controlYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/aFFN3CWWqnd2p2TyM2QiKFhttps://nicecrew.tv/lazy-static/thumbnails/ab37fc01-ffa2-422b-aaa0-fe2f7946cd7f.jpgSneed Divers 2That was fun.https://nicecrew.tv/static/streaming-playlists/hls/4e6cc761-07d5-494f-a890-eec92e2a9579/2897fd97-ce5c-47df-a764-f089f173a1a5-master.m3u8https://nicecrew.tv/videos/embed/aFFN3CWWqnd2p2TyM2QiKF28345282024-03-14T14:10:57.648ZhelldiversnctvgamingautismniggerYESGamingNOhttps://nicecrew.tv/w/3Xd7DhuPQDQHmjqggEdNywhttps://nicecrew.tv/lazy-static/thumbnails/71a97441-f4e2-44a8-9c50-06eeafe2b488.jpgBen Shapiro Demands TikTok be Censored for Israel and Grandma Work Until she Diesabsolutely sickeninghttps://nicecrew.tv/static/streaming-playlists/hls/17e7a688-2ca6-4d28-8bd5-c4d56412da36/1e60f96e-81c1-44b0-9d6e-ccaae9eb1a8a-master.m3u8https://nicecrew.tv/videos/embed/3Xd7DhuPQDQHmjqggEdNyw266451192024-03-15T18:26:12.656ZBen ShapiroTikTokDaily WireUnit 8200censorshipYESRadix Verum ☦NOhttps://nicecrew.tv/w/vkHPz5gg7AmWMXAUUQboK6https://nicecrew.tv/lazy-static/thumbnails/5e40f64a-a112-47c4-bd51-6a138c17ba8e.jpgBen Shapiro Demands TikTok be Censored & Grandma Work Until She DiesAbsolutely sickening... Check out my Rumble or NCTV for the FULL VIDEO!! Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #tiktok #benshapiro #retirement #dailywirehttps://nicecrew.tv/static/streaming-playlists/hls/ed99ece4-fdaf-4569-ad56-6d26032192eb/f68138cf-a921-4776-9a4d-fd24ac39d37b-master.m3u8https://nicecrew.tv/videos/embed/vkHPz5gg7AmWMXAUUQboK6336532024-03-15T18:52:59.602ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/bWYRMzbdeLuyac6u1EGhu5https://nicecrew.tv/lazy-static/thumbnails/64722389-4149-4250-b28d-b580e96b2273.jpgJJR - 245 - It's Just What They DoOfficial Friend of the Show Jason Kessler joins me and we go over the SHOCKING societal collapse in Haiti, Congress cracks down on the CCP, the culpability of CashMeOusside Syndrome, super serious spicy chat situation, the kissed shoe on the other foot and oh so much more.https://nicecrew.tv/static/streaming-playlists/hls/58a89724-562f-453e-9fc9-2ea6d10617bc/25067104-7edf-4f8c-be45-d2d52630159e-master.m3u8https://nicecrew.tv/videos/embed/bWYRMzbdeLuyac6u1EGhu580585742024-03-17T03:57:47.830ZYESJust Joe Radio NOhttps://nicecrew.tv/w/8Je5kmAh82BDjh8K7gAspNhttps://nicecrew.tv/lazy-static/thumbnails/c6589f21-9468-4d12-9be8-ab49271250c2.jpgThyme & Place - RachaelNew song out today. Free download here: https://thymeandplace.bandcamp.com/track/rachaelhttps://nicecrew.tv/static/streaming-playlists/hls/3e95443c-1623-4794-ae35-a58d4e62504c/bf174f2d-20a3-4d90-abb4-27b7182dd6c1-master.m3u8https://nicecrew.tv/videos/embed/8Je5kmAh82BDjh8K7gAspN1005112024-03-18T00:03:24.584ZYESThyme & PlaceNOhttps://nicecrew.tv/w/vzYA45HnrcXjV78iKtZusQhttps://nicecrew.tv/lazy-static/thumbnails/9c5cc777-9c6b-48d0-867b-246484d926c9.jpgAn Unhinged Deep Dive into "Where is Kate Middleton?"We are going to discuss the question on everyone's mind: where is Kate Middleton? Catherine, Princess of Wales, was last seen publicly on December 25, 2023, at a public Christmas event with Prince William and the kids. Since then, it was announced she was having a "planned abdominal surgery" and would not be returning to public duties until Easter, as she would be recovering. With the publication of an edited photo released on the Prince and Princess of Wales' joint Instagram account and the strangeness after - theories are running wild on just where the princess could be, and what could have happened to her. Sources: https://twitter.com/bribrilukes/status/1768355400347263423 https://docs.google.com/presentation/d/197Wrj8y0Pyelq_IddEUa6bF-QfaLr_OjpPTYmTMqQdU/edit?usp=sharing https://www.thecut.com/article/who-is-rose-hanbury-marchioness-of-cholmondeley.html https://twitter.com/TheAtlantic/status/1769178125735194791 Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #katemiddleton #princewilliam #royalfamily #whereiskate #kingcharleshttps://nicecrew.tv/static/streaming-playlists/hls/ef977048-4c9d-40ad-b49d-d8faa4aed73c/d684ab05-d4d7-4948-b986-a3272b51dee1-master.m3u8https://nicecrew.tv/videos/embed/vzYA45HnrcXjV78iKtZusQ4126042024-03-18T19:04:16.005ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/bPvPRmS9CNhajFUCP3n7fyhttps://nicecrew.tv/lazy-static/thumbnails/e83e38d9-c997-4ae4-8e87-aba038b9d63d.jpgDaddy-O by Dave's True StoryThe lament of the Boomerhttps://nicecrew.tv/static/streaming-playlists/hls/579db95f-483f-46e0-82bc-30d90c51cbec/d4336ab0-8f25-46e3-b247-45ea95c47fa4-master.m3u8https://nicecrew.tv/videos/embed/bPvPRmS9CNhajFUCP3n7fy201032024-03-19T00:05:37.185ZYESMain snidely_whiplash channelNOhttps://nicecrew.tv/w/bZdXHL6TKFfcTGQ97KJtPwhttps://nicecrew.tv/lazy-static/thumbnails/f2d05b44-ea46-4af8-be6a-a83853ec99bd.jpgShoot the likker to me, Jon BoyShoot the likker to me, Jon Boyhttps://nicecrew.tv/static/streaming-playlists/hls/58f8c4cf-fe97-44b7-9e94-979b18483790/dc80e72a-db35-4b60-83d8-28a6e653ad9e-master.m3u8https://nicecrew.tv/videos/embed/bZdXHL6TKFfcTGQ97KJtPw175032024-03-20T07:09:17.594ZYESMain snidely_whiplash channelNOhttps://nicecrew.tv/w/oyDTnvEidFgRegLYPiKTGYhttps://nicecrew.tv/lazy-static/thumbnails/9fcd5bb3-cadb-4080-89a4-4977676525e7.jpgJJR - 246 - Confirmed Failed StateAfter existing in an unsustainable state for years, I can now safely say, the state has officially failed. I go over the latest examples of our current failed state status as well as Thou Shall Not El Paso, Nickelodeon's pedo problem, Jumanji and the growing Competency Crisis, strong aversion to Shmuley, cultivate inclusive initiatives to eviscerate bias, and on and on...https://nicecrew.tv/static/streaming-playlists/hls/b6b832f5-447f-4585-8e4f-1a071d613b9c/6065c121-6eae-4e52-a27e-d7007ad26f65-master.m3u8https://nicecrew.tv/videos/embed/oyDTnvEidFgRegLYPiKTGY92555592024-03-24T04:23:09.538ZYESJust Joe Radio NOhttps://nicecrew.tv/w/6BeRi6TkbZ4jGivNkLvg52https://nicecrew.tv/lazy-static/thumbnails/c2fe9d35-c56c-4fcc-a8ad-f70948dbf04f.jpgThis is Dangerous! New Federal Red Flag CenterHello friends, We need to talk about the launch of the new "National Extreme Risk Protection Order Resource Center" aka a new federal red flag database and center and how that could be dangerous to communities as well as law enforcement. https://nicecrew.tv/static/streaming-playlists/hls/2d6942b4-2074-409a-9132-0c695e22d72d/677752d8-ac4b-474c-a093-ba2179bd5366-master.m3u8https://nicecrew.tv/videos/embed/6BeRi6TkbZ4jGivNkLvg5218235212024-03-23T22:43:59.626Zmerrick garland,red flag lawsfederal red flag centergun controlpolitical policeYESRadix Verum ☦NOhttps://nicecrew.tv/w/gtQdG45EKy1Xwu7WbXPhqNhttps://nicecrew.tv/lazy-static/thumbnails/71a8ab45-314d-4375-8b83-138c08a31275.jpgGo watch my Federal Red Flag Center video!Go watch my Federal Red Flag Center video!https://nicecrew.tv/static/streaming-playlists/hls/7d5be0a9-471e-43cc-85b6-82a22e60a066/41cc8613-ac81-4279-911a-f705b0d6e774-master.m3u8https://nicecrew.tv/videos/embed/gtQdG45EKy1Xwu7WbXPhqN23542024-03-23T23:49:18.815ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/6SKhZj189nME5EMepPc65Shttps://nicecrew.tv/lazy-static/thumbnails/522005a2-c48e-43e7-802d-0d9ec2b04889.jpgWe're all being played and being set upjoin me for another unhinged and long-winded deep dive into BCIs, AI, DARPA projects ASIMOV and CARCOSA, Metal Gear Solid 2 "AI codex" and more. Sources: https://unlimitedhangout.com/2024/03/investigative-reports/weaponizing-reality-the-dawn-of-neurowarfare/ https://www.defenseone.com/technology/2024/03/big-ai-research-darpa-funding-year/394924/ https://theintercept.com/2024/03/18/pentagon-darpa-ai-carcosa/ Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #ai #bci #mgs #metalgearsolid #information #darpa #technology #neurotechnologyhttps://nicecrew.tv/static/streaming-playlists/hls/2f938fdf-01dc-471c-9f6b-c800faf7c196/e15c299c-5292-4ce7-8c4c-e20039b4b092-master.m3u8https://nicecrew.tv/videos/embed/6SKhZj189nME5EMepPc65S39855122024-03-24T22:01:12.752ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/cJunkm5d36K5Y64BQCcptqhttps://nicecrew.tv/lazy-static/thumbnails/a63666f7-887c-47f4-9975-532ffce0301b.jpgJewish Plan for Esau/AmalekHow jews see Christians and Europeans, straight from the horse's mouth. https://nicecrew.tv/static/streaming-playlists/hls/5f033ef2-a62f-4d5c-8f37-e19525713faa/eb619353-9b58-426e-9ab1-929b9a47e72d-master.m3u8https://nicecrew.tv/videos/embed/cJunkm5d36K5Y64BQCcptq5875122024-03-26T11:29:42.870ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/rFcu18SGBd12yd2bHt7JSnhttps://nicecrew.tv/lazy-static/thumbnails/f6c12230-9434-4e18-a6bc-174299f3bbf9.jpgAI Translated Goebbles SpeechMakes you wonder why they never subtitle those evil Nazi speeches.https://nicecrew.tv/static/streaming-playlists/hls/cfed8cd0-78c6-45b8-8fd0-a81161722091/7e55fc12-2dbb-482d-b3dc-085f9cabb7bb-master.m3u8https://nicecrew.tv/videos/embed/rFcu18SGBd12yd2bHt7JSn890122024-03-26T23:53:55.463Zhitlernational socialismreichaitranslateYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/kvoyCY6WANfK7Kv66mYfcthttps://nicecrew.tv/lazy-static/thumbnails/8752bf5e-06ef-4d70-a401-256507abb82a.jpgThe Kalergi Plan - A Jewish Plan for White GenocideArchive of Matthew North's documentary.https://nicecrew.tv/static/streaming-playlists/hls/9df81bcf-8f46-4d19-8969-6e120565d771/fa4902f7-83ad-41c3-88cd-41185d31359a-master.m3u8https://nicecrew.tv/videos/embed/kvoyCY6WANfK7Kv66mYfct29970672024-03-27T02:23:56.544Zjewishwhite genocidejudaismkalerginwoYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/sxZq9dm8bzrzReTXxumR6fhttps://nicecrew.tv/lazy-static/thumbnails/182dd28d-ecb5-4311-88bd-919ce4cbf4bd.jpgI need your help, please share this, it is urgent!I urgently need your help to raise awareness about the purposeful sabotage of the Whitmer kidnap plot victim's appeals. The latest is the targeting of Paul Bellar. Write to the guys: https://www.kandkfilm.com/write-to-the-guys Donate to the documentary: https://www.kandkfilm.com/donate Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/d7050bc9-5f47-4cc5-b0a5-5c36979c4e94/b79c6827-0fb2-4e41-aabe-33f2072a460e-master.m3u8https://nicecrew.tv/videos/embed/sxZq9dm8bzrzReTXxumR6f809552024-03-27T20:51:01.192ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/aUZNkxkkKz6sQSagZNQp9Ehttps://nicecrew.tv/lazy-static/thumbnails/12e45835-9b21-4ed4-8840-2a1b5dc52103.jpgTHALASINAn old, but good commercial for a revolutionary product!https://nicecrew.tv/static/streaming-playlists/hls/50488b38-1e78-4718-a1f8-ea5b13e74f72/6d9311ba-8229-425c-bfaa-3e10cda9926d-master.m3u8https://nicecrew.tv/videos/embed/aUZNkxkkKz6sQSagZNQp9E1745172024-03-27T21:31:39.709ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/8pcAiAFE9M39PzSYFPHZawhttps://nicecrew.tv/lazy-static/thumbnails/33d2b273-47d0-4345-a7d7-59237508546d.jpgWhy do more people care about Candace Owens & Steven Crowder than the Whitmer guys?Why do more people care about Candace Owens & Steven Crowder than the Whitmer guys?https://nicecrew.tv/static/streaming-playlists/hls/3bed3886-d72e-44b9-95f8-7cb92d6e02e4/fdbde005-83ad-4cb8-9fcc-a3a443294101-master.m3u8https://nicecrew.tv/videos/embed/8pcAiAFE9M39PzSYFPHZaw46542024-03-27T21:49:12.834ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/61LcGrT9ufUeg3prSZQYbUhttps://nicecrew.tv/lazy-static/thumbnails/0cbe6b28-b1cb-4fe9-ac30-9bb6855e36d0.jpgCodex Pajeet: Why Indians are the worst race and country on EarthArchive/mirror of ***Moonman's*** first offering - a prelude to his magnus opus. This documentary presents a first glimpse at the disgusting truth about india, narrated by Moonman. **Warning. This film is incredibly revolting and extremely NSFW.**https://nicecrew.tv/static/streaming-playlists/hls/2898eefd-45f2-4857-80fe-9f4e5e949568/3df668ef-2c6c-4814-8478-5931fef5610d-master.m3u8https://nicecrew.tv/videos/embed/61LcGrT9ufUeg3prSZQYbU448955632024-03-28T10:28:51.428ZpajeetpoojeetindiadungpooNOApocryphaNOhttps://nicecrew.tv/w/tm599sVsFdbcCCqbXBvrLLhttps://nicecrew.tv/lazy-static/thumbnails/6cab398e-18b0-446b-b3a6-d288a1ba2517.jpgThe Hopelessness of being Trapped inside a BoxIn the dimly lit confines of his cell, the young man felt suffocated, as if he were trapped inside a small box with no air to breathe. Each day stretched out endlessly, devoid of color or purpose, of hope or meaning, much like the monotonous walls that confined him. Time became a cruel master, ticking away relentlessly, yet offering no solace or reprieve. There is no comfort here. His dreams, once vibrant and full of promise, now seemed distant echoes of a life he could no longer touch. Like shadows dancing on the walls of his cell, they taunted him with memories of freedom, memories of laughing with his friends and spending time with his family. He even missed fighting with his brothers. This was a freedom he could no longer grasp. The weight of his mistakes and the corrupt actions of others pressed down on him, heavier than the steel bars that separated him from the outside world... Music Credits: "Scott Buckley - Undertow" is under a Creative Commons (CC-BY 3.0) license. https://www.youtube.com/user/musicbyscottb Music promoted by BreakingCopyright: https://bit.ly/bkc-undertow Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #prison #solitaryconfinement #jailhttps://nicecrew.tv/static/streaming-playlists/hls/dd742bbd-8a78-4ba2-aedc-42329f91da40/7732b213-d2df-4ebb-864b-f642a6f5becf-master.m3u8https://nicecrew.tv/videos/embed/tm599sVsFdbcCCqbXBvrLL241522024-03-30T18:09:54.208ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/xxcEGhQecpcubJYRQ95NG9https://nicecrew.tv/lazy-static/thumbnails/f06d937a-1a1c-49bd-9788-ae4e91a7bf2d.jpgJJR - 247 - Don't See DEIWhat started out as a bridge collapse has morphed into a battle over DEI and what the term REALLY means. Also attack of Trans Visibility Day, WW3 over cow ashes, no more stillin' and so much more https://nicecrew.tv/static/streaming-playlists/hls/ff668ba3-a6da-4649-b7a2-bd4227bdc8f0/e8951fbd-8205-4fc4-bf2d-3a992f782d4d-master.m3u8https://nicecrew.tv/videos/embed/xxcEGhQecpcubJYRQ95NG990815502024-03-31T04:28:08.240ZjustjoeradioYESJust Joe Radio NOhttps://nicecrew.tv/w/q5VL3rnCrq9wuxFpLpBC58https://nicecrew.tv/lazy-static/thumbnails/423668ce-1ccb-4141-8cec-a47e79b27152.jpgThe Truth About Jesus (Jews, Jesus, and Salvation) (reuploaded Mark Dice)I usually never reupload other people's stuff, but Mark Dice really killed it here.https://nicecrew.tv/static/streaming-playlists/hls/c30b6eec-5102-4237-8389-7d4a7be029a7/8927bf87-0ef9-4487-a3c2-a192012a807a-master.m3u8https://nicecrew.tv/videos/embed/q5VL3rnCrq9wuxFpLpBC587475622024-03-31T22:57:35.363ZYESBrother TylerNOhttps://nicecrew.tv/w/5tFNb3ZQiM5Kuv3pLqAfYqhttps://nicecrew.tv/lazy-static/thumbnails/a9a2ff18-49ea-47de-b105-65b40bff3380.jpgDid the FBI Target this Virginia Militia for ANOTHER Entrapment Hoax? CIA involved?The FBI might be up to their old tricks, and this time the CIA might be involved as well: The Virginia Kekoas, a pro-gun prepper militia based in Eastern Virginia and formerly affiliated with the Boogaloo movement, tells News2Share that they recently kicked out a member they believe may have been plotting an explosives-related entrapment attempt against the group, or worse. Russell Richardson Vane IV first made contact with the Virginia Kekoas in April 2022, according to the group's leader Eddie Ray, who goes by "ICE" and member Cody Beckner, who goes by "Sasquatch." Vane allegedly adopted the call sign "Duke." The pair provided extensive screenshots and documents showing that since joining, Vane - as "Duke" - engaged in an escalating sequence of unusual behavior that included apparent provocations for the group to develop homemade explosives. Homemade explosives lacking an ATF registration are generally a federal felony. Source: https://twitter.com/FordFischer/status/1774773763013324943https://nicecrew.tv/static/streaming-playlists/hls/24422961-6ab0-4430-b5d1-3267c03ee4d0/b6a8a51e-63b5-445c-846a-d051e851f245-master.m3u8https://nicecrew.tv/videos/embed/5tFNb3ZQiM5Kuv3pLqAfYq22785162024-04-01T17:22:30.980ZvirginiamilitiaentrapmentfbiciaYESRadix Verum ☦NOhttps://nicecrew.tv/w/6SmoH94Ntgj3qG9NuDnouFhttps://nicecrew.tv/lazy-static/thumbnails/d7c6c2cb-2dfb-4e07-9183-d1370e9f21c2.jpgDid the FBI Target this Virginia Militia for ANOTHER Entrapment Hoax? CIA Involved?The government may be up to its old tricks again... Source: https://twitter.com/FordFischer/status/1774773763013324943 Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/2f8572d3-09d9-4526-9087-18ec6762412f/df8bdf0c-a116-4ddc-b27b-b422583c74fc-master.m3u8https://nicecrew.tv/videos/embed/6SmoH94Ntgj3qG9NuDnouF226522024-04-01T18:09:20.764ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/muHy5aAhPw5aBWF98cRySJhttps://nicecrew.tv/lazy-static/thumbnails/33a620e7-07f6-468a-b3a3-32caa8946341.jpgWho is Russell Richardson Vane, IV? This is getting WEIRD.I wanted to document concerning findings surrounding the identity of a Virginia man who attempted to join a VA Militia called the Kekoas, and was kicked out for attempting to orchestrate an entrapment hoax or was just saying very stupid things. We believe he glows like the sun and has been working for the government in some capacity. I am interested to know what do you think? Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/a5f934e9-2842-4f7e-bd47-a741964eec36/6bd346c6-3d81-4588-9d3d-e9a6ca5ba1ec-master.m3u8https://nicecrew.tv/videos/embed/muHy5aAhPw5aBWF98cRySJ817552024-04-01T20:10:50.318ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/cpQNojBbp9XS7BamonW6iRhttps://nicecrew.tv/lazy-static/thumbnails/f9532b7f-fc7f-4af3-b97e-df27d50f08d7.jpgThis is Dangerous! New Federal Red Flag CenterHello friends, We need to talk about the launch of the new "National Extreme Risk Protection Order Resource Center" aka a new federal red flag database and center and how that could be dangerous to communities as well as law enforcement. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/5c68b4b4-60fd-4692-a255-f63ec43732bf/360add61-155e-42f9-8680-9b79d84c3c7d-master.m3u8https://nicecrew.tv/videos/embed/cpQNojBbp9XS7BamonW6iR1823522024-04-02T13:23:09.190ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/eom9vwv4aqypp7eTKnoqjehttps://nicecrew.tv/lazy-static/thumbnails/9bbea732-4f3c-40ce-9854-776fbf9c00d6.jpgSomeone Blew up Georgia Guidestones #occult #agenda2030Someone Blew up Georgia Guidestones #occult #agenda2030https://nicecrew.tv/static/streaming-playlists/hls/6c6594d4-a74a-4cbc-8b3f-bd5a4cbc1261/c7bea634-b9e6-499a-9dcc-da59a19c8057-master.m3u8https://nicecrew.tv/videos/embed/eom9vwv4aqypp7eTKnoqje56002024-04-02T13:22:03.278ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/vyUY26dy5Qt9oNyf4oK7nbhttps://nicecrew.tv/lazy-static/thumbnails/fac2acaa-cf70-4568-9335-a735f920ea1d.jpgSubscribe to my Substack! UwUSubscribe to my Substack! UwUhttps://nicecrew.tv/static/streaming-playlists/hls/ef717690-48fc-4fa1-ad9d-d43b7744821c/67c2915f-30de-4497-b6f0-b0d11c36a2d3-master.m3u8https://nicecrew.tv/videos/embed/vyUY26dy5Qt9oNyf4oK7nb57002024-04-02T13:22:00.450ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/nZiLGqrEqrwp58B4uypYU7https://nicecrew.tv/lazy-static/thumbnails/2a0f618c-f116-4712-aa4b-105e64656543.jpgCollege Is A Scam #college #scam #genzCollege Is A Scam #college #scam #genzhttps://nicecrew.tv/static/streaming-playlists/hls/b210421f-889b-4c9f-84d5-de919166f206/2c6e2ea2-ff4e-421c-a2ca-1fc2e2614edc-master.m3u8https://nicecrew.tv/videos/embed/nZiLGqrEqrwp58B4uypYU760002024-04-02T13:22:07.652ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/aX9ibrqJCSRqQg87z8N8uthttps://nicecrew.tv/lazy-static/thumbnails/2feb6261-95c2-4516-a506-df51fdb65bb5.jpgCIA Vault 7 Leak Trial Verdict, Part 2CIA Vault 7 Leak Trial Verdict, Part 2https://nicecrew.tv/static/streaming-playlists/hls/5095449c-38c8-4f83-be07-119f5c3100af/5c1355c3-c8a6-479d-9c6b-1fa54752cfde-master.m3u8https://nicecrew.tv/videos/embed/aX9ibrqJCSRqQg87z8N8ut49012024-04-02T13:22:06.391ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/u6nNBSEiC3oU41Qu6ZxiJohttps://nicecrew.tv/lazy-static/thumbnails/9133aa04-53af-4e70-81b8-0f018f723d54.jpgWendy Rogers Disavows Nick Fuentes & #AmericaFirstWendy Rogers Disavows Nick Fuentes & #AmericaFirsthttps://nicecrew.tv/static/streaming-playlists/hls/e38009d3-30eb-4ecf-8e10-e3ce7b95fd86/b3de8344-ce5a-4fe3-8f9a-1ebee3548bf8-master.m3u8https://nicecrew.tv/videos/embed/u6nNBSEiC3oU41Qu6ZxiJo47002024-04-02T13:22:10.097ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/otLfZwohRKXgF1urynAt5vhttps://nicecrew.tv/lazy-static/thumbnails/82745561-f4c8-4477-aea7-0350005540ce.jpg#BakedAlaska Plea Hearing Sealed From the Public #AmericaFirst #Groypers #January6#BakedAlaska Plea Hearing Sealed From the Public #AmericaFirst #Groypers #January6https://nicecrew.tv/static/streaming-playlists/hls/b6096856-499b-4957-aba3-2c936bf0ffb1/c70e41fe-b294-4053-b548-0e7d9f3b3240-master.m3u8https://nicecrew.tv/videos/embed/otLfZwohRKXgF1urynAt5v52012024-04-02T13:22:13.734ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/6TbznT8zaAPSHQsC5TnJUxhttps://nicecrew.tv/lazy-static/thumbnails/4ea750f2-96a1-49b5-b875-cae3f3ad0004.jpgHighlights for the Weaponization Committee ꟾ Whitmer “Kidnapping” HoaxBarry Croft's statement to the Weaponization Committee, followed by Brandon Caserta (who was acquitted after spending 18 months in prison and having his life ruined) explaining how the FBI preyed on Adam Fox and how they violated the law. Detailing FBI entrapment and framing of innocent American citizens. Timestamps: 0:00-3:57 Barry Croft Statement 3:58-4:14 Average Americans are getting paid to be informants for FBI 4:15-4:29 So the government can justify using Americans as pawns for politics 4:30-4:37 The magnitude of criminality in these agencies 4:38-4:54 Adam Fox's mother might never see her son again (despite his innocence) 4:55-5:28 How the FBI stalked Adam Fox like a Lion stalks a Gazelle 5:29-6:45 The FBI created these militia groups 6:46-7:49 FBI informant (CHS) Dan Chappel in leadership "training" role. The government is leading FTX trainings 7:50-10:15 The government set up each FTX exercise. The FBI agents/informants set up the medical training, barrel training, shoot house, etc 10:16-11:10 FBI CHS's in "Commanding Officer" positions admonished not to "initiate any ideas, plans, events, etc but that is literally all they did, as well as suggesting criminal acts to targets 11:11-12:20 FBI CHS's admonished not to supply or use illicit substances with targets. CHS Steve Robeson is getting drunk with targets and smoking pot with them. CHS Steve is buying ounces of Marijuana and giving it to target Barry Croft for free 12:21-12:34 Over 150 data points in FBI paperwork where they admit there is nothing illegal happening 12:35-13:12 Throughout government timeline docs CHS Dan or CHS Steve is re recording something they planned not something they came across organically - they are the ones pushing for things to happen 13:13-14:12 If Adam Fox is the ringleader and just "consolidated control" over the Wolverine Watchmen Militia, why are there no phone calls between him and his alleged co-conspirators? Only phone calls are from FBI informants to Adam F...https://nicecrew.tv/static/streaming-playlists/hls/2fa32497-6302-4ceb-b4fe-acf8679655c7/f11a8425-a5ee-4382-904c-8642c6081859-master.m3u8https://nicecrew.tv/videos/embed/6TbznT8zaAPSHQsC5TnJUx982002024-04-02T16:23:27.683ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/gR1SZCpZBGuRttbemw6mbbhttps://nicecrew.tv/lazy-static/thumbnails/8469587d-7c6b-480a-9276-a457805c5ecb.jpgBiden Regime Changing Definition of #RecessionBiden Regime Changing Definition of #Recessionhttps://nicecrew.tv/static/streaming-playlists/hls/80511103-4103-41be-b903-1b017970bb86/05e3f65c-c0db-4df6-bf80-656efd1c5e9d-master.m3u8https://nicecrew.tv/videos/embed/gR1SZCpZBGuRttbemw6mbb57002024-04-02T17:06:15.077ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/fMQ7NEJWvkc8KMXDUS2rovhttps://nicecrew.tv/lazy-static/thumbnails/b1e16009-ab65-4521-8ccc-b099314cf5cd.jpgThe Fake #Michigan #Whitmer #Fednapping Hoax & Eric Allport's MurderThe Fake #Michigan #Whitmer #Fednapping Hoax & Eric Allport's Murderhttps://nicecrew.tv/static/streaming-playlists/hls/77c61072-32c1-4b1b-b562-937fceb9f125/052c30cb-260b-436c-9782-070f2a83164d-master.m3u8https://nicecrew.tv/videos/embed/fMQ7NEJWvkc8KMXDUS2rov59002024-04-02T17:06:11.616ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/8QL3gEJjeQDb4XLkYqBjBUhttps://nicecrew.tv/lazy-static/thumbnails/26498ebe-b383-4006-b2b4-b45c3351dfba.jpgWhere Have All The Cowboys Gone?! #cowboys #conspiracyWhere Have All The Cowboys Gone?! #cowboys #conspiracyhttps://nicecrew.tv/static/streaming-playlists/hls/3f7ecfc9-3ccd-4290-b159-9e3486701662/681c1ef1-03fc-4705-9254-b0a525e10b22-master.m3u8https://nicecrew.tv/videos/embed/8QL3gEJjeQDb4XLkYqBjBU39002024-04-02T17:06:12.832ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/69JB2kDjkqD7kZDgg6SUzPhttps://nicecrew.tv/lazy-static/thumbnails/364dfd9a-e8d9-44c9-bdc7-a22471e5ca9b.jpgBirthday Stream Tomorrow Night!Birthday Stream Tomorrow Night!https://nicecrew.tv/static/streaming-playlists/hls/29b5e625-b831-47ac-bde8-54f769f3ddb9/2e0808e4-e742-4b1c-981c-da66573904f7-master.m3u8https://nicecrew.tv/videos/embed/69JB2kDjkqD7kZDgg6SUzP50002024-04-02T17:06:15.730ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/x6gSb22LCpKXN7XEWHVVDGhttps://nicecrew.tv/lazy-static/thumbnails/36be1a9f-9d5b-4a89-9809-a20f863a1f5f.jpgTotal REKIETA VICTORY! The Pope is Back! @RekietaLawTotal REKIETA VICTORY! The Pope is Back! @RekietaLawhttps://nicecrew.tv/static/streaming-playlists/hls/fbc7cb63-d759-49eb-aa34-16dce4ccf796/28180a23-a3a5-4a5f-ac05-4f0fd8157048-master.m3u8https://nicecrew.tv/videos/embed/x6gSb22LCpKXN7XEWHVVDG23002024-04-02T17:06:13.842ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/cNDXXhFHsEetvMHxn1jocnhttps://nicecrew.tv/lazy-static/thumbnails/8f6c054e-7dcc-4c54-a7e4-97d0db2dad2c.jpgTurning the Michigan Whitmer Kidnapping Plot Case into a Hollywood ProductionTurning the Michigan Whitmer Kidnapping Plot Case into a Hollywood Productionhttps://nicecrew.tv/static/streaming-playlists/hls/5f9822a0-ae57-4c77-b86f-e8f46f05e3db/6c194c37-4827-4d5c-bfae-d5659bec1531-master.m3u8https://nicecrew.tv/videos/embed/cNDXXhFHsEetvMHxn1jocn53002024-04-02T17:06:33.163ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/nCYZ279gYoCKj7mWqpmxRrhttps://nicecrew.tv/lazy-static/thumbnails/c32a4005-d65f-47f5-9118-fbcce251d2b1.jpgHappy Halloween Friends! #wednesdayaddams #addamsfamily #halloweenHappy Halloween Friends! #wednesdayaddams #addamsfamily #halloweenhttps://nicecrew.tv/static/streaming-playlists/hls/af39cdfd-e043-4fc7-884c-81ed98b9ca9f/e77ad1d0-1046-4159-b785-c8a95599554c-master.m3u8https://nicecrew.tv/videos/embed/nCYZ279gYoCKj7mWqpmxRr4002024-04-02T17:06:16.045ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/pDZH6XLUpi2DFFHk7XTjsqhttps://nicecrew.tv/lazy-static/thumbnails/3990b1b7-2207-4d18-8a65-4fe07db37a08.jpgI Hate the Anti-Christ: Halloween EditionI Hate the Anti-Christ: Halloween Editionhttps://nicecrew.tv/static/streaming-playlists/hls/bf9045dc-ce31-4ee8-be5d-74fafee9c6ec/ac18e0e1-3563-474b-8968-7fedd1cd8814-master.m3u8https://nicecrew.tv/videos/embed/pDZH6XLUpi2DFFHk7XTjsq50002024-04-02T17:06:33.223ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/1P1fqVpSHdsD7NDUk1WygHhttps://nicecrew.tv/lazy-static/thumbnails/6c0b39da-893b-4230-9d7b-67e3da300fb3.jpgDarrell Brooks GUILTY ON ALL CHARGES! #JUSTICEDarrell Brooks GUILTY ON ALL CHARGES! #JUSTICEhttps://nicecrew.tv/static/streaming-playlists/hls/06901c4a-6daf-4db2-bc0a-863cd442bedf/5a05e5a4-5598-4e05-8ba8-f3132ecd3d35-master.m3u8https://nicecrew.tv/videos/embed/1P1fqVpSHdsD7NDUk1WygH49002024-04-02T17:06:36.223ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/fKft6H1kyPNSymJDkKaaA7https://nicecrew.tv/lazy-static/thumbnails/0252ccb1-25eb-4743-9c79-751d8e1c70ea.jpgFBI Met with Big Tech Companies Weekly Prior to 2020 ElectionFBI Met with Big Tech Companies Weekly Prior to 2020 Electionhttps://nicecrew.tv/static/streaming-playlists/hls/7769d6ce-6948-4b7f-b704-a225d6419236/11fcbc54-684f-4d61-8880-c7adc78a3e3b-master.m3u8https://nicecrew.tv/videos/embed/fKft6H1kyPNSymJDkKaaA745002024-04-02T17:06:36.107ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/cLz7DBjjFufH7er1PLiUVVhttps://nicecrew.tv/lazy-static/thumbnails/7839fa60-1b1a-4254-bcf8-e73c19a8fa93.jpg#vibing#vibinghttps://nicecrew.tv/static/streaming-playlists/hls/5f4da8a4-2309-49a6-9dbc-c7aa7284aecf/154ecac2-3d7b-4270-8bea-e1a27ebac766-master.m3u8https://nicecrew.tv/videos/embed/cLz7DBjjFufH7er1PLiUVV9012024-04-02T17:06:30.015ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/6YKT7uzwnLmXScSKPpJ4oJhttps://nicecrew.tv/lazy-static/thumbnails/593e72da-4c5e-4e57-b5fb-6c77f258527b.jpgHey Friends!Hey Friends!https://nicecrew.tv/static/streaming-playlists/hls/306a631f-3939-46a5-8a58-a7fc053c50b2/8540ac0b-3b8a-449e-b5c7-4602d251c0d2-master.m3u8https://nicecrew.tv/videos/embed/6YKT7uzwnLmXScSKPpJ4oJ60002024-04-02T17:06:38.361ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/1mMEJZFwToAY2VSPxPxjWWhttps://nicecrew.tv/lazy-static/thumbnails/6a13dd5b-4c96-4a06-85a1-cdd5dd59b6f8.jpgAddams Family Pinball Machine! #addamsfamily #pinballAddams Family Pinball Machine! #addamsfamily #pinballhttps://nicecrew.tv/static/streaming-playlists/hls/02e704ef-4791-49bd-b57a-21abef4e19e2/098ab04c-e630-440c-8ab6-61ceaf85200a-master.m3u8https://nicecrew.tv/videos/embed/1mMEJZFwToAY2VSPxPxjWW49002024-04-02T17:06:40.683ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/oAUjiB53AhxbvwUi3RsNhBhttps://nicecrew.tv/lazy-static/thumbnails/3e5625fb-f841-43b4-a6d3-deaf38435067.jpgMichigan AG just Indicted her Former Political RivalMichigan AG just Indicted her Former Political Rivalhttps://nicecrew.tv/static/streaming-playlists/hls/b708944e-556b-40cd-8e88-4e19f4112fdb/53530fcb-8f4c-4c29-bd88-9d6b2ec97874-master.m3u8https://nicecrew.tv/videos/embed/oAUjiB53AhxbvwUi3RsNhB34002024-04-02T17:07:50.363ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/t5QsCw3MzVy7MZt1efBQA2https://nicecrew.tv/lazy-static/thumbnails/8c7f2d85-a34f-41df-8d61-92de1471ce64.jpgThe FBI is out here killing peopleThe FBI is out here killing peoplehttps://nicecrew.tv/static/streaming-playlists/hls/db539538-f812-460b-a399-abf9ab12306d/c4948f0f-41fd-4602-8b96-372330131a09-master.m3u8https://nicecrew.tv/videos/embed/t5QsCw3MzVy7MZt1efBQA260002024-04-02T17:07:43.896ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/vpXaa2h8ySZTMDozbHnSV6https://nicecrew.tv/lazy-static/thumbnails/242e59aa-2210-4575-b9cf-a890d93e83c0.jpgMICHIGAN AG ORDERED TO PRODUCE EXHIBITS & DOCUMENTS IN WHITMER FEDNAPPING HOAXMICHIGAN AG ORDERED TO PRODUCE EXHIBITS & DOCUMENTS IN WHITMER FEDNAPPING HOAXhttps://nicecrew.tv/static/streaming-playlists/hls/ee311ebd-e73a-49db-88f2-c4c35fceb267/0ac7cc8a-51e1-438b-b571-570ca8fe0286-master.m3u8https://nicecrew.tv/videos/embed/vpXaa2h8ySZTMDozbHnSV658002024-04-02T17:07:46.425ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/8izJuEg3KfkdYtFiW6ctYUhttps://nicecrew.tv/lazy-static/thumbnails/242de0a4-4b10-4b9d-b210-85b929761097.jpgMichigan was the Dry Run for January 6Michigan was the Dry Run for January 6https://nicecrew.tv/static/streaming-playlists/hls/3b246738-07b1-472b-98cc-51cbce1f7738/7fb38940-a4ad-4291-8223-fe6497b475a8-master.m3u8https://nicecrew.tv/videos/embed/8izJuEg3KfkdYtFiW6ctYU59012024-04-02T17:08:40.443ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/iBnhPb9QZaSya42PBFhYQ4https://nicecrew.tv/lazy-static/thumbnails/55ab0c06-ce8f-498f-b6c2-6795d56971a1.jpgToday's Bureau of Prisons Oversight HearingToday's Bureau of Prisons Oversight Hearinghttps://nicecrew.tv/static/streaming-playlists/hls/8e9b8270-6cba-4229-b4b5-20cac2059cd3/16d2f8e2-04ab-4213-bbdc-2fc57a05f573-master.m3u8https://nicecrew.tv/videos/embed/iBnhPb9QZaSya42PBFhYQ457002024-04-02T17:10:02.739ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/wHc6gcdTSvsGrRXtLtHTsYhttps://nicecrew.tv/lazy-static/thumbnails/d25ac6e1-63f1-400d-8b89-4082cd89855f.jpgFinally, some good news!Finally, some good news!https://nicecrew.tv/static/streaming-playlists/hls/f8b27d40-da04-4186-8840-b6ad6e3f1220/a8660b02-929c-4ff7-9fa0-a7ee5b49696f-master.m3u8https://nicecrew.tv/videos/embed/wHc6gcdTSvsGrRXtLtHTsY14002024-04-02T17:07:26.385ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/fU2K9SpkA2WaA8QgWNrU3zhttps://nicecrew.tv/lazy-static/thumbnails/f0f52c09-90a7-47e7-84fc-a5b473831e85.jpgAdam Fox's Christmas 🎄🎁Adam Fox's Christmas 🎄🎁https://nicecrew.tv/static/streaming-playlists/hls/78a3b12b-59eb-4809-91de-8f50f528172d/43c49ac7-e72b-4d52-a5d5-839e1eaff941-master.m3u8https://nicecrew.tv/videos/embed/fU2K9SpkA2WaA8QgWNrU3z38002024-04-02T17:09:51.645ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/s7ZS7DMiufW97uu36YbtG3https://nicecrew.tv/lazy-static/thumbnails/7ff38cbd-75a4-4d18-b036-69a6566001e6.jpgBeing acquitted doesn't mean you're freeBeing acquitted doesn't mean you're freehttps://nicecrew.tv/static/streaming-playlists/hls/d387ba4e-d21a-4965-852e-ff5640a8338e/63b697e2-b4de-4bfa-8340-2f72d15c3fff-master.m3u8https://nicecrew.tv/videos/embed/s7ZS7DMiufW97uu36YbtG358012024-04-02T17:10:01.083ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/naB1MaP9jJReJYz66VawuPhttps://nicecrew.tv/lazy-static/thumbnails/aae7631d-93a6-48f7-ac9c-d5eab56c144a.jpgSolitary Confinement = Torture #prisonreform #solitaryconfinementSolitary Confinement = Torture #prisonreform #solitaryconfinementhttps://nicecrew.tv/static/streaming-playlists/hls/ab672eff-29a2-4bfe-aae5-9991d9768e57/999bf47e-80bd-4b4b-a687-3be070f41076-master.m3u8https://nicecrew.tv/videos/embed/naB1MaP9jJReJYz66VawuP39002024-04-02T17:09:48.026ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/gXiYDpuraGzm5S1VYkViS1https://nicecrew.tv/lazy-static/thumbnails/71134bb4-6bd9-467d-93c9-a78c66c65c04.jpgThis poor creature 😔 LOLThis poor creature 😔 LOLhttps://nicecrew.tv/static/streaming-playlists/hls/813210d4-b535-457c-9d98-be5febcfe570/d33daf02-2be7-4ba0-9922-c23b1cb760ad-master.m3u8https://nicecrew.tv/videos/embed/gXiYDpuraGzm5S1VYkViS115012024-04-02T17:08:42.351ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/peV3havt7uswkgRmGALVD6https://nicecrew.tv/lazy-static/thumbnails/09978c27-fb89-455f-8164-069b4bf269fb.jpgmake sure you watch my latest videomake sure you watch my latest videohttps://nicecrew.tv/static/streaming-playlists/hls/bc338b78-cfd3-4895-94d3-0630ffba415b/26e3c27d-aacf-4ce3-a5d8-03e7e2b7420b-master.m3u8https://nicecrew.tv/videos/embed/peV3havt7uswkgRmGALVD651002024-04-02T17:10:10.869ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/nYn5ZyWWHhsZWPixDNqXMVhttps://nicecrew.tv/lazy-static/thumbnails/7946f440-5b3c-4049-bba6-6c2bb1f48ac3.jpgI have been wondering...I have been wondering...https://nicecrew.tv/static/streaming-playlists/hls/b1ee8ec7-dff5-441c-ae68-4c4d97071d23/0097e956-d5ca-4837-8c47-685e0305b4d5-master.m3u8https://nicecrew.tv/videos/embed/nYn5ZyWWHhsZWPixDNqXMV6002024-04-02T17:09:11.240ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/pENeDBHcj5Z1V8fRyNTU1uhttps://nicecrew.tv/lazy-static/thumbnails/dd4b1a0b-ae0a-4b4d-b271-5bdee97367c8.jpgEric Molitor on why he would would join a Militia todayEric Molitor on why he would would join a Militia todayhttps://nicecrew.tv/static/streaming-playlists/hls/bfacf22a-f48a-4d65-b4c3-9e93f8b44484/88a7fbc2-f1a4-4f14-82f8-4629ad02550a-master.m3u8https://nicecrew.tv/videos/embed/pENeDBHcj5Z1V8fRyNTU1u14002024-04-02T17:09:51.672ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/nDPp6kPMtEgcK5C8HRFqmDhttps://nicecrew.tv/lazy-static/thumbnails/fbd01df6-9f90-443c-b665-24ebe49828ff.jpgJohnny Depp vs Amber Heard VERDICT!!The jury appears to have reached a verdict in the Johnny Depp v Amber Heard Trial! #Depp #Heard #DeppvHeardhttps://nicecrew.tv/static/streaming-playlists/hls/af57a438-c424-41f0-ac98-e57da8df7e95/625d697f-73f1-4a77-884e-cd1876e235ea-master.m3u8https://nicecrew.tv/videos/embed/nDPp6kPMtEgcK5C8HRFqmD3538512024-04-02T17:16:19.890ZJohnny DeppAmber HeardDepp v HeardYESRadix Verum ☦NOhttps://nicecrew.tv/w/dSJu8UUCjBqJ6EJeHvpwLwhttps://nicecrew.tv/lazy-static/thumbnails/6bdf24b6-8ee4-4c17-b2ba-3a8761ab932b.jpgInterview with FBI Whistleblower Steve FriendI am joined by FBI whistleblower Steve Friend, who courageously came forward to speak out about the FBI's aggressive handling of the January 6 investigations. Stephen Friend was suspended by the FBI for refusing to participate in what he regarded as unnecessarily heavy-handed SWAT raids over January 6 misdemeanors. Friend had been working as a field agent in Florida when he said he noticed "rules were not being followed as they are laid out in our guidance for carrying out investigations" for tracking down January 6 participants. He said he made a protective disclosure to his supervisor in August 2021 to raise those concerns ahead of arrest-and-search operations on certain subjects. In his whistleblower complaint to the Department of Justice inspector general, Friend alleged that the FBI has been manipulating case-file management in order to falsely inflate the threat of domestic terrorism and using unconstitutional excessive force against political dissenters. With @GoodLawgic Follow Steve on Twitter: https://twitter.com/RealStevefriend Follow Kyle Seraphin on Twitter: https://twitter.com/KyleSeraphin #Whistleblower #FBI #DOJ #Court #Law #Trial #J6https://nicecrew.tv/static/streaming-playlists/hls/684308e8-9feb-4c21-96cf-615597298996/cf895559-511b-426e-81e2-9ff41a80ebc8-master.m3u8https://nicecrew.tv/videos/embed/dSJu8UUCjBqJ6EJeHvpwLw4954002024-04-02T17:18:20.693ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/dsG9oJPAAf2MwTNRCyqMqShttps://nicecrew.tv/lazy-static/thumbnails/cba2d067-e1a5-420f-afbe-75be74c6e3af.jpgFBI's Gov. Whitmer "Kidnapping Plot" Final Trial: Day TwoJoin me for day two of the FBI's Gov. Whitmer "kidnapping plot" trial, for the third and final case. #news #michigan #whitmer #court #live #trialhttps://nicecrew.tv/static/streaming-playlists/hls/64e7bdf2-af1e-4cdd-966d-b083b2fc6576/5f1706dd-81bd-4c56-89b2-0b9468785585-master.m3u8https://nicecrew.tv/videos/embed/dsG9oJPAAf2MwTNRCyqMqS27928002024-04-03T00:24:29.867ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/voM5mP8yscyZjXtp6xP84Nhttps://nicecrew.tv/lazy-static/thumbnails/932a92df-c577-4b7d-988a-73a981a1eed7.jpgFBI's Whitmer Kidnapping Plot Trial Commentary Day 10Join me for commentary only about the Gov. Whitmer "kidnapping plot" final trial. #news #michigan #whitmer #trialhttps://nicecrew.tv/static/streaming-playlists/hls/ee0729a2-1350-44a2-b9a1-c11cb8ead580/aa91ac17-eeb2-4d6a-9d54-f9271e8f1a58-master.m3u8https://nicecrew.tv/videos/embed/voM5mP8yscyZjXtp6xP84N22659002024-04-03T00:17:23.976ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/2rDAXRaGRdHEgdBkMvVbfrhttps://nicecrew.tv/lazy-static/thumbnails/0869e84f-e660-4869-af8f-01396d10e8cf.jpgFBI's Gov. Whitmer "Kidnapping Plot" Final Trial Day 11 CommentaryJoin me for commentary on day 11 of the FBI's Gov. Whitmer "kidnapping plot" final trial.https://nicecrew.tv/static/streaming-playlists/hls/0bade80e-07a8-4004-8222-ccda015cd125/b73d8569-8d7a-4d1a-a622-940198937d84-master.m3u8https://nicecrew.tv/videos/embed/2rDAXRaGRdHEgdBkMvVbfr25356002024-04-03T00:21:45.680ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/e11MMoAJyjqxqKwWGCHGjuhttps://nicecrew.tv/lazy-static/thumbnails/6115f604-eb6a-4066-86c6-07a1a9f15741.jpgFBI's Gov. Whitmer "Kidnapping Plot" Final Trial Day 12 CommentaryJoin me for day 12 of the FBI's Gov. Whitmer "Kidnapping Plot" final trial.https://nicecrew.tv/static/streaming-playlists/hls/694749fe-551d-4734-93a3-d28035549cf8/08afd255-635a-443e-af7a-8bb515c62e6a-master.m3u8https://nicecrew.tv/videos/embed/e11MMoAJyjqxqKwWGCHGju26509002024-04-03T00:22:31.519ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/2STzSqyssPHkzQXqAcZCoqhttps://nicecrew.tv/lazy-static/thumbnails/d3d5687d-583c-4a14-ab99-7178d3134688.jpgFBI's Gov. Whitmer "Kidnapping Plot" Final Trial Day 13, Preparing to Travel!Join me for day 13 of trial and prepping to travel for the verdict. #news #michigan #whitmer #trial #courthttps://nicecrew.tv/static/streaming-playlists/hls/0f341ded-4271-4e10-a766-17ad1345857c/df4b4ca9-23ac-47ee-b521-86f72edaa4a7-master.m3u8https://nicecrew.tv/videos/embed/2STzSqyssPHkzQXqAcZCoq15551002024-04-03T00:20:53.314ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/qLgcakWhayrBvPeDrXArNLhttps://nicecrew.tv/lazy-static/thumbnails/1e78cc6d-ae74-48ca-8526-c309b26b94ae.jpgLawsuit: Facebook and Instagram enabled child traffickingFacebook and Instagram display s*xual content to minors and serve as a “marketplace for predators in search of children,” according to a lawsuit brought against the platforms’ parent company, Meta, by the state of New Mexico’s attorney general. Filed on Tuesday, the suit alleges that underage users of both platforms – who can sign up without age verification – are shown adverts linking to adult p*rn sites and directed to accounts posting “images of s*xual intercourse and s*xualized images of minors,” even when the child has expressed no interest in this content. Links: https://archive.is/Ulnqr https://www.nmag.gov/attorney-general-raul-torrez-files-lawsuit-against-meta-platforms-and-mark-zuckerberg-to-protect-children-from-sexual-abuse-and-human-trafficking/ https://www.nmag.gov/wp-content/uploads/2023/12/2023-12-05-NM-v.-Meta-et-al.-COMPLAINT-REDACTED.pdf https://about.fb.com/news/2023/12/default-end-to-end-encryption-on-messenger/ https://www.theguardian.com/technology/2017/may/04/facebook-content-moderators-ptsd-psychological-dangers Join me as we go over the lawsuit. #instagram #meta #faceook #socialmedia #newmexico #lawsuithttps://nicecrew.tv/static/streaming-playlists/hls/c8896a98-7955-476a-9b00-deb4fdf87c3c/bb2bead4-3580-4a43-a7c9-54c6c51eb02f-master.m3u8https://nicecrew.tv/videos/embed/qLgcakWhayrBvPeDrXArNL5394012024-04-02T18:21:25.471ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/5cXyDhqtagVjkgrbt7dXJuhttps://nicecrew.tv/lazy-static/thumbnails/9e0f30b7-4b70-4718-94d3-9bd61c9a5d36.jpgInterview with Neil Sanders: Cambridge Analytica, PsyOps, Mind Control & Questioning EverythingI talk to Neil Sanders, one of the foremost experts on mind control about Cambridge Analytica, the shadowy Council for National Policy (CNP), Micro-Targeted manipulation, Social Media, Qanon & Questioning Everything, especially your own beliefs. Neil's Website: https://www.neilsandersmindcontrol.com #CambridgeAnalytica #JTRIG #GCHQ #MindControl #PsyOps #Advertising #Marketing #CNP #Trump #Influencehttps://nicecrew.tv/static/streaming-playlists/hls/220ffa58-1421-4ce1-8d3a-76d581940e7c/3989445a-7c85-429d-9af3-955af7460fb3-master.m3u8https://nicecrew.tv/videos/embed/5cXyDhqtagVjkgrbt7dXJu7216002024-04-02T20:11:24.458ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/2gvVDEt1bM863k9xyENNb7https://nicecrew.tv/lazy-static/thumbnails/853c835e-68a0-41ea-b8d0-e911fc3fac0c.jpgChris Smalls: Amazon, Unionizing, Workers Rights & Corporate RacismRadix interviews Chris Smalls, a former Amazon employee who was wrongfully terminated from his position at the company for daring to attempt to unionize. He was the subject of a corporate meetings, with Bezos in which they called him "not smart or articulate" aka he's black, and they actually contemplated doing a public smear campaign against him. He is a powerful voice for workers rights, the right to a living wage and how the people hold the power and can make a real difference. His Twitter account: https://twitter.com/Shut_downAmazon His website: https://tcoew.org My Amazon article: https://patriotssoapbox.com/tech/fake-social-justice-inside-amazons-racist-horrifying-treatment-of-employees/ I encourage everyone to support Chris in his class action lawsuit against Amazon! This is truly a David vs Goliath battle, Chris is up against a massive corporation with tremendous wealth and privilege. Keep him in your prayers! #ChrisSmalls #Amazon #BLM #WorkersRights #Unionizing #CollectiveAction #WorkingClass #BlueCollarhttps://nicecrew.tv/static/streaming-playlists/hls/0a43bcb5-30ca-4381-a7cf-594af1206f12/ab0a9165-7214-48d4-aec8-363d60a019fa-master.m3u8https://nicecrew.tv/videos/embed/2gvVDEt1bM863k9xyENNb72310012024-04-02T23:11:43.193ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/rj6xJAoM9riSDJbEVDgbN9https://nicecrew.tv/lazy-static/thumbnails/4eef7424-ba71-472b-b4af-841c738cebd0.jpgDerrick Jaxn Apology & Reaction: A Sociopathic NarcissistI am reviewing "relationship guru" Derrick Jaxn's apology video for cheating on his wife and then the bizarre reaction video he did of his own apology, totally in the 3rd person which he later deleted from his channel. This man has given bad advice to women and he has bashed other men calling their sins unforgiveable. When it comes out he was cheating on his wife with multiple people, he expects everyone to forget the advice he gave about throwing those men out. #DerrickJaxn #Apology #Reaction #Cheating #Guru #Mistress #narcissism #Sociopathyhttps://nicecrew.tv/static/streaming-playlists/hls/ccfb45dd-599b-4ae2-82e0-b3956fcc3624/ecbc0614-a20b-4832-8b27-a962701d89a5-master.m3u8https://nicecrew.tv/videos/embed/rj6xJAoM9riSDJbEVDgbN91826002024-04-02T22:45:25.955ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/cx31p1aBVVriRohojXqPqihttps://nicecrew.tv/lazy-static/thumbnails/4b6c2573-4adf-481d-8b7f-4e0399915752.jpgDealing with Bipolar, Manic Depressive, Narcissistic Family MemberI wanted to share some of my thoughts and experiences dealing with a family member who suffered from Bipolar disorder, manic depression and narcissism and how difficult it can be. I am NOT a mental health professional, clinician or therapist and this is not any kind of advice. These are just personal observations and experiences and my own thoughts on them. If you know someone who is suffering from mental illness, please help and encourage them to seek treatment for their disorder from a licensed professional. #Bipolar #ManicDepression #Narcissism #Abuse #Neglect #Gaslighting #LoveBombinghttps://nicecrew.tv/static/streaming-playlists/hls/5d69d1a2-9fe5-477c-a121-7494ab08740d/093f3092-4363-420c-baea-310d2b1c3a4f-master.m3u8https://nicecrew.tv/videos/embed/cx31p1aBVVriRohojXqPqi1774032024-04-02T22:56:42.595ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/rTxftmPnrXjx1R7wuj1TMyhttps://nicecrew.tv/lazy-static/thumbnails/32179960-9464-41a6-b20c-cabfb4a7f472.jpgNew Empirical Data on NarcissismA new study has been published on Science Direct that confirms what many authors and researchers have claimed about narcissism for about several decades now. Primarily that narcissists are mainly that grandiose narcissism is correlated to psychopathy and vulnerable (covert) narcissism appears to be the primary form of narcissism, or narcissism proper. Here is a link to the study: https://www.sciencedirect.com/science/article/pii/S0191886921001550 Here is a link to Dr. Vaknin's discussion on this: https://samvak.tripod.com/faq66.html #Narcissism #Covert #Overt #Psychopathy #CoDependenthttps://nicecrew.tv/static/streaming-playlists/hls/d1a6a82e-e9e9-46ac-b962-f01da63b789e/dc195387-39f0-4651-898c-ed5ed967638e-master.m3u8https://nicecrew.tv/videos/embed/rTxftmPnrXjx1R7wuj1TMy2096002024-04-02T23:09:14.001ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/gCLYZVYKShQ8cha6XXQ22Ahttps://nicecrew.tv/lazy-static/thumbnails/b5b6f7db-60fb-4202-bc35-ca7f206a67a9.jpgThe Worst Witness: What NOT to do When Under Cross ExaminationRadix reviews a case, of a very good defense attorney shredding the prosecutions witness. We look at the different strategies and techniques employed to confuse, and distract and lead the witness. This kid clearly was not properly prepared for this trial. Disclaimer: I am not an attorney or licensed to practice law, nor am I giving any legal advice. I am simply commenting on the case from the position of having previously worked in law and commenting on what might be happening in a situation like this. #DefenseAttorney #CrossExamination #Witness #DrugCase #Prosecution #Criminal #Legal #Law #Trial #TrialPrep #PreTrial #Depositionhttps://nicecrew.tv/static/streaming-playlists/hls/7e9b93c4-7fe9-4e0e-953a-91ddc3d3b090/1966f8e2-f63b-432e-98ae-d18800ccbdb0-master.m3u8https://nicecrew.tv/videos/embed/gCLYZVYKShQ8cha6XXQ22A2350002024-04-02T23:20:56.525ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/7hpf8UBghCJELPc1VtWgQohttps://nicecrew.tv/lazy-static/thumbnails/dde96f01-128c-461c-bc0b-dabf862a7c80.jpgNew Age to Jesus Testimonial VideosHey guys, I wanted to share some recent videos I have seen that detail several journeys people have made from the occult and new age to Jesus Christ. One interesting thing to note is that almost all of them were Christians when they were younger, then they rebelled and got into spiritualism and new age stuff, then made their way back to Christ. I think he is gathering all of his people up and preparing them for what is coming in the future. God is moving across the land. I find these people very brave and genuine. Some cynically believe these videos are a fad or trend, and that people are only making them now because they have become popular - so to gain views and exposure I guess? What do you all think? Are these testimonials real, and proof that God is bringing His people back? Could God be using the lockdowns to shake people out of their delusion? Is there something else going on, maybe more than meets the eye? I want to know your thoughts! #NewAge #Jesus #Testimonial #Spiritualism #Occult #Manifestation #LawOfAttraction #Christ #God #Faith #GodSaveshttps://nicecrew.tv/static/streaming-playlists/hls/32e10e86-5739-4bd2-9312-fb83c24431d2/1d6f10a5-cdfc-4d20-8b6e-b2a6acd00048-master.m3u8https://nicecrew.tv/videos/embed/7hpf8UBghCJELPc1VtWgQo2853002024-04-02T23:21:22.740ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/iLRV8JvvRD8CH5i36xrwYEhttps://nicecrew.tv/lazy-static/thumbnails/5a9e25d9-d751-46b3-83fa-01527e95b166.jpgWoke Liberalism as the Ultimate Expression of Capitalism & ConsumerismI think progressivism mostly expressed as toxic woke liberalism is the ultimate expression of capitalism and consumerism. I think that entire worldview is inculcated by the elite class to remove class consciousness from the middle and working class, and to prevent them from uniting together for their shared economic interest. I look at some of the quotes from Christopher Lasch's "The Revolt of the Elites & The Betrayal of Democracy" which was published in 1994, but was incredibly before its time. Sources: https://patriotssoapbox.com/opinion/white-liberal-saviorism-escapism-its-pathological-manifestations/ https://patriotssoapbox.com/opinion/narcissistic-sjws-victimhood-as-the-ultimate-grandiose-expression/ https://unherd.com/2020/07/the-book-that-predicted-2020/ https://www.goodreads.com/author/quotes/87816.Christopher_Lasch https://www.goodreads.com/work/quotes/573827-the-revolt-of-the-elites-and-the-betrayal-of-democracy #Capitalism #Consumerism #ConsumerCulture #RevoltoftheElites #Masses #FakeTribalism #IdentityPolitics #Capital #ClassConsciousness #WorkingClass #Poor #MiddleClass #Economics #NeoLiberalism #Progressive #Progressivism #WokeCapitalhttps://nicecrew.tv/static/streaming-playlists/hls/8feed850-e598-48c5-a637-ee124d4a8b06/3fd993b5-1f67-4651-af2c-e9b79e7f1a3b-master.m3u8https://nicecrew.tv/videos/embed/iLRV8JvvRD8CH5i36xrwYE2098002024-04-02T23:19:48.756ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/x9N2q2EyZNFhgFpsC1vBeLhttps://nicecrew.tv/lazy-static/thumbnails/363a3375-3211-499a-810f-0d1983c8fa09.jpgPano Kostouros: On Spiritual Warfare, Demonic Thoughts & The Next GenerationToday I got to interview a friend, Pano Kostouros about spiritual warfare. This is a topic that is really important to me, and I want the younger generation to understand the spiritual aspect of our world. To understand the problem of evil, demonic thoughts and tempations, and the nature of reality in general. To find solutions, first you must properly understand the problem. Pano's Channel: https://www.youtube.com/channel/UCziOPvYyM4lNwQoKGneFloA St. Silouan on Spiritual Warfare: http://assumptionaz.org/silouan-chapters-11-12 On spiritual warfare and suffering: https://www.ancientfaith.com/specials/orthodox_institute_2014_theosis_your_life_with_god/spiritual_warfare_and_suffering #Pano #PanoKostouros #SpiritualWarfare #DemonicThoughts #Logismoi #Passions #Temptations #Youth #Suffering #Addictionhttps://nicecrew.tv/static/streaming-playlists/hls/fc459cb6-2413-4389-9105-420204536912/6bebce9d-fb32-49de-811b-eff52cdc5cbd-master.m3u8https://nicecrew.tv/videos/embed/x9N2q2EyZNFhgFpsC1vBeL3256002024-04-02T23:17:35.730Zspiritual warfaredemonic thoughtsyouthaddictionsufferingYESRadix Verum ☦NOhttps://nicecrew.tv/w/c7WnAWduNtwUio7NqK2pJMhttps://nicecrew.tv/lazy-static/thumbnails/d07f9e8c-f51d-4e3a-92af-dcda25fdbd69.jpgBible Reading with Meditative Music: Ephesians 1-6Scripture readings with meditative music, this is a first for me. This is a project I have been trying to work on for a long time! I hope you find it relaxing, calming, uplifting and edifying. Glory to God. #Scripture #Bible #MeditativeMusic #Relaxing #Calming #Ephesians #ArmorOfGod #BibleReadings #ScriptureReadinghttps://nicecrew.tv/static/streaming-playlists/hls/5a0c7f00-1738-4c61-ba01-1e10cf7b8945/2a85fb80-b694-4237-b2a3-487dae536c91-master.m3u8https://nicecrew.tv/videos/embed/c7WnAWduNtwUio7NqK2pJM1592002024-04-02T23:06:22.951ZScriptureBibleBible ReadingsRelaxationCalmingYESRadix Verum ☦NOhttps://nicecrew.tv/w/j2RwgPPs3t44iietDyrnwXhttps://nicecrew.tv/lazy-static/thumbnails/cc8724b8-2cbd-439a-bdb0-9557e361fcb5.jpgScripture Reading with Relaxing Music: EcclesiastesToday's Bible reading is from Ecclesiastes, we read the whole thing. If you enjoy these, please share the videos, and let me know! If I mispronounce anything, please inform me so I can learn. Glory to God! Christ is King. #Scripture #Bible #ScriptureReading #BiblePassage #Relaxing #Calm #Ecclesiastes #BibleReading #God #Christ #Jesushttps://nicecrew.tv/static/streaming-playlists/hls/9206c235-c664-493a-82e1-ec454a56bb3f/49daae57-8a45-4a9c-b805-0c244d887999-master.m3u8https://nicecrew.tv/videos/embed/j2RwgPPs3t44iietDyrnwX2837002024-04-03T00:02:38.741ZBibleScriptureBible ReadingEcclesiastesScripture ReadingYESRadix Verum ☦NOhttps://nicecrew.tv/w/6GmtuxQGsZjQRePm5hL4HWhttps://nicecrew.tv/lazy-static/thumbnails/aca9bf9a-578d-4cf4-a8d6-069507242d3e.jpgSt. John Cassian's Institutes: On Pride. Part 1, Chapters 1-10A reading from St. John Cassian's Institutes: On Pride. Part 1, Chapters 1-10 which discuss why Pride is the worst sin, and how all other sins flow from it. Pride caused Lucifer to fall from an exalted Archangel to the depths of hell. #StJohn #Cassian #SaintCassian #Institutes #OnPride #Pride #Humility #TheFall #LucifersFallhttps://nicecrew.tv/static/streaming-playlists/hls/2e200fc8-7fc1-412a-842e-07a6c12808cc/ba25d587-775a-427d-a1b2-dbb1c2ad0ff6-master.m3u8https://nicecrew.tv/videos/embed/6GmtuxQGsZjQRePm5hL4HW1071002024-04-02T22:25:52.114ZPrideSaint John CassianJohn CassianInstitutesOn PrideYESRadix Verum ☦NOhttps://nicecrew.tv/w/cFGHQdgRAeUkkiP7igDNJphttps://nicecrew.tv/lazy-static/thumbnails/0a9b2e6e-780a-4eae-acfe-213592379296.jpgCommunism & The Coming Persecution of ChristiansWe look a three (3) books that can help us as Christians prepare for the coming persecution of Christians. The cultural revolutionaries in our midst are very clear that they wish to genocide us. Wake up America. The Books: 1. Hearts of Fire 2. Tortured for Christ 3. AA-1025 Memoirs of the Communist Infiltration Into the Church #HeartsofFire #TorturedForChrist #AA1025 #Communism #Persecution #Martyrs #Saints #Church #Infiltrationhttps://nicecrew.tv/static/streaming-playlists/hls/5e9fa0ac-e8f3-432b-b35c-53b00f7f4f6b/cba7c533-a3bb-4b35-be7e-7235650aa3ab-master.m3u8https://nicecrew.tv/videos/embed/cFGHQdgRAeUkkiP7igDNJp1738012024-04-02T23:54:04.471ZcommunismpersecutiongenocidechristianschristYESRadix Verum ☦NOhttps://nicecrew.tv/w/6BKZ3CSy4HGdpScVXVXnTZhttps://nicecrew.tv/lazy-static/thumbnails/f2ebd4e0-489c-44f5-9aa7-6abad02e8177.jpgBeautiful Deer in Forestcame across this sweet baby today. #Deer #Forest #Buck #Outdoors #Wildlifehttps://nicecrew.tv/static/streaming-playlists/hls/2d7bd4c1-0f63-47b9-a2aa-0399f28e3ec3/cfb93bdf-f1cc-4100-98d1-e8c576c34e4d-master.m3u8https://nicecrew.tv/videos/embed/6BKZ3CSy4HGdpScVXVXnTZ11012024-04-02T23:17:42.623ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/dNGcw1zCZqNkY7SHVyuZRfhttps://nicecrew.tv/lazy-static/thumbnails/0e7fd7ab-18da-4e03-bad7-b6f506f298e2.jpgBuck Deer Eats Under BushThis sweet guy was just hanging out under a bush! #deer #deers #bucks #forest #wildlife #animalshttps://nicecrew.tv/static/streaming-playlists/hls/67b2a68d-3c78-4fa6-a4a4-f8086375efec/0ba66538-c370-4e61-b574-2a9ce50f4fe1-master.m3u8https://nicecrew.tv/videos/embed/dNGcw1zCZqNkY7SHVyuZRf10002024-04-02T23:18:18.711ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/dkCtd4tjxBuviUT8jCP6gchttps://nicecrew.tv/lazy-static/thumbnails/d6b67b2f-b5c9-440e-9481-f57aaf0ad2ef.jpgNarcissistic Abuse & Addiction Series Part 1: Interview with DebThis is the first video in a series I am doing on narcissistic abuse and addiction and its impact on society and families. I wanted to interview and get stories from regular people, just documenting their personal experiences. I think that addiction and narcissism are both epidemics in modern society and are destroying an entire generation of people. "Narcissistic personality disorder — one of several types of personality disorders — is a mental condition in which people have an inflated sense of their own importance, a deep need for excessive attention and admiration, troubled relationships, and a lack of empathy for others. But behind this mask of extreme confidence lies a fragile self-esteem that's vulnerable to the slightest criticism. A narcissistic personality disorder causes problems in many areas of life, such as relationships, work, school, or financial affairs. People with narcissistic personality disorder may be generally unhappy and disappointed when they're not given the special favors or admiration they believe they deserve. They may find their relationships unfulfilling, and others may not enjoy being around them." If you or someone you know is in danger, please seek immediate help. I am including the contact information for several organizations that you can reach out to: National Domestic Violence Hotline: 800–799–7233 Childhelp National Child Abuse Hotline: 800–422–4453 National Suicide Prevention Lifeline: 800–273–8255 Lifeline Crisis Chat: https://suicidepreventionlifeline.org/chat National Drug Helpline: 844-289-0879 https://www.help.org/drug-abuse-hotline/ https://www.drugrehab.com/addiction/hotlines/ Remember you are NOT alone. Often mental health and substance abuse issues go hand in hand. Seeking treatment and help is one of the best things you can do for yourself if you are suffering from either disease. #addiction #mentalhealth #treatment #abuse #domesticabuse #recovery #narcissism #narcissisticabuse #disease #selfharm #rehabhttps://nicecrew.tv/static/streaming-playlists/hls/63eb453b-130a-4ef0-8f52-353b260aa33d/102891e9-e1aa-4b10-9f6b-5c69752864cf-master.m3u8https://nicecrew.tv/videos/embed/dkCtd4tjxBuviUT8jCP6gc3522012024-04-03T00:03:51.952Zmental healthabusedomestic abuserecoverytreatmentYESRadix Verum ☦NOhttps://nicecrew.tv/w/d977etsQJeUdSeMuhMa8Uyhttps://nicecrew.tv/lazy-static/thumbnails/d7950a9d-d8d8-46f8-be44-e44cd37ac18d.jpgAfghanistan & The Taliban: What is Really Happening? A different perspectiveLink to full video: https://tv.gab.com/channel/diggingdeeper/view/afghanistan-the-taliban-what-is-611982864e78f42f9e55a26f #Afghanistan #Taliban #MiddleEast #PivotToAsia #GreaterIsrael #OdedYinonhttps://nicecrew.tv/static/streaming-playlists/hls/624f60c0-238c-4b93-9b5e-7061b7b7019c/a08fbef5-2dab-400a-af2b-72cf9b57a88c-master.m3u8https://nicecrew.tv/videos/embed/d977etsQJeUdSeMuhMa8Uy34002024-04-02T23:20:45.830ZAfghanistanTalibanBreaking NewsMiddle EastGreater IsraelYESRadix Verum ☦NOhttps://nicecrew.tv/w/nbXihgN5zVmcmLWVR6CD3fhttps://nicecrew.tv/lazy-static/thumbnails/b477dcb1-d96d-4c0f-ac80-2f9bcd0854d3.jpgNarcissistic Abuse & Addiction Series, Part II: Deadcat on Addiction and Coming to ChristLink to the full interview: https://odysee.com/@RadixVerum:4/DeadcatInterview:6?r=BDxjq2LF6k5XMMSaxGqEDGL1QGPt8WNU #Addiction #Alcoholism #Treatment #Sobriety #ChristSaves #SpiritualHealinghttps://nicecrew.tv/static/streaming-playlists/hls/ab976d99-b334-4037-9ec8-8cd014aaeb86/9a660db1-f20c-49d2-87c4-470783034ee3-master.m3u8https://nicecrew.tv/videos/embed/nbXihgN5zVmcmLWVR6CD3f1478002024-04-03T00:01:41.870ZaddictiontreatmentalcoholismJesus ChristChrist SavesYESRadix Verum ☦NOhttps://nicecrew.tv/w/sv4TGGNYEfL3hRNYWGesgFhttps://nicecrew.tv/lazy-static/thumbnails/10f32e15-ee2c-4f9a-905e-530f99e9045e.jpgOversocialization and Modern LeftismSources: http://www.xahlee.org/p/um/um-s04.html https://apexsnotes.substack.com/p/oversocialization-an-introduction #Oversocialization #Leftism #Liberalism #CognitiveDissonancehttps://nicecrew.tv/static/streaming-playlists/hls/d69c9299-9c32-4941-84e4-f881103ba17d/1534c96f-4bc7-40bc-a3fe-d544f544d51f-master.m3u8https://nicecrew.tv/videos/embed/sv4TGGNYEfL3hRNYWGesgF1724002024-04-03T00:01:09.258Zoversocializationmodern leftismliberalismneoliberalover educatedYESRadix Verum ☦NOhttps://nicecrew.tv/w/prFjqFUppxTZQWLwyBMMiihttps://nicecrew.tv/lazy-static/thumbnails/635f0c0c-da05-41e5-bf98-d42f645ff339.jpgAddiction Part III: Exposing Powerful Lies on Spiritual Sickness, Suffering & AddictionInterview with Jerry of Exposing Powerful Lies on addiction, trauma, and healing. We look at the spiritual sickness underlying addiction and how the Orthodox Church is the best road for recovery. Links for Jerry: https://www.instagram.com/john.black.___.burglar/ https://m.facebook.com/PowerfulLies/ https://youtube.com/channel/UCB2oHYPXg_MEr01ZHGhFSfw If you appreciated this interview, let us know! If you are suffering from addiction please seek help and treatment. There are so many places that will help you. Addiction Hotline: 1-800-662-HELP (4357) #Addiction #Opium #Opiates #SubstanceAbuse #Recovery #Christ #Jesushttps://nicecrew.tv/static/streaming-playlists/hls/bdd80389-43f0-4b39-ae7d-03639e36d4f7/864c1538-658d-4b60-9d72-bea27d8f03c9-master.m3u8https://nicecrew.tv/videos/embed/prFjqFUppxTZQWLwyBMMii5417002024-04-03T00:07:13.080Zaddictiontreatmentrecoverysubstance abuseopiumYESRadix Verum ☦NOhttps://nicecrew.tv/w/q8fmZziWVzaPWfgjXba1oghttps://nicecrew.tv/lazy-static/thumbnails/9d086b6a-4431-4288-bde3-f404d3ed431a.jpgInterview with Rob: Addiction, Self Destruction & Redemption through ChristIn this interview, I talk to a long-time listener who suffered from alcoholism and addiction. We discuss the destroyed relationships, opportunities, and self-harm that came from this. We then get into recovery, forgiveness, and redemption. #alcoholism #substanceabuse #recovery #redemption #forgivenesshttps://nicecrew.tv/static/streaming-playlists/hls/c35e6295-56cc-403f-ac0d-dbbf5bdf0473/ed8aa4b4-e7d3-4547-a5a9-23671e8d5e70-master.m3u8https://nicecrew.tv/videos/embed/q8fmZziWVzaPWfgjXba1og3116022024-04-03T00:04:08.051ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/aMcU9abD3oSWMVd7eu1cCGhttps://nicecrew.tv/lazy-static/thumbnails/b9a3507f-2094-4fa0-b488-605a7133fdf7.jpgInterview with Maximus: Addiction, Close Calls with Death & the Healing Power of the Orthodox ChurchI interview young Maximus, who has struggled with addiction and abuse. He had several close calls where he nearly died. Christ saved him through the Holy Orthodox Church. Link to FULL INTERVIEW: https://tv.gab.com/channel/diggingdeeper/view/interview-with-maximus-addiction-close-calls-61367c752d5913dcc5247ba0 https://www.bitchute.com/video/dPzqwqZ1rrvq/ https://odysee.com/@RadixVerum:4/Maximus:2 PODCAST VERSION: https://anchor.fm/radix-verum/episodes/Interview-with-Maximus-Addiction--Close-Calls-with-Death--the-Healing-Power-of-the-Orthodox-Church-e170cvs #addiction #substanceabuse #abuse #recovery #treatment #healing #salvation #suffering #redemptionhttps://nicecrew.tv/static/streaming-playlists/hls/4f320cf3-caa2-4b5c-9b66-3e30d345323c/cf37c2c2-921d-4584-91b1-ceaefe87dbc7-master.m3u8https://nicecrew.tv/videos/embed/aMcU9abD3oSWMVd7eu1cCG1804002024-04-03T00:04:03.387Zaddictiontraumaabusesubstance abusesufferingYESRadix Verum ☦NOhttps://nicecrew.tv/w/rEJhNTJ4ioWVDpQvxgkyGLhttps://nicecrew.tv/lazy-static/thumbnails/ea65dadb-a697-4383-9fc1-d2f4816ec6b6.jpgRadix IntroShow Introhttps://nicecrew.tv/static/streaming-playlists/hls/cfdccab1-d1f0-490c-b57a-481c12756b44/e6f8a885-7ef0-4854-8a5c-d7d5fcc3825f-master.m3u8https://nicecrew.tv/videos/embed/rEJhNTJ4ioWVDpQvxgkyGL67002024-04-03T00:02:45.555ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/t3z53gWEtSk2WMyQdq1Ycxhttps://nicecrew.tv/lazy-static/thumbnails/72078757-fbea-438a-b3c9-681650e3e0f5.jpgIntro with Gregorian ChantI really like this one! Music credit: https://youtu.be/GlAQ6F8T2f0https://nicecrew.tv/static/streaming-playlists/hls/db029c7a-ea8b-4bb0-aeda-0869365e407d/c87bc667-3776-4eeb-b5cb-b16fccb64c0f-master.m3u8https://nicecrew.tv/videos/embed/t3z53gWEtSk2WMyQdq1Ycx103012024-04-03T00:03:12.222ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/agihZv6okeeWtiZq6qmFHthttps://nicecrew.tv/lazy-static/thumbnails/bf95a696-832f-4059-aff4-f18325e0fe64.jpgRadix Second Intro ReduxI have re-done the second intro.https://nicecrew.tv/static/streaming-playlists/hls/4b050fc8-7131-4ac4-a5b6-5c3dbf524621/7749cc46-8fe7-4fad-993b-6e6fcac05b93-master.m3u8https://nicecrew.tv/videos/embed/agihZv6okeeWtiZq6qmFHt102002024-04-03T00:03:01.072ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/md3tgtG1Pnj8LW3668K7iYhttps://nicecrew.tv/lazy-static/thumbnails/2c558cd8-61e6-4c50-99e1-67f02b4a630a.jpgSpirit of OrthodoxyJust having fun with editing and all that!https://nicecrew.tv/static/streaming-playlists/hls/a3a53880-118c-42ce-950a-130d15281d72/6070bfb4-0608-4e91-ae37-a3b3b46d4a85-master.m3u8https://nicecrew.tv/videos/embed/md3tgtG1Pnj8LW3668K7iY175012024-04-03T00:03:34.471ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/nvd4sC5ry9QqbNLGW2obKXhttps://nicecrew.tv/lazy-static/thumbnails/b0e835fc-f889-4c86-b270-33720e53b901.jpgX Files Style IntroSince you guys always call me Agent Scully, I figured I would make an X-Files style intro...https://nicecrew.tv/static/streaming-playlists/hls/ae23e9c7-d970-4d91-a014-f482311aa39d/8f4f01a2-2c51-4f1d-a5c8-08c15fa663b5-master.m3u8https://nicecrew.tv/videos/embed/nvd4sC5ry9QqbNLGW2obKX43022024-04-03T00:03:15.575ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/1kRfU95nnfje9GPCMCnuRwhttps://nicecrew.tv/lazy-static/thumbnails/22e368e6-52d5-481c-bbde-a9cd3f377154.jpgInterview with Jon Pro: Demonic Possession & Spiritual RealityLink to FULL INTERVIEW: https://tv.gab.com/channel/diggingdeeper/view/interview-with-jon-pro-on-demonic-6151fac592186a8a0cfee6c5 https://odysee.com/@RadixVerum:4/JonPro:f?r=BDxjq2LF6k5XMMSaxGqEDGL1QGPt8WNU https://www.bitchute.com/video/OQiOjNf0vu2l/ I interview Jonathan Proby, an artist, and Iconographer about so-called "mental illness", a recent experience he had meeting a possessed man and the underlying spiritual reality of the world. Jon's Links: https://www.jonproby.com https://t.me/jonprobyartandeconomia #Demons #DemonicInfluence #Possession #DemonicPossession #Orthodoxyhttps://nicecrew.tv/static/streaming-playlists/hls/02c57cbd-10eb-496f-bfc7-2127ea54ce50/6975e36a-caab-4041-9f4e-a9514d8c3652-master.m3u8https://nicecrew.tv/videos/embed/1kRfU95nnfje9GPCMCnuRw286012024-04-03T00:03:26.862ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/jxBoWjebihTvtGgFU3ozdJhttps://nicecrew.tv/lazy-static/thumbnails/56335acb-f142-43ba-80f3-89ccc696a470.jpgInterview with Tricia: Schizophrenia, Prison Abuse of Women & the Legal RacketLINK TO FULL INTERVIEW: https://tv.gab.com/channel/diggingdeeper/view/interview-with-tricia-schizophrenia-prison-abuse-615a2578d7e8665849bda96d FYI: Trigger warning regarding abuse and sexual assault. If these topics trigger you, maybe skip this interview. #Prison #MentalIllness #Abuse #Narcissism #Schizo #Schizophreniahttps://nicecrew.tv/static/streaming-playlists/hls/962e5db0-83be-4f83-87d8-85c4e28775d6/15c611d6-c398-4963-87ae-c23cfd1c6cbc-master.m3u8https://nicecrew.tv/videos/embed/jxBoWjebihTvtGgFU3ozdJ558002024-04-03T00:03:55.175ZSchizophreniaPrisonSexual AbusePrison LifeMental IllnessYESRadix Verum ☦NOhttps://nicecrew.tv/w/8yc51Z4se7gzdc9SsPfw2bhttps://nicecrew.tv/lazy-static/thumbnails/d0e928d7-1834-4f4a-868c-9ca5257d2299.jpgDead Internet Theory: Something Strange has Happened to the Internet...In this video, we review a thread that was posted on an internet forum that posits the internet as it used to exist is dead. At the beginning of the internet, there were tons of amazing and original websites and content. It really was like the wild wild west. While the internet was always a creation and tool of the military, it was first sold to us as a way to empower citizens and democratize media. We were told the internet would help spread democracy around the world. That it would help bring freedom. At first, that seemed to be true but then something happened. Governments and corporations slowly began locking it down. They began to change the internet and turn it into a tool for manipulation, propaganda, social engineering, advertising, and mindless consumerism. Governments began using it for mass global surveillance and tracking. Corporations began using it for personalized, micro-targeted adverts. Big Tech started sucking up all competition and turning into the global conglomerates we see today. They saw they could use their platforms for social engineering and to "nudge" people. They start employing behavior modification and other psychological operations on their users. Say something the company doesn't like? Now you are in time out. Promote something the company likes, and your post gets boosted and you get a dopamine rush. Eventually, people learn to modify their behavior in a way that is consistent with what the algorithms and platforms want. Link to Thread: https://forum.agoraroad.com/index.php?threads/dead-internet-theory-most-of-the-internet-is-fake.3011/ #BehaviorModification #Bots #AI #MachineLearning #Experiment #SocialEngineering #SocialTheory #Nudge #Microtargeted #Algorithms #Sterile #Control #SurveillanceCapitalism #ClosedFeedbackLoop #technology #Science #Programming #Codinghttps://nicecrew.tv/static/streaming-playlists/hls/3d2e97ca-6ce6-4e9a-adf6-632d918bdc5c/95054605-8d7f-4082-91e3-bcb88ae25130-master.m3u8https://nicecrew.tv/videos/embed/8yc51Z4se7gzdc9SsPfw2b2056052024-04-03T00:06:13.576ZSocial EngineeringDead Internet TheoryBotsA.I.Predictive AnalyticsYESRadix Verum ☦NOhttps://nicecrew.tv/w/rvHT2FpST4RgQtgm9BuRZZhttps://nicecrew.tv/lazy-static/thumbnails/1ebdb011-f882-44ea-aa6c-4037c5287db9.jpgWang Huning & The Spectre of Western Liberalism's DecayWe talk about Chinese philosopher Wang Huning and his political thoughts about American and "liberalism". Sources: https://www.revolver.news/2021/10/secret-chinese-philosopher-lessons-for-america/ https://palladiummag.com/2021/10/11/the-triumph-and-terror-of-wang-huning/ #China #WesternDecay #Liberalism #Democracy #Nationalism #WangHuning #AmericaAgainstAmericahttps://nicecrew.tv/static/streaming-playlists/hls/ce9ad85d-ada5-48b7-8341-4e0b56de6d17/ce837f70-3756-47de-aba9-5c1940417860-master.m3u8https://nicecrew.tv/videos/embed/rvHT2FpST4RgQtgm9BuRZZ2694002024-04-03T00:06:21.978ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/qBSgaXhyT1dDNuDe9oZwp8https://nicecrew.tv/lazy-static/thumbnails/f230e1a9-43f0-4fb0-99cd-fe11cb6f45d4.jpgStudy Shows Childhood Trauma & Stress Changes the BrainA study from December of 2017 has found that adults who experienced trauma and high stress as children have an inability to process information that should tell them they are headed to a bad place or making a wrong decision. "Adults who endured high levels of stress within their childhood have difficulty reading signs of potential punishment or loss, which makes them vulnerable to certain avoidable health, legal, and financial problems." Sources: https://gobigread.wisc.edu/2017/12/two-uw-madison-professors-investigate-childhood-trauma-effects/ https://news.wisc.edu/gambling-against-the-odds-on-lifes-risks-more-common-after-childhood-stress/ #CPTSD #PTSD #Trauma #ChildhoodTrauma #Stress #HighStress #Brain #Imaginghttps://nicecrew.tv/static/streaming-playlists/hls/c75d55a7-996f-4776-90c5-5eb529e8607d/0506988d-0489-44d6-8141-1a09f3862369-master.m3u8https://nicecrew.tv/videos/embed/qBSgaXhyT1dDNuDe9oZwp82076002024-04-03T00:05:40.734ZStressChildhood TraumaTraumaPTSDCPTSDYESRadix Verum ☦NOhttps://nicecrew.tv/w/fNi16JXs5EmFgxTKpgz5o3https://nicecrew.tv/lazy-static/thumbnails/cfc72504-ac48-4c68-a727-328a77f1b606.jpgYoung Women are Toxic...I can see why young men are not committing to women anymore, and why they are "going their own way". Women are insane and social media has just made this so much worse. These young women don't know what it is they actually want. Young men, I have some advice about what women actually want versus what they think they want that maybe will help you navigate the landmines. #ToxicWomen #NarcissisticWomen #WhatDoWomenWanthttps://nicecrew.tv/static/streaming-playlists/hls/77d6a1e0-9fc4-4517-bb5b-73a741fd7346/162a9813-05ac-4020-864f-917d69086651-master.m3u8https://nicecrew.tv/videos/embed/fNi16JXs5EmFgxTKpgz5o31838032024-04-03T00:06:15.227ZToxic WomenWhat Do Women Want?Narcissistic WomenYoung WomenWomen are CrazyYESRadix Verum ☦NOhttps://nicecrew.tv/w/1hHMkiYPv1HtRxodX21i9vhttps://nicecrew.tv/lazy-static/thumbnails/345766f3-dc22-429f-b5c8-5ec13a7d7420.jpgComfort is the Enemy: Get Outside your Comfort ZoneI wanted to talk about the problem with comfort and remaining inside your "comfort zone" and why this is so dangerous. When you are in your comfort zone and everything is going well, you aren't challenging yourself and you are not growing. It is adversity and struggle that keeps us fighting, growing, improving, and pushing ourselves to achieve things that perhaps we didn't think we were capable of achieving. #Comfort #Growth #Adversity #Motivation #Challenges #Struggles #Complacencyhttps://nicecrew.tv/static/streaming-playlists/hls/0255a62e-83d0-4b17-9512-b6e24966f2c1/08a777a1-fb43-4445-8bf3-92c9ee3a78ce-master.m3u8https://nicecrew.tv/videos/embed/1hHMkiYPv1HtRxodX21i9v1269042024-04-03T00:06:38.302ZcomfortcomplacencyadversitychallengesstruggleYESRadix Verum ☦NOhttps://nicecrew.tv/w/rv1aMSKnU1tuBufvcCvvXmhttps://nicecrew.tv/lazy-static/thumbnails/2219ee7c-2e2d-44d4-8351-dc56e283d751.jpgCodependency: An Addiction Based on TraumaCo-dependency can be a result of trauma, a trauma response. Oftentimes people develop co-dependency due to addiction and from an insecure attachment style. This typically stems from childhood trauma – so bad experiences you had as a child. Attachment theory and attachment styles are something I am going to discuss in greater length in the book I am currently writing. Basically, attachment is how we relate to others. It’s about the quality of our bonding with other people in our lives. A secure attachment is where there is a healthy attachment and relationship – there are coping skills, good communication, trust, boundaries, and the ability to handle it when things get difficult. Insecure attachments however stem from traumatic childhood experiences where the child did not have a secure attachment with the primary caretaker. They can be anxious, avoidant, or both... #Codependence #Addiction #Trauma #PTSD #CPTSD #InsecureAttachment #Attachment #AttachmentTheoryhttps://nicecrew.tv/static/streaming-playlists/hls/ce8123ce-0303-4cf2-bd0e-755819b7de86/f515f44b-9c4e-4222-96bd-1fd2af95a9b8-master.m3u8https://nicecrew.tv/videos/embed/rv1aMSKnU1tuBufvcCvvXm2239022024-04-03T00:07:22.906ZAddictionSelf DevelopmentSelf ImprovementAttachmentAttachment TheoryYESRadix Verum ☦NOhttps://nicecrew.tv/w/iyhoTS992S48fskafdopb7https://nicecrew.tv/lazy-static/thumbnails/f86401b5-8c1f-4f98-acd4-68b4aa1d66b0.jpgHow to Let Go (For Insecure Attachment Style)Learning to let go is one of the most important things you can do as an adult. For people who have an insecure attachment style, this can be incredibly difficult. When you are attached to something, it’s because you have given it some kind of meaning. What you are really attached to is the meaning that you have assigned to this person or thing. You need to let go of things that are not serving you. Take a mental inventory, write it down if you need to. Do a cost/benefit analysis. For people with insecure attachment styles, they felt like they were out of control as children. So as adults, they often try to micromanage and they want to control things, people, and the outcomes. This ends up causing the opposite to happen because of the energy you are putting off. While you are being weighed down with these negative emotions and energy you are not open to the right thing or person coming into your life. Let go of the desire to run from the negative emotions you don’t want to feel – like shame, rejection, hurt, and abandonment. This has to do with your self-image, your identity, and the power that you are giving to that thing that you don’t want to let go of. For many people who were traumatized or neglected as children they didn’t get a chance to build up a strong send of self, maybe they were constantly put down and told you are bad, you are worthless. Maybe they were made to feel shame when they expressed themselves, maybe they had to walk on eggshells and learned to become people pleasers and change themselves to keep others around them happy. #LetGo #LettingGo #Attachments #Spiritualityhttps://nicecrew.tv/static/streaming-playlists/hls/8e2d42ef-afec-407e-bb63-18a72fba7536/5561cb83-1cec-47ee-bbd2-cd37055f2f3d-master.m3u8https://nicecrew.tv/videos/embed/iyhoTS992S48fskafdopb71092022024-04-03T00:06:30.727Zlet gohow to let goletting goattachmentattachment theoryYESRadix Verum ☦NOhttps://nicecrew.tv/w/kHEnJ8qN8uSHSXbuMcfGyGhttps://nicecrew.tv/lazy-static/thumbnails/4aefdb2f-a306-45eb-9bca-99ed72572314.jpgThe Batman: A Review (2022)I went to see the latest Batman film, called The Batman starring Robert Pattinson as Batman, Zoe Kravitz as Cat woman, Paul Dano as The Riddler and Colin Farrell as the Penguin. Synopsis: Batman ventures into Gotham City's underworld when a sadistic killer leaves behind a trail of cryptic clues. As the evidence begins to lead closer to home and the scale of the perpetrator's plans become clear, he must forge new relationships, unmask the culprit and bring justice to the abuse of power and corruption that has long plagued the metropolis. The film is a sort of noir detective thriller mixed with Batman, which I liked but I do think there were some issues with the plot. I would have preferred more character development but at 3 hours long, it would have just made the film even longer. Overall, I would give this film a 3.5 out of 5 stars. There was the usual Hollywood social justice propaganda but that was also undermined by several other plot points. #TheBatman #Batman #RobertPattinson #ZoeKravitz #ColinFarrell #DC #Riddlerhttps://nicecrew.tv/static/streaming-playlists/hls/9faec73e-2d1b-427c-b9de-178784c99708/896ddef4-8d4b-40bf-a614-3c5cfe2fd80d-master.m3u8https://nicecrew.tv/videos/embed/kHEnJ8qN8uSHSXbuMcfGyG1326002024-04-03T00:06:57.329ZThe BatmanFilm ReviewBatmanRobert PattinsonColin FarrellYESRadix Verum ☦NOhttps://nicecrew.tv/w/m2gLZ684u6Ye2q6YrSxt2Qhttps://nicecrew.tv/lazy-static/thumbnails/f005698e-84a2-4179-932a-26215bf470c7.jpgJohnny Depp v. Amber Heard: Inside the Courtroom, Days 5-11I have been attending the trial in person in Fairfax County, Virginia. I wanted to share some insights from inside the courtroom, that you wouldn't see unless you were there in person. There are many channels covering this, giving recaps and play by plays. I am not interested in that. I just wanted to provide some information that you wouldn't see on the Livestream, etc. #Depp #Heard #JohnnyDepp #AmberHeard #Trial #Defamationhttps://nicecrew.tv/static/streaming-playlists/hls/a2243d30-9fe4-43ae-8c94-132c2c9f204e/cc42e258-8405-4e01-b1b3-41a994821fcd-master.m3u8https://nicecrew.tv/videos/embed/m2gLZ684u6Ye2q6YrSxt2Q2201002024-04-03T00:07:59.413ZJohnny DeppAmber HeardDefamationDomestic ViolenceDomestic AbuseYESRadix Verum ☦NOhttps://nicecrew.tv/w/aStNiN7qVvW88qmtDUt5JFhttps://nicecrew.tv/lazy-static/thumbnails/9d3e52de-6e9f-4b74-a3b2-2b268cb7aaad.jpgAmber Heard and the Terror of Borderline WomenSince I was unable to make it into the Courthouse today having arrived early but not expecting the insane amount of people that showed up, way more than in prior weeks I figured I would briefly talk about Amber Heard and the terror of Borderline women. These women who suffer from Borderline Personality Disorder, or BPD often display volatile and explosive rage when they do not get their way. They act out like a spoiled and petulant child and they have a pattern of behavior that can be observed if you know what to look for. In this vein, Amber's behavior is not shocking at all, in fact it makes a lot of sense. The Borderline can display sociopathic and even psychopathic behavior, and can suspend guilt or empathy in order to carry out their "vengeance." The Borderline can thus be an incredibly dangerous individual. #AmberHeard #Depp #JohnnyDepp #Depp #Heard #Borderline #BPD Sources: https://lovefraud.com/the-borderline-personality-as-transient-sociopath/ https://www.henrymakow.com/borderline_personality_disorde.htmlhttps://nicecrew.tv/static/streaming-playlists/hls/4fee915b-e4ee-4601-81f3-e1b7a9642c93/af7a950c-72d0-4aaf-9db4-f58ab714195d-master.m3u8https://nicecrew.tv/videos/embed/aStNiN7qVvW88qmtDUt5JF2228012024-04-03T00:07:47.303ZAmber HeardJohnny DeppDepp vs HeardBPDNarcissistic AbuseYESRadix Verum ☦NOhttps://nicecrew.tv/w/5YcWBp3SA3uTMj4ETvLPo6https://nicecrew.tv/lazy-static/thumbnails/6aad5439-27ba-4d5e-86b9-7b6181cce561.jpgAmber Heard Fires PR Team in Desperate, Last-Ditch Effort to WinAccording to the New York Post, Amber Heard has fired the PR team Precision Strategies after the negative coverage she has received. She has hired Shane Communications, headed up by CEO David Shane. She claimed she doesn't like "bad headlines," according to a "source." PR teams cannot change the facts of the case, nor can they erase the evidence that has already come out. This looks like a desperate, last-ditch effort to salvage her public image. #AmberHeard #JohnnyDepp #DeppvHeard #Depp #Heard #PR #ShaneCommunications #PrecisionStrategies #Defamation https://nypost.com/2022/05/01/amber-heard-fires-pr-team-days-before-shes-set-to-testify-after-tons-of-bad-press/https://nicecrew.tv/static/streaming-playlists/hls/283d90a4-396b-458b-beb7-35e4c523142d/ed562fc8-2026-4182-8446-3cd785f58bd6-master.m3u8https://nicecrew.tv/videos/embed/5YcWBp3SA3uTMj4ETvLPo6371002024-04-03T00:06:44.781ZAmber HeardJohnny DeppDepp vs HeardDefamationShane CommunicationsYESRadix Verum ☦NOhttps://nicecrew.tv/w/4quvLDCGHh1AwMYPQ1bWf8https://nicecrew.tv/lazy-static/thumbnails/445d8957-ff14-4319-8c70-4aaebad6e3f9.jpgMichigan "Whitmer Kidnapping" Plot: Adam Fox & Barry Croft Seek AcquittalsThe latest in the so-called Michigan "Whitmer Kidnapping Plot" case, after a trial that began March 8, 2022, and ended on April 8, 2022, with 2 defendants - Brandon Caserta and Daniel Harris being found NOT GUILTY and a mistrial declared for defendants Adam Fox and Barry Croft - is a Motion from Adam Fox and Barry Croft seeking acquittals in the case. "The motions from Adam Fox and Barry Croft Jr. follow a federal jury’s April 8 decision to find Wolverine Watchmen Daniel Harris and Brandon Caserta not guilty of conspiring to kidnap Whitmer. Jurors failed to reach a verdict on Fox and Croft." #WhitmerPlot #WolverineWatchman #AdamFox #BarryCroft #FBI #Entrapment https://archive.ph/6IuPohttps://nicecrew.tv/static/streaming-playlists/hls/1bb6d6a0-a125-4338-abbe-ccbdfc81ef1b/0c949585-621d-486e-94ef-bdad0eed2367-master.m3u8https://nicecrew.tv/videos/embed/4quvLDCGHh1AwMYPQ1bWf81104002024-04-03T00:08:13.412ZFBIEntrapmentDomestic TerrorRichard TraskJayson ChambersYESRadix Verum ☦NOhttps://nicecrew.tv/w/nWzCLLpoHss7mcJZoJF69Yhttps://nicecrew.tv/lazy-static/thumbnails/11ad16ae-79b6-4224-9bb1-2e03b482e7e2.jpgCringe & Insane Women of TikTok Compilation with CommentaryTikTok is filled with videos of absolutely insane women. These women are out of control. It is no wonder men do not want to commit to these women. Moder women act delusional, deranged, arrogant, entitled, narcissistic, hypersexual, and vulgar. There is nothing attractive about this sort of behavior and attitude. Some of these women appear mentally ill and unhinged. They expect constant attention, validation, and praise for simply existing. It's all so tiresome. Get it together ladies! Humble yourself before the Lord. There is no self-reflection, no accountability, and no long-term thinking. These women act like children. They act like petulant, spoiled brats. It isn't cute and it isn't funny. It is no wonder men are going their own way. #TikTok #Compilation #Cringe #Feminism #Women #MGTOWhttps://nicecrew.tv/static/streaming-playlists/hls/b1aecd99-b82b-4606-a708-c8c8ec117874/5325d846-d3bb-44f4-854f-72a10241d2d0-master.m3u8https://nicecrew.tv/videos/embed/nWzCLLpoHss7mcJZoJF69Y3491022024-04-03T00:09:02.062ZCringeWomenFemalesTikTokWomen of TikTokYESRadix Verum ☦NOhttps://nicecrew.tv/w/5yYPK2MGFs3HXdH5SAqbM7https://nicecrew.tv/lazy-static/thumbnails/9336ec07-38e5-4e04-8123-fea2a662e104.jpgLeon Black & Jeffrey Epstein: A Deep Dive, Plus DNA Data Mining and the Biden AdminI wanted to provide a deep dive on Leon Black, former co-founder and CEO of Apollo Global Management, a public hedge fund with around $400 billion in assets under management. Leon Black has publicly stated his relationship with Jeffrey Epstein was "professional," and that he was not aware of Epstein's "abhorrent" behavior. According to Guzel Ganieva a Russian model who is currently suing black, that is not true. She makes numerous allegations not just about Black's own sexual violence but about his "best friendship" with Epstein. She mentions meeting Sarah Kellen and Ghislaine Maxwell who tried to get her to become a "global citizen." She claims Black told her Epstein was trying to create his own "town" in New Mexico, with his own schools and law enforcement. Leon Black and Epstein are tied to Eric Lander who was involved in DNA data mining and is now working for the Biden administration. Sources: https://iapps.courts.state.ny.us/nyscef/ViewDocument?docIndex=ckR/2pvKRTDvttYfYyBxtg== https://twitter.com/kbriquelet/status/1485994444168077317 https://twitter.com/gumby4christ/status/1316116256051867648 https://twitter.com/Loveon999/status/1354238800503955460 https://twitter.com/Loveon999/status/1354914455872819201 https://www.vanityfair.com/news/2020/09/what-was-leon-black-doing-with-trump-in-russia https://twitter.com/pc_432/status/1399153535862771720 https://twitter.com/pc_432/status/1313600694176284672 https://twitter.com/Deeeviouss/status/1356150740897718273 #LeonBlack #Apollo #JeffreyEpstein #GhislaineMaxwell #GuzelGanieva #Biden #DNAhttps://nicecrew.tv/static/streaming-playlists/hls/24ff5fb0-2d14-4672-a842-a389d0593440/0438ae1d-e299-40d3-b1d0-16109f5061b5-master.m3u8https://nicecrew.tv/videos/embed/5yYPK2MGFs3HXdH5SAqbM74512002024-04-03T00:09:34.152ZLeon BlackApollo Global ManagementJeffrey EpsteinGhislaine MaxwellSarah KellenYESRadix Verum ☦NOhttps://nicecrew.tv/w/qLL1JwcubpXGs1rNDe9HGLhttps://nicecrew.tv/lazy-static/thumbnails/e46ee52b-5b91-4141-902f-23021e617c88.jpgAmber Heard WRECKED on Cross by Camille VasquezAmber Heard got demolished by Johnny Depp lawyer Camille Vasquez. Her lies, inconsistencies, and aggressive behavior were all on display today in court. Camille was able to show photographic evidence that contradicted Amber's allegations. Amber became smug and condescending at times, and even brash and arrogant. COPE AND SEETHE AMBER. SNEED. #AmberHeard #CamilleVasquez #JohnnyDepp #DeppvHeardhttps://nicecrew.tv/static/streaming-playlists/hls/c89b2d6e-db89-4e0e-bf91-80b87363d130/23389503-9db7-4578-99d0-daf428a78f95-master.m3u8https://nicecrew.tv/videos/embed/qLL1JwcubpXGs1rNDe9HGL2860002024-04-03T00:09:18.003ZJohnny DeppAmber HeardCamille VasquezElaineDefamationYESRadix Verum ☦NOhttps://nicecrew.tv/w/9usTuapooBmXa6DbkM4zE4https://nicecrew.tv/lazy-static/thumbnails/464550de-e381-4b3a-8874-f1db78e5d1a5.jpgDepp v Heard Day 17 Recap: Amber's Insane Cackling Laughter, Taunting Johnny "Suck my dick"On day 17 of the Johnny Depp v Amber Heard Defamation trial Camille Vasquez continue her epic takedown of Amber. Amber has now repeatedly perjured herself. We heard audio of Amber taunting and belittling Johnny Depp telling him to "suck her dick," while doing this maniacal super villain laugh. Truly terrifying stuff. https://twitter.com/cocainecross/status/1523787510609981440 #AmberHeard #JohnnyDepp #DeppvHeard #CamilleVasquezhttps://nicecrew.tv/static/streaming-playlists/hls/44c28145-3bb7-481c-904c-ca0ded1fed6b/8754a0d7-81eb-45a6-852f-b7050f757010-master.m3u8https://nicecrew.tv/videos/embed/9usTuapooBmXa6DbkM4zE43087002024-04-03T00:10:30.587ZJohnny DeppAmber HeardDepp vs HeardJohnny Depp vs Amber HeardCamille VasquezYESRadix Verum ☦NOhttps://nicecrew.tv/w/6tNy1JA9tHaNEdaymGwnSKhttps://nicecrew.tv/lazy-static/thumbnails/b59698e2-9aad-4555-90bc-89915b925be1.jpgMSM "journalists" Demand Social Media Censor Amber Heard's Lies, Vogue Demands Believe All WomenRolling Stone Magazine, NBC News, and Vogue Magazine, potentially more mainstream publications have been furiously contacting social media platforms like Twitter and TikTok and demanding they remove videos that regular content creators and ordinary people have made that point out Amber Heard's inconsistencies and lies. They claim that memes and jokes are actually "violence," and that we are witnessing a modern-day "witch hunt" of Amber Heard. No, this is a fair trial in a court of law. Amber has access to a high-powered team of attorneys that unprivileged regular people do not have access to. She has a PR team that regular people don't have and friendly mainstream media outlets that once again the average person doesn't have access to. The media is really upset that lawyers on YouTube, known as the "LawTube" community are getting more viewers than them. They see this as competition and a challenge to their grip on the public narrative as well as their ability to manipulate public opinion for political and ideological reasons. They are smear merchants, and they operate as a cartel and monopoly with billions of dollars at stake for them. They are not interested in the truth or factual, objective reporting. They are interested in control and propaganda. Sources: https://blog.nomorefakenews.com/2022/05/18/tik-tok-rolling-stone-nanny-state-johnny-depp-amber-heard-defamation-lawsuit/ https://www.nbcnews.com/news/amp/rcna28572 https://twitter.com/TheMarieOakes/status/1524170408789958656 https://www.vogue.com/article/why-its-time-to-believe-amber-heard/amp #MSM #Depp #Heard #AmberHeard #JohnnyDepp #DeppvHeard #Defamation #RollingStone #Voguehttps://nicecrew.tv/static/streaming-playlists/hls/2c5f76b7-e999-45be-8a0d-fcb1ba0869a3/4e6058d7-4a2d-43c0-a48d-50b4badfbf80-master.m3u8https://nicecrew.tv/videos/embed/6tNy1JA9tHaNEdaymGwnSK1478002024-04-03T00:08:23.200ZRollingStoneRolling Stone MagazineVogueTikTokTwitterYESRadix Verum ☦NOhttps://nicecrew.tv/w/8qTEV5Cjb1qVBrYzFsS7CEhttps://nicecrew.tv/lazy-static/thumbnails/59e0f330-8ff0-48f2-8259-3a88b8515146.jpgWho is "Armand"? Buffalo Mass Shooter Groomed in Discord by Federal Agent?I have been looking into the Buffalo Mass Shooter Payton Gendron. I did a two-hour deep dive which is available on my Odysee channel - I couldn't post it here for obvious reasons. Link below. The main question that MUST be asked now is who is the mysterious "ARMAND" that was communicating with Payton in discord for months? What sort of "pledge" were they talking about? Did Payton attempt a shooting in March of 2022 but his gun malfunctioned? More information: https://odysee.com/@RadixVerum:4/PaytonGendron:4?r=BDxjq2LF6k5XMMSaxGqEDGL1QGPt8WNU https://counter-currents.com/2022/05/payton-gendron-and-the-buffalo-massacre/ #Buffalo #MassShooter #PaytonGendron #Discord #Twitch #Groominghttps://nicecrew.tv/static/streaming-playlists/hls/3c29aa19-b908-456a-af95-043ad8100736/956981e8-774d-41df-b7d2-554868a438c9-master.m3u8https://nicecrew.tv/videos/embed/8qTEV5Cjb1qVBrYzFsS7CE871052024-04-03T00:08:31.704ZBuffalo Mass ShooterPayton GendronDiscordTwitchO9AYESRadix Verum ☦NOhttps://nicecrew.tv/w/aki8DegPSKv1YFFEWYuao8https://nicecrew.tv/lazy-static/thumbnails/5c219c74-0e37-4c8f-bb89-0c761c981b9c.jpgAmber Heard's Expert Witness DESTROYED by Camille VasquezDr. Moore, Amber Heard's $5k a day "expert witness" gets straight-up FELTED, demolished by Camille Vasquez. This was an epic takedown by Johnny Depp's lawyer. #JohnnyDepp #AmberHeard #DeppvHeard #CamilleVasquezhttps://nicecrew.tv/static/streaming-playlists/hls/4b93eff8-c9e9-45a7-b103-e8a319ae98e7/ed9f418d-b645-4456-a467-b57a1c610185-master.m3u8https://nicecrew.tv/videos/embed/aki8DegPSKv1YFFEWYuao8956002024-04-03T00:09:22.385ZJohnny DeppAmber HeardDepp v HeardJohnny Depp vs Amber HeardCamille VasquezYESRadix Verum ☦NOhttps://nicecrew.tv/w/mwZp3cAbGRirqYX15biDpXhttps://nicecrew.tv/lazy-static/thumbnails/f237eeaf-9ced-4500-a784-e1ebaaad2d02.jpgAmber Heard's Combative Expert Witness Dr. Spiegel Shouts & Yells at Johnny Depp's LawyerAmber Heard brought in "expert witness" David R. Spiegel, a physician psychiatrist who works at the Eastern Virginia Medical School and he went off on Johnny Depp's lawyer. He was the most combative and argumentative witness so far, actually shouting at one point in the courtroom. He kept talking in circles and going off into the weeds, refusing to provide simple yes or no answers to questions. According to TUG, Dr. Spiegel drove 2 patients to suicide! https://twitter.com/ThatUmbrella/status/1528741127708360704 #JohnnyDepp #AmberHeard #DeppvHeard #Spiegelhttps://nicecrew.tv/static/streaming-playlists/hls/a64a7565-cc45-4eb0-b4fd-26475bc1a6e9/6a5995c0-bbd1-4866-8eb2-7ac293c96c31-master.m3u8https://nicecrew.tv/videos/embed/mwZp3cAbGRirqYX15biDpX3304002024-04-03T00:11:32.375ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/ndibBuBPV4GyfkmVQkToJ6https://nicecrew.tv/lazy-static/thumbnails/120c6ede-9a0d-418c-af3c-07cc29d15312.jpgWalter Hamada Just Destroyed Amber Heard's $100 Million Dollar Counterclaim!Walter Hamada, executive and producer, President of DC-based film production for Warner Brothers has blown Amber Heard's claims about the Aquaman contract out of the water. Amber's "expert witness" Kathryn Arnold testified yesterday that there was great chemistry between Jason Momoa and Amber Heard and Walter testified today there was no chemistry and they had to fabricate it in editing. Walter testified that Amber was never fired and thus never had to be re-hired for Aquaman 2, her role was never reduced, and Adam Waldman's statements had nothing to do with any of their decisions.https://nicecrew.tv/static/streaming-playlists/hls/abc76d2d-aa44-4bbe-98ee-aaf7782d1309/c9cdce23-39d0-4beb-b0d4-9c20951bc564-master.m3u8https://nicecrew.tv/videos/embed/ndibBuBPV4GyfkmVQkToJ61091002024-04-03T00:09:53.119ZWalter HamadaAquamanAquaman 2DC UniverseJason MomoaYESRadix Verum ☦NOhttps://nicecrew.tv/w/11ThpBajzZLWygjBMYhD3Dhttps://nicecrew.tv/lazy-static/thumbnails/47e33ea9-cb5e-4c19-b913-3e99de8c23ec.jpgAmber Heard's Expert Kathryn Arnold WRECKED by Richard Marks (Depp vs Heard)Amber Heard's so-called "expert witness" for damages Kathryn Arnold was absolutely wrecked by Richard Marks. He says she built a "house of cards" and that she pulled things from thin air. He said she didn't provide a baseline or any background and numbers for the comps she had set up. He said that Zendaya was not a comparable actor or career to evaluate against Ms. Heard. He refers to Ms. Arnold's testimony as "highly speculative," and "not worth the paper it was written on." He said she's not an expert in deal-making and that her assessment is built on "nothing." This was absolutely savage!https://nicecrew.tv/static/streaming-playlists/hls/001f9aac-ad2a-4139-8484-daeb7b5d60ad/e16de54b-c17b-41a2-aa61-ca7d6d6148e9-master.m3u8https://nicecrew.tv/videos/embed/11ThpBajzZLWygjBMYhD3D2597002024-04-03T00:10:40.205ZJohnny DeppAmber HeardDepp vs HeardJohnny Depp vs Amber HeardJustice for JohnnyYESRadix Verum ☦NOhttps://nicecrew.tv/w/3FQFnSCeuM6AtAj1pD5UZ4https://nicecrew.tv/lazy-static/thumbnails/45d55698-4677-41b6-937d-21f9e1b7e78f.jpgDoug Bania Shows Amber Heard's Bad Q Scores, Lack of Popularity and Star Power (Depp v Heard)Johnny Depp's Intellectual Property Expert Doug Bania presents data that contradicts claims by Amber Heard's Expert Kathryn Arnold. He shows that Amber had the lowest positive Q scores after Aquaman and BEFORE the Waldman statements as well as the HIGHEST NEGATIVE ratings as well. She had the least number of social media followers out of the comps that Ms. Arnold presented. #JohnnyDepp #AmberHeard #DougBania #DeppvHeardhttps://nicecrew.tv/static/streaming-playlists/hls/15c248a6-f824-47f6-b9ee-e724724dd28d/7da4465c-e930-4af2-a616-c5f3129b85bd-master.m3u8https://nicecrew.tv/videos/embed/3FQFnSCeuM6AtAj1pD5UZ42230002024-04-03T00:10:49.287ZJohnny DeppAmber HeardDepp vs HeardDepp v HeardDefamationYESRadix Verum ☦NOhttps://nicecrew.tv/w/oRh5KS1CCCtMyyPbkPSjeJhttps://nicecrew.tv/lazy-static/thumbnails/5ab13284-510f-4df8-acd2-7931f5ec06ae.jpgAmber Heard Acting CREEPY & WEIRD In Court! (Johnny Depp vs Amber Heard)What the heck was she doing with these faces in court today? Did you all get a super creepy vibe from this? Was she starting into your soul? #AmberHeard #JohnnyDepp #DeppvHeard #JusticeForJohnnyhttps://nicecrew.tv/static/streaming-playlists/hls/b90a67f8-9845-46eb-9a6c-bfd11bb18444/0dd17e11-c800-4e25-910f-389f6ec45e98-master.m3u8https://nicecrew.tv/videos/embed/oRh5KS1CCCtMyyPbkPSjeJ109002024-04-03T00:09:23.853ZAmber HeardJohnny DeppJustice for JohnnyJustice for Johnny DeppAmber TurdYESRadix Verum ☦NOhttps://nicecrew.tv/w/fokhCJH5VR4Jz84Yuo642shttps://nicecrew.tv/lazy-static/thumbnails/19cdbcc0-8a76-4749-9537-b6e73960b641.jpgMorgan Knight Identifies Amber Heard as the "Abuser," Says Johnny Depp "Cowered," in HicksvilleMorgan Knight testified today that he witnessed Amber Heard become angry and yell at Johnny Depp while they were staying at his trailer park in Hicksville. He said that it triggered him because he has been in emotionally abusive relationships. He said he saw Johnny cower and that shocked him because Johnny was older than Amber. He said Johnny became despondent and quiet the rest of the night. #MoragnKnight #JohnnyDepp #AmberHeard #AmberHeardIsAnAbuserhttps://nicecrew.tv/static/streaming-playlists/hls/747e30a9-34bb-4428-92fd-0662c42055e8/fefaf226-2cb9-4db0-92fa-8620cd7b360c-master.m3u8https://nicecrew.tv/videos/embed/fokhCJH5VR4Jz84Yuo642s1004002024-04-03T00:09:47.112ZJohnny DeppAmber HeardMorgan KnightHicksvilleDepp v HeardYESRadix Verum ☦NOhttps://nicecrew.tv/w/e7dsyeXmFaUTzFxCL8BMAPhttps://nicecrew.tv/lazy-static/thumbnails/095e4268-c400-4001-8bf3-68996e488853.jpgDr. Richard Shaw Makes Dr. Spiegel Look Like a Clown (Johnny Depp vs Amber Heard)Dr. Richard Shaw an expert witness for Johnny Depp in the Depp vs Heard case explains why Dr. Spiegel is not a good expert and also how he violated the Goldwater Rule, which was "unethical." #Depp #Heard #DeppvHeard #Johnny Depp #AmberHeardhttps://nicecrew.tv/static/streaming-playlists/hls/6a24f150-1ec0-4ab1-8dc2-b2122291011f/2ebe2cc9-e543-4636-977e-1486b2649af5-master.m3u8https://nicecrew.tv/videos/embed/e7dsyeXmFaUTzFxCL8BMAP1459002024-04-03T00:11:12.215ZJohnny DeppAmber HeardDepp v HeardJohnny Depp v Amber HeardDr. SpiegelYESRadix Verum ☦NOhttps://nicecrew.tv/w/5ZR3hGcQwBsBGAV2RmDfH7https://nicecrew.tv/lazy-static/thumbnails/c0ac76c7-c19f-4dc3-a431-ae8789a9c8b9.jpgTMZ Files Emergency Motion to Intervene in Depp v HeardTMZ has just filed an Emergency Motion to protect the "confidential source" who sold them the kitchen video. Their legal argument is that their "reporting" was in the "public interest." They are citing source protection and first amendment shield. Emergency Motion: https://www.fairfaxcounty.gov/circuit/sites/circuit/files/assets/documents/pdf/high-profile/depp%20v%20heard/cl-2019-2911-emergency-intervene-ehm-prod-5-24-2022.pdf #JohnnyDepp #AmberHeard #TMZ #Tremainehttps://nicecrew.tv/static/streaming-playlists/hls/28782bd1-41c7-4329-9302-dc82c54482b0/a263522d-3087-4bf6-bfaf-10bc5f504e73-master.m3u8https://nicecrew.tv/videos/embed/5ZR3hGcQwBsBGAV2RmDfH7540002024-04-03T00:09:56.880ZJohnny DeppAmber HeardDepp v HeardTMZTremaineYESRadix Verum ☦NOhttps://nicecrew.tv/w/bamBvpcgMoqCx1gHMnT16Ghttps://nicecrew.tv/lazy-static/thumbnails/209ffa98-4a47-44bb-93c7-c98e20033b4e.jpgJennifer Howell: Amber Heard Lied About Donations Under Oath, Whitney Lying to Protect AmberIncredible testimony from Jennifer Howell of Art of Elysium, Whitney's former employer who has testified that Amber Heard lied about donations under oath and that her sister Whitney is lying to protect her! She has been threatened by Ms. Heard, and someone broke into her house. Howell Letter: https://twitter.com/natesaver/status/1528264506857598977 House Break In: https://twitter.com/mimasdiaries/status/1526940970717167616 #DeppHeardTrial #JusticeForJohnnyDepp #AmberHeardlsALiar #JenniferHowellhttps://nicecrew.tv/static/streaming-playlists/hls/5249c882-8bf3-4bd7-a4a9-e5138f9cea72/208be9ed-8d6d-42e3-ab25-7a9cc392ccd1-master.m3u8https://nicecrew.tv/videos/embed/bamBvpcgMoqCx1gHMnT16G711002024-04-03T00:10:07.882ZAmber HeardJohnny DeppWhitneyJennifer HowellElon MuskYESRadix Verum ☦NOhttps://nicecrew.tv/w/11JukCruNuzoWpM1wKVmS3https://nicecrew.tv/lazy-static/thumbnails/381b14d6-cd5b-4f93-adb4-fcfd858e4f9f.jpgKate Moss Testifies "Johnny Did NOT Push Me Down the Stairs!" (Johnny Depp v Amber Heard)Kate Moss testified today that Johnny Depp NEVER pushed her down the stairs as Amber Heard claimed. She said Johnny NEVER hit or kicked her, was never violent with her at all! #KateMoss #JohnnyDepp #AmberHeard #DeppvHeardhttps://nicecrew.tv/static/streaming-playlists/hls/001a2f3d-1963-4180-8cfa-6bafbc8ca25e/8d8dd5cf-8a34-4a67-81bc-bc7fd15ef5bd-master.m3u8https://nicecrew.tv/videos/embed/11JukCruNuzoWpM1wKVmS3214002024-04-03T00:10:00.676ZKate MossJohnny DeppAmber HeardJohnny Depp v Amber HeardDepp v HeardYESRadix Verum ☦NOhttps://nicecrew.tv/w/1A68pnrjEjTAJAt9fx9KaDhttps://nicecrew.tv/lazy-static/thumbnails/77f58c85-bc7d-4944-8dc3-423a16afbd7f.jpgDr. Curry Testifies Dr. Hughes Misrepresented Tests & Helped Amber Heard Fake PTSD, Pt. 1Dr. Sharron Curry testified today to rebut Amber Heard's "expert witness" Dr. Hughes. Dr. Curry testified that Dr. Hughes misrepresented tests, used inappropriate tests and used opinion as fact. Amber also tried to game the tests and there were signs of exaggeration and deception. Dr. Hughes OMITTED items that said Amber Heard LIED about PTSD. #DrCurry #deppvheard #amberheard #justiceforjohnny #justiceforjohnnydepp #DrHugheshttps://nicecrew.tv/static/streaming-playlists/hls/04c272bd-205a-44c7-8136-4291f4b41fab/c24dd9c7-ea3d-4866-858b-40ed1f1523d1-master.m3u8https://nicecrew.tv/videos/embed/1A68pnrjEjTAJAt9fx9KaD2397002024-04-03T00:12:57.441ZSharron CurryDr. Sharron CurryMental HealthForensic PsychologyDr. HughesYESRadix Verum ☦NOhttps://nicecrew.tv/w/d6kbatLpwrabYDVaVnKdWPhttps://nicecrew.tv/lazy-static/thumbnails/14ee573d-97c0-41d4-becc-a210e74f80b7.jpgDr. Curry Testifies Dr. Hughes Misrepresented Tests & Helped Amber Heard Fake PTSD, Pt. 2Dr. Sharron Curry testified today to rebut Amber Heard's "expert witness" Dr. Hughes. Dr. Curry testified that Dr. Hughes misrepresented tests, used inappropriate tests and used opinion as fact. Amber also tried to game the tests and there were signs of exaggeration and deception. Dr. Hughes OMITTED items that said Amber Heard LIED about PTSD. #DrCurry #deppvheard #amberheard #justiceforjohnny #justiceforjohnnydepp #DrHugheshttps://nicecrew.tv/static/streaming-playlists/hls/61ec332e-5c1a-4748-901e-9de9f7187503/e2144a5f-9103-4101-83aa-76b6a4d90dfa-master.m3u8https://nicecrew.tv/videos/embed/d6kbatLpwrabYDVaVnKdWP2080002024-04-03T00:11:38.353ZJohnny DeppAmber HeardJustice for JohnnyJustice for Johnny DeppAmber Heard is a LiarYESRadix Verum ☦NOhttps://nicecrew.tv/w/9PiEPyCKCdGKzSumq84x18https://nicecrew.tv/lazy-static/thumbnails/52056572-604b-4dae-b470-b727841da25d.jpgTMZ Emergency Motion to Intervene DENIED! Tremaine will Testify in Depp v Heard TrialYesterday we covered an Emergency Motion to Intervene filed by TMZ to prevent a former employee Mr. Tremaine from testifying about who provided the video to them of Mr. Depp and possible about who tipped them off to Heard obtaining a TRO. Judge DENIED the Motion today! https://nypost.com/2022/05/25/tmz-seeks-to-block-johnny-depp-from-calling-ex-employee-to-testify/ #TMZ #deppvheard #Defamtion #JohnnyDepp #AmberHeardhttps://nicecrew.tv/static/streaming-playlists/hls/4763f4a0-38b9-4004-988b-3c2a617fe34b/52300be3-f2ed-46a2-9fbf-59f5d3f01121-master.m3u8https://nicecrew.tv/videos/embed/9PiEPyCKCdGKzSumq84x18999002024-04-03T00:10:54.938ZTMZTremaineJohnny DeppAmber HeardDepp v HeardYESRadix Verum ☦NOhttps://nicecrew.tv/w/1RSQ3aTp3vEXVWR4zWmEwzhttps://nicecrew.tv/lazy-static/thumbnails/42caa356-4db1-4c51-95c5-5a8f4da5b1dd.jpgJohnny Depp: Amber Gave Him Black Eye on Honeymoon, Fought Sister WhitneyJohnny testified again today, and he spoke about Amber hitting him on their honeymoon and a photo was presented of him with a black eye. He testified about her abusive relationship with her sister Whitney who he said was her lackey and punching bag. He said Amber threw wine in Whitney's face and fought her physically numerous times. #DeppvHeard #AmberHeard #amberheardisanabuser #justiceforjohnnydepphttps://nicecrew.tv/static/streaming-playlists/hls/06f6c4cc-2e63-4ce1-b90b-e37cdda6b9a5/789e53d6-92f7-44cc-be43-4430e9e209d8-master.m3u8https://nicecrew.tv/videos/embed/1RSQ3aTp3vEXVWR4zWmEwz2686002024-04-03T00:13:15.477ZJohnny DeppAmber HeardDepp v HeardJustice for Johnny DeppAmber Heard Is an AbuserYESRadix Verum ☦NOhttps://nicecrew.tv/w/wne4WrFFxkKZsbfeu9TMjwhttps://nicecrew.tv/lazy-static/thumbnails/dd5b588a-ef0a-445b-b308-8c80741a6b5d.jpgMorgan Tremaine from TMZ Testifies in Depp v Heard TrialMorgan Tremaine a former employee for TMZ testified today about the timeline of TMZ's reporting relating to Amber Heard. He doesn't explicitly name Amber as the source, but it is heavily implied. #TMZ #MorganTremaine #JohnnyDepp #AmberHeardhttps://nicecrew.tv/static/streaming-playlists/hls/f5e8d515-29d5-483d-889e-14ae77536dbe/66ae325f-83d6-404d-be8d-362502142f08-master.m3u8https://nicecrew.tv/videos/embed/wne4WrFFxkKZsbfeu9TMjw1034002024-04-03T00:11:56.443ZTMZMorgan TremaineJohnny DeppAmber HeardDepp v HeardYESRadix Verum ☦NOhttps://nicecrew.tv/w/tizCi4KPA25pDcpB61ewefhttps://nicecrew.tv/lazy-static/thumbnails/f1d6a226-7a61-4b8a-8222-cbee845ae9b6.jpgAmber Heard's Expert Witness Tries to Confuse Jury, Taken Down in Minutes!Julian Ackert, Amber's computer forensics expert witness tried to confuse the jury with word salad and technical jargon only to be totally DESTROYED on cross in just a few minutes. #JohnnyDepp #AmberHeard #justiceforjohnnydepp #amberheardisaliarhttps://nicecrew.tv/static/streaming-playlists/hls/dd1b1c4b-2ccd-40b5-ab02-5260f88252a0/7c9e2563-6e0a-440f-88f9-8e2baa008e12-master.m3u8https://nicecrew.tv/videos/embed/tizCi4KPA25pDcpB61ewef1597002024-04-03T00:11:41.239ZAmber HeardJohnny DeppJohnny Depp v Amber HeardDepp v HeardJulian AckertYESRadix Verum ☦NOhttps://nicecrew.tv/w/f1qTpm88zv9bQLzxBJWQPZhttps://nicecrew.tv/lazy-static/thumbnails/210ff646-835d-4eda-a5dc-1c82c0a85783.jpgDr. Hughes Admits to Changing Testing Criteria to "Diagnose" Amber Heard with PTSD!Amber Heard's team brought back their expert witness Dr. Dawn Hughes who claims to have made a clinical assessment that Amber has PTSD and experienced IPV. Dr. Hughes admitted to changing testing criteria so she could "diagnose" Amber, while Amber sat there smirking. It appears Dr. Hughes might have coached Amber to feign PTSD. It's important to note that Dr. Hughes testified in a case where a woman killed her husband and she defended her. We must consider Dr. Hughes own biases. #DrHughes #amberheard #johnnydepp #deppvheardhttps://nicecrew.tv/static/streaming-playlists/hls/716f4726-dbe7-43da-8f94-59158b467fcf/bbe6511c-7e2a-4012-9a7e-f9688ab82482-master.m3u8https://nicecrew.tv/videos/embed/f1qTpm88zv9bQLzxBJWQPZ2316002024-04-03T00:13:24.369Zdepp v heardamber heardjohnny deppdr. hughesdawn hughesYESRadix Verum ☦NOhttps://nicecrew.tv/w/m76ABReZGCFF7wWAwPMYRzhttps://nicecrew.tv/lazy-static/thumbnails/1db03c6d-dd86-4dba-862f-2c7f8ac58ce1.jpgAmber Heard's Desperate Final Stand, Can She Win?Amber Heard took the stand again, for her counterclaim and began by trying to cry and play the victim. She went right into her overly dramatic histrionics and fake crying. She then goes into anger and combative mode when Camille Vasquez starts to call her out on her lies. She starts arguing and looks like she is about to have a breakdown. #amberheard #johnnydepp #camillevasquezhttps://nicecrew.tv/static/streaming-playlists/hls/a2d0af5c-c853-4cde-98aa-78d175d7cc53/c7cd0e93-e15b-4db4-bafe-abc86ddc9074-master.m3u8https://nicecrew.tv/videos/embed/m76ABReZGCFF7wWAwPMYRz2647002024-04-03T00:12:31.033Zamber heardjohnny deppdepp v heardcamille vasquezamber heard is a liarYESRadix Verum ☦NOhttps://nicecrew.tv/w/iHDj99PQMAe1mqVPMrf3hRhttps://nicecrew.tv/lazy-static/thumbnails/60564db4-d4eb-4224-9d97-92671d6ece82.jpgKevin Spacey Charged with Sexually Assaulting 3 Men in UKKevin Spacey was hit with charges from the UK as he was already in Manhattan Federal Court today in a civil matter. The first person to publicly accuse Mr. Spacey of sexual misconduct was the actor Anthony Rapp, who said in 2017 that Mr. Spacey had made unwanted sexual advances toward him in the 1980s when he was 14 years old. Soon after that, a former television anchor came forward to accuse Mr. Spacey of sexually assaulting her son, and then 20 people who worked with Mr. Spacey at the Old Vic theater in London, where he was artistic director for 11 years, accused him of inappropriate behavior. In 2018, Mr. Spacey was charged with the sexual assault of the television anchor’s 18-year-old son in Nantucket, Mass. Prosecutors dropped the case when the accuser invoked the Fifth Amendment and refused to continue testifying. A massage therapist sued Mr. Spacey in California in 2019, accusing him of groping and trying to kiss him before offering him oral sex during a massage. The accuser died unexpectedly ahead of the trial and the case was dismissed when his estate dropped the lawsuit. Sources: https://twitter.com/vicbekiempis/status/1529811095581507584 https://www.nbcnews.com/news/world/actor-kevin-spacey-charged-sexually-assaulting-three-men-uk-prosecutor-rcna30661?cid=sm_npd_nn_tw_ma https://archive.ph/0YG3X #KevinSpacey #sexualassault #UK #Predatorhttps://nicecrew.tv/static/streaming-playlists/hls/8f7bd8ba-cac1-4d80-814a-3fc4920bda39/07fe3996-ba94-4a02-be62-cb951520e6f2-master.m3u8https://nicecrew.tv/videos/embed/iHDj99PQMAe1mqVPMrf3hR582002024-04-03T00:11:14.958Zkevin spacysexual assaultpedophiliasexual predatorYESRadix Verum ☦NOhttps://nicecrew.tv/w/mgBMkfjU3qZZSZ47A6z6XAhttps://nicecrew.tv/lazy-static/thumbnails/11001844-e97d-4fbc-966b-0140876ae314.jpgPeter Nygard Sexual Assault Case Goes to Trial in July, here is Some Background InfoCanadian fashion mogul Peter Nygard's sexual assault and forcible confinement case in Quebec will return to a Montreal courtroom on July 8. Canadian clothing tycoon billionaire, Peter Nygard, 77, has been accused of luring at least 10 young teenagers to his mansion in the Bahamas under the guise that he would help them with their modelling careers. A lawsuit filed in the Southern District of New York claimed that Nygard plied his subjects with alcohol and drugs before they were violently assaulted, raped, and sodomized. The case could prove embarrassing for Prince Andrew - who once stayed at Nygard's mansion - linking him to another high-profile billionaire accused of sexually abusing young women. Sources: https://www.cbc.ca/news/canada/manitoba/peter-nygard-montreal-court-sexual-assault-allegations-1.6465693 https://www.dailymail.co.uk/news/article-8004655/Millionaire-fashion-exec-Peter-Nygard-accused-raping-10-young-women.html https://twitter.com/trebillion/status/1228390506041757696 #PeterNygard #Trial #Canada #sexualassaulthttps://nicecrew.tv/static/streaming-playlists/hls/a424fb1e-7fb4-42e6-b5d2-bbd7a4c5cc04/62e12a02-c22c-44be-a9b4-0303da99a84c-master.m3u8https://nicecrew.tv/videos/embed/mgBMkfjU3qZZSZ47A6z6XA999002024-04-03T00:11:45.007ZPeter NygardNygard CompaniesNygard InternationalBill GatesJeffrey EpsteinYESRadix Verum ☦NOhttps://nicecrew.tv/w/915vS3VLPgBRDsV8HuMkbvhttps://nicecrew.tv/lazy-static/thumbnails/3669b67d-b089-4052-8504-343e79f1afac.jpgCamille Vasquez & Ben Chew SAVAGE Closing Arguments in Depp v HeardCamille Vasquez and Ben Chew deliver their closing arguments in the Johnny Depp v Amber Heard Defamation trial. They utterly demolish her lies and her despicable false allegations of horrific sexual violence and domestic abuse. Amber Heard has been exposed for the monster she is for all the world to see. #johnnydepp #amberheard #closingarguments #camillevasquez #benchew #deppvheard #depp #Heardhttps://nicecrew.tv/static/streaming-playlists/hls/40cbe444-a62a-422f-96eb-0bada0f679b5/9267603a-5224-4e0f-a323-4cba2622ee52-master.m3u8https://nicecrew.tv/videos/embed/915vS3VLPgBRDsV8HuMkbv4862002024-04-03T00:15:15.782ZAmber HeardJohnny DeppDepp v HeardDepp vs HeardCamille VasquezYESRadix Verum ☦NOhttps://nicecrew.tv/w/mS4EEdZvyubkkM6d7q3Ro7https://nicecrew.tv/lazy-static/thumbnails/d9a72311-c58b-4edb-9400-a3ee044ca16b.jpgDid Feds Groom Both Buffalo & Texas Shooters? Federal Agent Under InvestigationA "retired" federal agent "regularly communicated" with accused Buffalo gunman Payton Gendron in an online chatroom on Discord and authorities are investigating whether he had advanced knowledge of the attack, according to a report from The Buffalo News. There are rumors that both Gendron and Ramos were part of the same discord server and were both being groomed by federal agents. So far, I have been unable to verify this claim. The Texas shooter may have been previously arrested as a minor for plotting a school shooting, though that is also disputed. Regardless we have more questions than answers and someone must ask them. #PaytonGendron #BuffaoShooter #TexasShooter #uvalde #Ramos #FBI #massshooting Sources: https://www.newsweek.com/salvador-ramos-arrested-4-years-ago-planning-attack-when-he-turned-18-1710867?utm_medium=Social&utm_source=Twitter#Echobox=1653660331 https://www.mediaite.com/tv/house-republican-claims-uvalde-school-shooter-was-arrested-four-years-ago-for-threat-to-shoot-up-a-school/ http://www.informationliberation.com/?id=63118 https://boards.4chan.org/pol/thread/379324326 https://archive.ph/J7124 https://www.kens5.com/article/news/crime/two-teens-arrested-in-mass-casualty-plot-in-2018-targeting-a-uvalde-middle-school/273-548565605https://nicecrew.tv/static/streaming-playlists/hls/a8f438a5-f4ef-4ba4-9c6e-85603afaaef6/ba186abb-a96c-4e8b-ab49-b80bf6ef9ee6-master.m3u8https://nicecrew.tv/videos/embed/mS4EEdZvyubkkM6d7q3Ro71809042024-04-03T00:12:35.132ZBuffalo ShooterPayton GendronMass ShootingSalvador RamosUvaldeYESRadix Verum ☦NOhttps://nicecrew.tv/w/u4n4pPXn7eTKrRfCLCeu8Qhttps://nicecrew.tv/lazy-static/thumbnails/21fe6e76-91f8-4ac0-a333-4634ae368000.jpgPsycho Ambers Lies Fall Apart: Camille Vasquez Closing Arguments Rebuttal in Depp v HeardCamille Vasquez in her closing arguments rebuttal pulls apart Amber Heard's atrocious lies. #Depp #Heard #deppvheard #amberheardisaliar #justiceforjohnnydepphttps://nicecrew.tv/static/streaming-playlists/hls/e338177c-5079-41b7-abdf-6b8cefb5f67e/2b3a25b5-af2a-4c23-945a-793be95cc198-master.m3u8https://nicecrew.tv/videos/embed/u4n4pPXn7eTKrRfCLCeu8Q2053002024-04-03T00:14:00.134Zdeppheardjohnny deppamber hearddepp v heardYESRadix Verum ☦NOhttps://nicecrew.tv/w/fr1RzY9uDiQYbSEHiL3nMphttps://nicecrew.tv/lazy-static/thumbnails/b1861d56-0bb0-4bc2-b061-8f52616c5bf4.jpgBlood In, Blood Out: The Mayday MysteryThe mayday mystery is a bizarre mystery that has been going on since the 1980s, possibly longer by a group referring to itself as the "Orphanage," and/or the Order of Unreconstructed Freaks." They also call themselves the freaks, etc. The group purports to be a secret society and they have been placing bizarre and cryptic ads in the Arizona Daily Wildcat since at least 1981. These ads include an opening SR/CL-that still remains a mystery and they commonly featured a "smiley guy" a smiling man with usually 5 or 6 hairs on his head and a leitmotif or a general theme of the ad. There are clear connections to Protestant Christianity, Lenin, Communism, and Revolutionary activity. There are hints of alchemy, esotericism, occultism, etc. The main historical figures that are referenced together in the ads are Oliver Cromwell, Martin Luther, John Calvin, and Gustavus Adolphus. The group refers to their enemies as "Pelagian Devils," a reference to Pelagianism. Sources: http://maydaymystery.org/mayday/index.html https://en.wikipedia.org/wiki/Oliver_Cromwell https://en.wikipedia.org/wiki/Martin_Luther https://en.wikipedia.org/wiki/John_Calvin https://en.wikipedia.org/wiki/Gustavus_Adolphus https://en.wikipedia.org/wiki/Pelagianism #Mayday #MaydayMystery #Luther #Cromwell #Calvin #Adolphus #TheOrphanage #Freaks #protestants #Hungerfordhttps://nicecrew.tv/static/streaming-playlists/hls/74de0ff6-92bc-479a-88a9-19a584b9962d/f43ad532-accb-4940-8d3b-77c06f7ee518-master.m3u8https://nicecrew.tv/videos/embed/fr1RzY9uDiQYbSEHiL3nMp4128002024-04-03T00:15:43.364ZMaydayMayday MysteryMayday MysteriesRobert HungerfordSecret SocietyYESRadix Verum ☦NOhttps://nicecrew.tv/w/pg62GZwanZurUqnq4mWvmmhttps://nicecrew.tv/lazy-static/thumbnails/e8b1e41e-39c7-4e98-9679-fbc6a9d2a590.jpgJuror Speaks Out on TikTok!? Johnny Depp vs Amber Heard TrialA TikTok account purporting to be from a member of the jury in the Johnny Depp vs Amber Heard trial has made a video detailing his thoughts on the trial and offering to answer questions. The individual wishes to remain anonymous and did not go on camera so I am unable to confirm that this is real and not a hoax. However, if it is who I think it is, this would be the juror in the second row all the way to the right who wore a face mask, next to my autistic warrior. Do you all think this is real or fake? Let me know in the comments below. Source: https://www.tiktok.com/@seekinginfinite/video/7104525102439550250 #jury #johnnydepp #amberheard #deppvheard #deppvheardtrial #justiceforjohnnydepp #justiceforjohnny #justice #defamationhttps://nicecrew.tv/static/streaming-playlists/hls/bc5d71fa-3580-4c72-bba8-92ee6c8b32c0/8ca0cbfb-70ce-4db1-a70f-02f09001fce5-master.m3u8https://nicecrew.tv/videos/embed/pg62GZwanZurUqnq4mWvmm1114002024-04-03T00:13:43.534ZJohnny DeppAmber HeardJuryJurorTiktokYESRadix Verum ☦NOhttps://nicecrew.tv/w/r8n3fyWQaisvzSj5mr65Tfhttps://nicecrew.tv/lazy-static/thumbnails/73456839-9481-4905-b5e8-3f672c1fc020.jpgThe Trad Meme & The Waifu DreamI have made a lot of videos in the past being critical of "modern" women and the insane expectations that they have of men. I wanted to make a video exploring the young, often Christian conservative men who display the same out-of-touch with reality expectations of the perfect traditional woman and the perfect Asian waifu. #trad #Waifu #Dating #Standards #Cope #MGTOW #Redpillhttps://nicecrew.tv/static/streaming-playlists/hls/cb7ba375-fd28-4760-8366-43b91b555004/60987fec-4cff-4d68-9915-f926e95e2b2d-master.m3u8https://nicecrew.tv/videos/embed/r8n3fyWQaisvzSj5mr65Tf915012024-04-03T00:13:04.335ZTradTrad womanTraditional WomanWaifuPerfect GirlYESRadix Verum ☦NOhttps://nicecrew.tv/w/pN9Q6hwvuHZ3j32DGAyo5hhttps://nicecrew.tv/lazy-static/thumbnails/50cdfc96-21a5-49cf-9055-7e2c2d768599.jpgMarilyn Manson vs Evan Rachel Wood: Defamation Lawsuit Deep DiveI wanted to provide an overview of the allegations made by Brian Warner aka Marilyn Manson against his ex-girlfriend actress Evan Rachel Wood and her associate Ashley "Illma" Gore. The Defamation lawsuit was filed in March of 2022 and contains some interesting information. He and his attorneys provided attached exhibits that appear to show a coordinated effort by Wood, et al. I am just started to investigate this saga so if you are interested, I will provide more updates as I go. Source: https://drive.google.com/file/d/1LloIWMJrefKSGZ_pfErcaOggmVIYckrd/view https://twitter.com/marilynmanson/status/1499159180401209346 #marilynmanson #evanrachelwood #defamation #falseallegationshttps://nicecrew.tv/static/streaming-playlists/hls/c0b3d800-bc2d-4eee-a9e5-45f041864bf0/eb660e7c-c32e-4f97-b031-77b8ef089dc5-master.m3u8https://nicecrew.tv/videos/embed/pN9Q6hwvuHZ3j32DGAyo5h2652002024-04-03T00:14:33.885ZBrian WarnerMarilyn MansonEvan Rachel WoodAshley GoreIllma GoreYESRadix Verum ☦NOhttps://nicecrew.tv/w/iwNKkvtLQ1U5iSFMV5ZztEhttps://nicecrew.tv/lazy-static/thumbnails/481b2ca7-6f1b-4177-b9ed-e017d079cf1a.jpgIron Rules of Tomassi: A Female PerspectiveI am currently reading a book called The Rational Male by Rollo Tomassi. I will be doing a review of the book, but I wanted to do a quick video with my thoughts on the Iron Rules because I think they are pretty spot on. Sources: https://medium.com/@redpillnorman/the-iron-rules-of-tomassi-3e01b8c31d64 https://therationalmale.com/ https://youtube.com/c/RolloTomassi #IronRules #RolloTomassi #RationalMale #masculinityhttps://nicecrew.tv/static/streaming-playlists/hls/8df87ab2-e37c-42c1-b872-c14418bca7f0/bd48ac41-512d-4de0-9877-cff009afdb25-master.m3u8https://nicecrew.tv/videos/embed/iwNKkvtLQ1U5iSFMV5ZztE1277002024-04-03T00:13:37.219ZRollo TomassiThe Rational MaleFemale PsychologyDatingModern DatingYESRadix Verum ☦NOhttps://nicecrew.tv/w/nQ9GXddQ3hoGbpiGPXkWHXhttps://nicecrew.tv/lazy-static/thumbnails/94fc463a-fb9f-4e57-a7ea-2084b9ce5c87.jpgTomi Lahren's Feminist Rant: "Men Are Trash!"A while back I did a livestream where I gave my thoughts on Tomi Lahren's awful "men are trash" rant but that has since become lost in the internet ether. So I wanted to make a video here where I offer my perspective on this. I think that Tomi Lahren hit the epiphany stage and she's upset that high status, top 10% men are not interested in her. She seems to think that being "ambitious" and "successful" and having money are wanted successful and wealthy men should find "valuable." The question is why? Those men don't need your ambition or money, so Tomi what else do you and your friends have to offer? What else do you bring to the table? No man wants to be lectured by a condescending shrill female. Sources: https://youtu.be/M6QQm6VtOAA https://youtu.be/NpIgalhrKQ4 https://people.com/tv/tomi-lahren-calls-off-engagement-fiance-brandon-fricke/ https://www.distractify.com/p/tomi-lahren-breakup #tomilahren #menaretrash #mgtow #redpill #entitledwomenhttps://nicecrew.tv/static/streaming-playlists/hls/b0c8fa66-5ccf-4329-b90e-a74943793e61/696a7234-a4b9-4d8f-9024-523a289c18d6-master.m3u8https://nicecrew.tv/videos/embed/nQ9GXddQ3hoGbpiGPXkWHX3931022024-04-03T00:16:12.359ZTomi LahrenMen are trashfeministman haterentitledYESRadix Verum ☦NOhttps://nicecrew.tv/w/mDcj3saL8q7XfcGVTXr9h2https://nicecrew.tv/lazy-static/thumbnails/678ea7dd-3c1a-4c0d-b60a-e32d715a65ff.jpgLookism, PUA, & Game: A Response to @Wheat WafflesI recently watched a fascinating video by Wheat Waffles regarding lookism and differences in what he called "sub5, normie, and chad" men. He makes a very good point about how women will treat unattractive men vs how they will treat chads. The video is called "40 differences in treatment between a sub5, normie, & chad". Link to video: https://youtu.be/jQOhRx3fDJ8 Wheat Waffles Channel: https://www.youtube.com/c/WheatWaffles #redpill #mgtow #wheatwaffles #lookism #PUA #gamehttps://nicecrew.tv/static/streaming-playlists/hls/a728436d-4be3-40cc-b5b0-2b6f862f6a39/8adb8aa9-235e-4bde-b077-e056579366db-master.m3u8https://nicecrew.tv/videos/embed/mDcj3saL8q7XfcGVTXr9h22292022024-04-03T00:14:23.743ZWheat WafflesPUAGameLookismResponse VideoYESRadix Verum ☦NOhttps://nicecrew.tv/w/dG1cWvFBSYvepavM1uN1Rthttps://nicecrew.tv/lazy-static/thumbnails/ffd86ccb-6876-45d4-904c-18f13575fdd5.jpgNick Rekieta EPIC "To the Women" Rant & How to Please a ManNick Rekieta of Rekieta Law went off on the ladies in a rant called "To the Women" that was absolutely golden. He tells the ladies all they need to know to keep a man happy. Is it really asking that much to be happy to see your man when he comes home from work? It doesn't take that much to please a man, but modern women are nasty, vile, and crazy. Just be sweet, pleasant, and nice to be around. Show your man that you are devoted to him and that you cherish him. It's not hard! #rekietalaw #dating #datingadviceforwomen #ranthttps://nicecrew.tv/static/streaming-playlists/hls/66c38aa5-56a4-4f6e-9ef0-5eb1a69b70e5/79dcc0a3-eef8-40f5-a0bc-dfe068f45067-master.m3u8https://nicecrew.tv/videos/embed/dG1cWvFBSYvepavM1uN1Rt732002024-04-03T00:14:07.294ZNick RekietaRekieta LawDating advicedatingdating advice for womenYESRadix Verum ☦NOhttps://nicecrew.tv/w/wQBRuzioE6LjmpEz4U9NBxhttps://nicecrew.tv/lazy-static/thumbnails/a4dca302-8e72-4d82-b88a-7cb7ed7fca52.jpgAmouranth's Terrifying Twitch Stalker & Creepy Beta MalesI wanted to talk about a very serious issue that appears to be escalating rapidly and that is the problem of stalkers. Many female streamers have had to deal with insane and entitled stalkers and law enforcement seemingly does very little to intervene. The Amouranth stalker situation is scary, with a man selling all his possessions - including his home, vehicle, and cat to travel to the US to stalk her outside of her P.O. Box. He streamed himself doing this on Twitch. It's an incredibly disturbing and frightening situation. Women should be allowed to live stream without having to worry about being stalked and assaulted. He later cased her house WHILE LIVESTREAMING and attempted to break-in. Law enforcement expressed very little interest in doing anything and it took them over 30 minutes to get there after she called reporting his attempts to gain entry. Had she been alone in the house, and he got in, who knows what would have happened. Why does this inappropriate and disturbing behavior seem to be a common thing with beta males, simps, and orbiters? Sources: https://twitter.com/wildkait/status/1537115655685779457 https://twitter.com/Dexerto/status/1537124381993881601 https://www.tiktok.com/@jacklynnwoodz69/video/7103327821170363690?is_from_webapp=1&sender_device=pc&web_id=7094223508603913774 #amouranth #twitch #stalkers #amouranthstalker #stalkinghttps://nicecrew.tv/static/streaming-playlists/hls/f9bbf4c6-85d6-400c-8999-2fe6911bb225/2d4dbc97-52d1-419f-9357-bbdd5598610c-master.m3u8https://nicecrew.tv/videos/embed/wQBRuzioE6LjmpEz4U9NBx1316042024-04-03T00:13:49.849ZAmouranthTwitchTiktokstalkersstalkingYESRadix Verum ☦NOhttps://nicecrew.tv/w/sNerteajNw98BBMjavKo6Ehttps://nicecrew.tv/lazy-static/thumbnails/b3c57d7d-7b6e-44e4-be50-f2de94698a87.jpgEzra Miller Grooming Scandals & Insane BehaviorAnother 12-year-old child and their mother have come forward with allegations against Ezra Miller and have been granted an order of protection against the star of D.C.'s The Flash. Ezra Miller has a history of violent assault, erratic behavior, and previous allegations of grooming a Native American environmental activist Tokata Iron Eyes, according to her parents. Ezra is missing and has deleted its Instagram account. Sources: https://www.thedailybeast.com/12-year-old-granted-order-of-protection-against-ezra-miller?via=twitter_page https://www.msn.com/en-us/movies/news/the-ezra-miller-accusations-explained/ar-AAYwINk?ocid=uxbndlbing https://www.yourtango.com/news/ezra-miller-ok-timeline-allegations-arrests-controversies https://lastrealindians.com/news/2022/6/10/chief-bear-testifies-ezra-miller-groomed-my-niece #ezramiller #dccomics #theflash #groominghttps://nicecrew.tv/static/streaming-playlists/hls/d90219c9-e0de-480b-babe-8d7b49da5a88/0325bc38-1d41-4d8d-a339-8b260653411a-master.m3u8https://nicecrew.tv/videos/embed/sNerteajNw98BBMjavKo6E1250032024-04-03T00:14:41.445ZEzra MillerDC ComicsThe FlashGroomingWarner BrothersYESRadix Verum ☦NOhttps://nicecrew.tv/w/15RQuPLBwqSDBHh3snYugehttps://nicecrew.tv/lazy-static/thumbnails/4d2fda5f-fa0b-4620-82cb-01e65d242ed5.jpg17 Questions About the FBI Murder of Eric AllportEric Allport was shot and killed by the FBI in the parking lot of a Madison Heights steakhouse in Michigan back in October of 2020. The FBI has imposed secrecy over the shooting and refused to provide details or release the autopsy or internal review into the shooting. It took the Detroit News more than a year to obtain the autopsy and the details of that leave us with even more questions. This appears to have been an execution and then a cover-up. We demand answers and transparency. Sources: https://radixverum.substack.com/p/fbi-must-release-review-into-the?sd=pf https://patriotssoapbox.com/politics/man-tied-to-whitmer-kidnapping-probe-was-executed-by-the-fbi/ #FBI #ExcessiveForce #Shootout #TrueCrimehttps://nicecrew.tv/static/streaming-playlists/hls/00adb00d-335c-4598-a7a0-6575282bc033/875baec2-fd8a-49bc-8a0b-1fa2be9d2453-master.m3u8https://nicecrew.tv/videos/embed/15RQuPLBwqSDBHh3snYuge966012024-04-03T00:14:38.577ZFBIShoot outShootingEric AllportEric Mark-Matthew AllportYESRadix Verum ☦NOhttps://nicecrew.tv/w/42cCory3g3Dy4j9nRiW54dhttps://nicecrew.tv/lazy-static/thumbnails/710d728d-a4da-4893-9e33-287f1255bbed.jpgOne Man vs. The CIA: The Biggest Trial Happening Now You Haven't Heard Of! Vault 7 & Joshua SchulteJoshua Adam Schulte is now representing himself against the federal government, the Department of Justice, and the Central Intelligence Agency (CIA) at his "re-trial" in New York City. Mr. Schulte is accused of leaking the biggest leak of classified documents in the history of the CIA to Wikileaks. Mr. Schulte has maintained his innocence. He was already tried for this back in early 2020 - which resulted in a mistrail on all but 2 counts. One juror said after the trial "I just don't think he did it. Let the brother go," and there has been an almost total media blackout on this case. Sources: https://wikileaks.org/ciav7p1/ https://wikileaks.org/vault7/ https://patriotssoapbox.com/opinion/total-media-blackout-two-court-cases-with-major-implications-for-national-security-and-press-freedoms-being-ignored/ https://patriotssoapbox.com/editors-picks/chaos-in-the-court-strange-happenings-in-the-us-vs-joshua-schulte-cia-vault-7-leak-trial/ https://patriotssoapbox.com/opinion/c-i-a-vault-7-leaks-trial-ends-in-hung-jury-but-what-of-julian-assange/ https://matthewrussellleeicp.substack.com/p/in-cia-leak-trial-of-schulte-jurors https://matthewrussellleeicp.substack.com/p/in-cia-leak-trial-of-schulte-fbi https://matthewrussellleeicp.substack.com/p/in-vault-7-leak-trial-schulte-crosses https://matthewrussellleeicp.substack.com/p/in-vault-7-leak-trial-schulte-cites https://matthewrussellleeicp.substack.com/p/in-vault-7-leak-trial-schulte-crossing https://matthewrussellleeicp.substack.com/p/in-vault-7-leak-trial-schulte-crossing-ef0 https://twitter.com/innercitypress/status/1540342596207362048 Support my work!: https://Paypal.me/RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/dvr/62adfcc12b5235b8d598b7f4 Thanks for watching my content friends! #CIA #Vault7 #Wikileaks #...https://nicecrew.tv/static/streaming-playlists/hls/1876534b-2658-456d-aee9-6286545e3aaa/181d1a01-b23a-4845-8d28-0e739cc76be5-master.m3u8https://nicecrew.tv/videos/embed/42cCory3g3Dy4j9nRiW54d6072002024-04-03T00:21:16.190ZJoshua Adam SchulteJosh SchulteJoshua SchulteCIADOJYESRadix Verum ☦NOhttps://nicecrew.tv/w/oYnGyqidRb8p4ig16gcAbMhttps://nicecrew.tv/lazy-static/thumbnails/e11fd235-264f-470c-982b-4beeb3d7dbf7.jpgThe Red King (a poem)This is my latest poem, in video format for your viewing pleasure! Link to poem: https://radixverum.substack.com/p/the-red-king Music credit: "Alexander Nakarada - Battle Of The Creek" is under a Creative Commons (CC-BY 3.0) license https://www.youtube.com/c/SerpentSoundStudios Music promoted by BreakingCopyright: https://youtu.be/IbKAiUlhFSs Support my work!: https://Paypal.me/RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/dvr/62adfcc12b5235b8d598b7f4 Thanks for watching my content friends! #Poetry #Poems #RedKing #Wonderlandhttps://nicecrew.tv/static/streaming-playlists/hls/ba081305-913f-47c8-bf87-8db250326181/7f9bd00c-1e39-4ca1-9950-cf202f9d0a54-master.m3u8https://nicecrew.tv/videos/embed/oYnGyqidRb8p4ig16gcAbM161012024-04-03T00:13:53.741ZPoetryPoemsRed KingAlchemyWonderlandYESRadix Verum ☦NOhttps://nicecrew.tv/w/96edA8ikAbzfo5Gn8uDMCZhttps://nicecrew.tv/lazy-static/thumbnails/8307a870-b8ac-41e5-b36d-d78f65b30f0e.jpgGeorgia Guidestones & Revelation of the MethodI wanted to discuss the slow revealing of Mystery Babylon as part of what H.G. Wells discussed in "The Open Conspiracy," and as Alice Bailey called for in "The Externalization of the Hierarchy." This is the slow initiation of society into occultism. Sources: https://twitter.com/kr3at/status/1544737017803800576 https://archive.org/details/TheExternalizationOfTheHierarchyBailey/mode/2up https://twitter.com/Fibonacci222/status/1032283527054872578 https://twitter.com/pinkcody4/status/1522661239876431873 Support my work!: https://Paypal.me/RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/dvr/62adfcc12b5235b8d598b7f4 Thanks for watching my content friends! #alicebailey #theosophy #blavatsky #newage #georgiaguidestoneshttps://nicecrew.tv/static/streaming-playlists/hls/4183f932-1b63-4b1b-986f-fd9f74b7ebdd/aa409f7e-7c38-4a84-8324-0982ebe975ec-master.m3u8https://nicecrew.tv/videos/embed/96edA8ikAbzfo5Gn8uDMCZ1282032024-04-03T00:15:30.914ZGeorgia GuidestonesOccultismRevelation of the MethodMystery BabylonMystery ReligionYESRadix Verum ☦NOhttps://nicecrew.tv/w/4nkXJy8e8JQ2sGHUa7EDb8https://nicecrew.tv/lazy-static/thumbnails/5034cda8-31e2-4fa0-b048-f95481686800.jpgSteve Jobs & The Reality Distortion FieldI wanted to briefly discuss Steve Jobs "reality distortion field," that made him such an innovative and successful businessman but also in the end probably cost him his life. This comes from the book "Steve Jobs" by Walter Isaacson. #stevejobs #apple #willtopower #realitydistortionhttps://nicecrew.tv/static/streaming-playlists/hls/1b465625-5a7b-4755-8d16-2af06fde7eef/9f2f9035-5d30-4de8-b7dd-f48bdfaf798a-master.m3u8https://nicecrew.tv/videos/embed/4nkXJy8e8JQ2sGHUa7EDb8768002024-04-03T00:17:55.300ZSteve JobsAppleReality Distortion FieldRDFWill to PowerYESRadix Verum ☦NOhttps://nicecrew.tv/w/2pirUUce9HZKnAXhj3oQ5Ehttps://nicecrew.tv/lazy-static/thumbnails/70a03647-3fd5-4554-b0ac-ad3bb37cdb74.jpgComing Collapse: 10 Signs of Recession & How You Can Prepare!It is that time again to discuss the current economic trends, what that means for you and your family, and how you can prepare for what is coming. Longtime readers will be familiar with my style, I am usually 1-2 years ahead when it comes to making these kinds of forecasts so keep that in mind. I made some economic predictions back in December of 2020 that I assumed would be happening in 2021 but it appears I was one year ahead and that they are happening now. As I see it, we are rapidly approaching a recession. A recent survey by Fortune showed that 75 percent of Fortune 500 CEOs believe a recession is on the horizon. Jamie Dimon, the CEO of JP Morgan Chase, has been sounding the alarm about the economy. Could this be the "bubble of all bubbles,"? Michael Burry, Ray Dalio and others have warned that this might be the worst collapse yet. Source: https://radixverum.substack.com/p/warning-biggest-crash-is-coming-and Support my work!: https://Paypal.me/RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/dvr/62adfcc12b5235b8d598b7f4 Thanks for watching my content friends! #Recession #Economy #stockmarket #collapsehttps://nicecrew.tv/static/streaming-playlists/hls/0b59ff50-36d4-4034-8d7a-05dc9671441e/3c4e7af5-1cd3-45cb-a84b-1a621ad5dac5-master.m3u8https://nicecrew.tv/videos/embed/2pirUUce9HZKnAXhj3oQ5E2388002024-04-03T00:19:30.253ZEconomyRecessionEconomic CollapseStock Market CrashLayoffsYESRadix Verum ☦NOhttps://nicecrew.tv/w/5jmQT1Hs1fbCBWmpECwadthttps://nicecrew.tv/lazy-static/thumbnails/dcd9b996-7f31-41df-939e-1aa5e57162b9.jpgBREAKING: In #CIA #Vault7 Re-Trial, Joshua Adam Schulte Declared GUILTY on all Counts!In the case of USA vs. Joshua Adam Schulte, accused of leaking the CIA's entire cyber hacking arsenal to Wikileaks in 2017 - Mr. Schulte has been declared GUILTY on all 9 counts. This comes after the first trial ended in a mistrial. The CIA has been in control since day 1, and this was a show trial. #Vault7 #CIA #JoshuaSchulte #BrutalKangaroo #Wannacryhttps://nicecrew.tv/static/streaming-playlists/hls/22f4c98c-936b-4ece-8d96-593dccddfb87/dde341b0-3a4c-45ed-afdf-8411e523b558-master.m3u8https://nicecrew.tv/videos/embed/5jmQT1Hs1fbCBWmpECwadt61012024-04-03T00:14:43.484ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/4DZKNxpqEUTgKEGRSieYznhttps://nicecrew.tv/lazy-static/thumbnails/06a9a4a7-e8d4-4dfd-a074-13acba0adfd9.jpgUPDATE in USA vs Joshua Schulte CIA Vault 7 Leak Trial!Mr. Joshua Adam Schulte has been found guilty by a jury of violating the espionage act. BREAKING: Alleged WikiLeaks #Vault7 whistleblower Joshua Schulte found guilty on all counts. In response to the embarrassing #Vault7 publication, Trump CIA director Mike Pompeo instructed the CIA to work out how to assassinate Julian Assange #SchulteTrial https://twitter.com/wikileaks/status/1547313205080457220 Support my work!: https://Paypal.me/RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/dvr/62adfcc12b5235b8d598b7f4 Thanks for watching my content friends! #CIA #Devlan #Schulte #Confluancehttps://nicecrew.tv/static/streaming-playlists/hls/1d998744-45de-4293-b38a-36575dc10107/007fa424-b36b-4644-bad9-e82cf6a8281e-master.m3u8https://nicecrew.tv/videos/embed/4DZKNxpqEUTgKEGRSieYzn1189002024-04-03T00:16:18.552ZCIAWikileaksJosh SchulteJoshua Adam SchulteVault 7YESRadix Verum ☦NOhttps://nicecrew.tv/w/fGnWB4pAPRv9TcPZ3da9Mwhttps://nicecrew.tv/lazy-static/thumbnails/176cd7b6-234b-4e8b-a89f-2ac989801982.jpgInflation Hits 9.1%, Will We See the Biggest Crash of Our Generation?The U.S. Economic outlook continues to look dire as we hit record levels of inflation, spurring the risk of a major recession. Food banks are reporting a major increase in demand as lines are going around the building and people are showing up on foot due to the cost of gas. There has been a 79% increase in demand at food banks from just last year with many people lining up at the food bank for the first time ever. This is a major indicator that the rise in gas, electric, and food is impacting normally financially secure households. Michael Burry has said that we haven't seen the bottom yet and that things might get much worse. JPMorgan Profit Drops 28% as Bank Signals Concern on Economy. We also have a nationwide housing crisis. China is also facing a major economic crisis that will continue to negatively affect the US. The wealth divide continues to grow. Sources: https://gab.com/disclosetv/posts/108645951112901947 https://twitter.com/NorthmanTrader/status/1547573475161755651 https://twitter.com/charliebilello/status/1547218698146119680 https://www.marketwatch.com/story/u-s-wholesale-prices-surge-again-and-signal-inflation-is-still-running-hot-11657802432 https://archive.ph/k9viC https://twitter.com/NYCComptroller/status/1546867826379685892 https://apnews.com/article/hungerfoodbanksinflation-4fd5d6fb5879eaecc3000fe2b73df006?taid=62d02750a14d530001c56d6c&utm_campaign=TrueAnthem&utm_medium=AP&utm_source=Twitter https://www.cnbc.com/2022/07/14/copper-prices-are-signaling-investors-are-negative-on-the-economy-anz.html https://www.scmp.com/economy/china-economy/article/3185326/china-facing-more-economic-woes-ahead-gdp-release-mortgage https://archive.ph/Wsrns https://web.archive.org/web/20220714144356/https://www.businessinsider.com/top-economist-us-economy-recession-federal-reserve-interest-rates-inflation-2022-7 https://www.thegatewaypundit.com/2022/07/biden-economy/ https://twitter.com/Breaking911/status/1547268792501288961 https://twitter.com/byHeatherLong/st...https://nicecrew.tv/static/streaming-playlists/hls/770336c4-f297-4176-b3a9-7db5dc66e998/92e00d54-c5c6-46e1-9f93-8ac38484ad96-master.m3u8https://nicecrew.tv/videos/embed/fGnWB4pAPRv9TcPZ3da9Mw3183002024-04-03T00:18:33.932ZInflationRecessionFinancial CollapseFederal ReserveMortage CrisisYESRadix Verum ☦NOhttps://nicecrew.tv/w/8Qu4m9ENockwGC8YBafY2fhttps://nicecrew.tv/lazy-static/thumbnails/d39f9278-9cbd-4d72-a23d-13a0a9efb6ce.jpgIs China on the Verge of Collapse?China’s economy is collapsing as we speak. The Chinese Communist Party has instituted a policy called “Zero Covid.” With China having a population of about 1.4 billion people, this is obviously not attainable. China has forced harsh lockdowns that brought the busiest cities in the world’s second-largest economy to a standstill, leading to major problems. It has damaged businesses and industrial supply chains that affect not just China but the entire world thanks to our globalized, inter-connected modern society. According to the National Bureau of Statistics, this has caused China’s economic growth to fall short of expectations in the second quarter of 2022. It is the lowest growth rate since China’s economy shrank by 6.8 percent in the first quarter of 2020. Under its zero-COVID policy, the Chinese government has shut down Shanghai, China’s biggest business and industrial hub with over 25 million people for over two months to bring down the spread of the so-called Omicron variant. The city is yet to achieve complete normality. Likewise, Beijing and several other cities also clamped prolonged restrictions on travel and business operations prompting analysts to scale down expectations of quick economic recovery for China as the government continues to persist with a strict zero-COVID policy to deal with periodic outbreaks of the virus. The once booming economy was also hit hard by a deep slump in the property market and weighed down by the weakening outlook for the global economy. The property market was severely impacted by investor sentiment after China’s biggest real estate developer Evergrande Group sparked off a major crisis last year by defaulting payment of installments of its whopping USD 309 billion debt. China is in a massive property bubble with impossible levels of debt. This is a big deal; it affects the entire world. Evergrande is China’s Lehman Brothers. It’s not just Evergrande, the Chinese property market is the largest asset class in the world ...https://nicecrew.tv/static/streaming-playlists/hls/3f74f677-7821-42ce-8cfb-95eadcaad448/ba7bf7ac-2615-4911-a1bd-1296a43434d4-master.m3u8https://nicecrew.tv/videos/embed/8Qu4m9ENockwGC8YBafY2f431012024-04-03T00:15:51.060Zyoutubechinaevergrandeshanghaibank runsYESRadix Verum ☦NOhttps://nicecrew.tv/w/qNqpv85acJ1bdYsKNGX2xnhttps://nicecrew.tv/lazy-static/thumbnails/5f228a9e-44e3-48a0-9bc8-a5d8c35a39d0.jpgThe Reddit Experiment: A Tale of Female Privilege & MoreToday we look at two tales of female privilege and another attack on children. A man decided to apply for jobs using a male and female name and he discovered the female applicant was 650% more likely to get a call back for an interview and the female was 870% more likely to get a job interview. https://www.reddit.com/r/TrueOffMyChest/comments/jvuzgu/i_sent_100_applications_as_a_man_and_a_woman_its/?utm_source=share&utm_medium=web2x&context=3 https://www.reddit.com/r/TrueOffMyChest/comments/l47d7y/tinder_exposes_the_dark_truth_of_women_and_dating/?utm_source=share&utm_medium=web2x&context=3 https://twitter.com/thehoffather/status/1548843678545850368 Support my work!: https://Paypal.me/RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/dvr/62adfcc12b5235b8d598b7f4 Thanks for watching my content friends! #reddit #female #privilege #redpill #dating #hookupculture #tinder #datingapps #datingadvice #gender #seattle #hypergamyhttps://nicecrew.tv/static/streaming-playlists/hls/c8d694dd-7182-4840-b976-117fabdf55d7/a5fa9517-677a-464d-abf6-03d1e399ac9d-master.m3u8https://nicecrew.tv/videos/embed/qNqpv85acJ1bdYsKNGX2xn1031002024-04-03T00:16:33.474Zredditfemalefemale privilegeprivilegewhite male privilegeYESRadix Verum ☦NOhttps://nicecrew.tv/w/36b7YsRFmtVUF945s9fkk4https://nicecrew.tv/lazy-static/thumbnails/ada111c7-fb0d-454f-9076-3d7dde5263e7.jpgATF Now Going Door to Door Without A WarrantAgents of the ATF and a Delaware State cop showed up to a Delaware man's house, armed, without a warrant demanding to see his firearms because of a recent purchase he made of two (2) guns. The man has not committed any crime, nor is he accused of a crime. It appears to be part of a scheme to create a federal gun registry for tracking and data collection. SHALL NOT BE INFRINGED. Support my work!: https://Paypal.me/RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/dvr/62adfcc12b5235b8d598b7f4 Thanks for watching my content friends! #ATF #Warrantless #GunRegistry #Firearms #Corruptionhttps://nicecrew.tv/static/streaming-playlists/hls/10eb3ba4-e806-4b6b-97f1-9c6dafe5c56d/93ba0b6f-04dd-41bf-bae5-292b0e46092a-master.m3u8https://nicecrew.tv/videos/embed/36b7YsRFmtVUF945s9fkk4619002024-04-03T00:16:14.776ZATFWarrantless SearchFirearmsFederal firearms registrycorruptionYESRadix Verum ☦NOhttps://nicecrew.tv/w/tv3mpZNyh6qrzJTk47Qg6Mhttps://nicecrew.tv/lazy-static/thumbnails/ed702f70-3820-4baf-9bb7-5574982641ea.jpgPolitical GnosticismI wanted to cover a fascinating topic of political Gnosticism being the main underlying foundation of modern society. Sources: https://arktos.com/2018/10/24/modern-statism-as-western-gnosticism-part-1/ https://arktos.com/2018/10/25/modern-statism-as-western-gnosticism-part-2/ https://postliberalorder.substack.com/p/russia-america-and-the-danger-of https://arktos.com/2022/07/15/liberalism-is-gnosticism-a-response-to-keith-woods/ Support my work!: https://Paypal.me/RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/dvr/62adfcc12b5235b8d598b7f4 Thanks for watching my content friends! #modernity #gnosticism #polticshttps://nicecrew.tv/static/streaming-playlists/hls/deb4c339-90cd-48bd-a774-ac22cce4636b/9747b15a-8a9c-41e4-8b0b-74c8b6c09d38-master.m3u8https://nicecrew.tv/videos/embed/tv3mpZNyh6qrzJTk47Qg6M50830212024-04-03T00:25:38.470Zpolitical gnosticismleftismmodernitymarxismcommunismYESRadix Verum ☦NOhttps://nicecrew.tv/w/9Sf8sFMh7c2mvFHRr6twpahttps://nicecrew.tv/lazy-static/thumbnails/fef492b3-8dcb-46ea-b4e6-b627b3f0cc98.jpgLeftists Celebrate Tragic Suicides of January 6 DefendantsAt least three (3) January 6 defendants have committed suicide as a result of the horrific and abusive treatment they have been subjected to. The left has completely dehumanized their political opposition to the point that they are celebrating this loss of life. These men were human beings, they were children, fathers, brothers, uncles, loved ones, and friends. They had families. Their lives mattered. Sources: https://radixverum.substack.com/p/the-tragic-story-of-matthew-perna https://www.dailymail.co.uk/news/article-9142839/PICTURED-Banker-53-shot-chest-arrest-Capitol-riot.html https://www.pennlive.com/nation-world/2022/07/pa-man-awaiting-sentencing-for-entering-the-us-capitol-during-the-jan-6-riot-has-died.html https://gab.com/DiggingDeeper/posts/108697908154507532 Support my work!: https://Paypal.me/RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/dvr/62adfcc12b5235b8d598b7f4 Thanks for watching my content friends! #MatthewPerna #MarkAungst #ChristopherGeorgia #J6https://nicecrew.tv/static/streaming-playlists/hls/47cd013e-0949-4943-94e3-9189f3bd715f/4f7fe162-71b9-40c1-94fe-cef49ff2e6db-master.m3u8https://nicecrew.tv/videos/embed/9Sf8sFMh7c2mvFHRr6twpa24675202024-04-03T00:18:04.274ZJanuary 6Matthew PernaMark AungstChristopher Stanton GeorgiaUS CapitolYESRadix Verum ☦NOhttps://nicecrew.tv/w/gZtmzNgskkoJe8WT7v4ehEhttps://nicecrew.tv/lazy-static/thumbnails/18e26218-cd01-46e3-b023-86638a98984d.jpgHypernormalisation: Everything is Fake & BrokenI wanted to discuss the concept of hypernormalisation and how it has come to be through techniques like perception management and the creation of permanent destabilization in order to control the masses. It has been a brilliant tool of political and economic control. We look at this through the lens of the Adam Curtis 2016 documentary of the same name. Sources: https://www.trebuchet-magazine.com/hyper-normalisation-modern-propaganda/ https://medium.com/thrice-removed/hypernormalisation-242567ba451f https://www.bournbrookmag.com/home/hypernormalisation https://www.theamericanconservative.com/our-american-pravda/ Support my work!: https://Paypal.me/RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/dvr/62adfcc12b5235b8d598b7f4 Thanks for watching my content friends! #Hypernormalisation #Perception #Destabilization #AdamCurtishttps://nicecrew.tv/static/streaming-playlists/hls/817f5534-5c0c-4828-9270-323196161062/206a16ff-6eea-4814-ad8b-36bbe5da9f0d-master.m3u8https://nicecrew.tv/videos/embed/gZtmzNgskkoJe8WT7v4ehE3754012024-04-03T00:22:54.437Zadam curtisdocumentaryhypernormalisationperception managementpermanent destabilizationYESRadix Verum ☦NOhttps://nicecrew.tv/w/wm2XDR2hdr8txSrhDqHhsYhttps://nicecrew.tv/lazy-static/thumbnails/ea2fbc54-5270-4d28-aa26-d428f0210861.jpgHypernormalisation SummarizedHere is a quick summary of Hypernormalisation and some of the key concepts discussed in the documentary by Adam Curtis. Support my work!: https://Paypal.me/RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/dvr/62adfcc12b5235b8d598b7f4 Thanks for watching my content friends! #AdamCurtis #Hypernormalisation #ControlledOpposition #PerceptionManagement #ManagedOutcomes #ConstructiveAmbiguity #HenryKissinger #Putin #Russia #Sarkovhttps://nicecrew.tv/static/streaming-playlists/hls/f5be3e28-2b43-4a04-888f-eb53a1c118e4/544bce99-ad63-4492-aa30-5aa55b4978e7-master.m3u8https://nicecrew.tv/videos/embed/wm2XDR2hdr8txSrhDqHhsY590002024-04-03T00:16:25.328ZAdam Curtisdocumentaryvladirmir PutinPutinBoris YeltsinYESRadix Verum ☦NOhttps://nicecrew.tv/w/rzhKb5LBpdRRrpbfDFbvnQhttps://nicecrew.tv/lazy-static/thumbnails/b08a809d-5a62-448f-8951-680a6417b919.jpgCredit Suisse ImplosionCredit Suisse has been rocked by major scandals in recent years, including Spygate, Archegos, Swiss Leaks, Greensill & more. They have lost many of their top talent, gone through a slew of CEOs, and now they are having to lay off employees as they face several quarters of unprofitability. Just today it was announced their CEO Thomas Gottstein is stepping down according to the Wall Street Journal. Sources: https://www.theguardian.com/news/2022/feb/20/suisse-secrets-leak-financial-crime-public-interest https://www.efinancialcareers.com/news/2022/07/credit-suisse-layoffs https://www.cnbc.com/2022/07/26/credit-suisse-ceo-to-step-down-from-embattled-investment-bank-wsj-says-.html https://www.efinancialcareers.com/news/2022/07/leaving-credit-suisse https://youtu.be/PyuUc74Qdzs Support my work!: https://Paypal.me/RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/dvr/62adfcc12b5235b8d598b7f4 Thanks for watching my content friends! #banking #creditsuisse #finance #lender #Switzerland #ubs #zurich #scandal #spygate #tidjanethiam #axellehmann #thomasgottstein #banks #morganstanley #spying #oligarchs #covid #lockdown #antoniohortaosorio, #coronavirus #archegosgreensill #markets #bonds #investing #investmentbanks #investment #money #scandalshttps://nicecrew.tv/static/streaming-playlists/hls/cf1a547a-c53a-457e-8630-a216dcf572a6/c29452db-3b94-4bef-9859-490b5daa1e65-master.m3u8https://nicecrew.tv/videos/embed/rzhKb5LBpdRRrpbfDFbvnQ993002024-04-03T00:16:48.816ZCredit SuisseThomas GottsteinGreensillArchegosSwiss LeaksYESRadix Verum ☦NOhttps://nicecrew.tv/w/tvwWSLzr53nVqGmnjPdJoKhttps://nicecrew.tv/lazy-static/thumbnails/fa726652-c6ae-4c83-9a7c-5d656abaf85a.jpgPutin Announces New Global Reserve Currency & Other Economic NewsRussian President Vladimir Putin announced a new global reserve currency at the 14th annual BRICS summit. He also announced the potential joining of Turkey, Egypt, and Saudi Arabia into the BRICS economic bloc. We talk about the latest economic and financial news as well. *Disclaimer this is not financial advice. Sources: https://news.bitcoin.com/targeting-the-us-dollars-hegemony-russia-china-and-brics-nations-plan-to-craft-a-new-international-reserve-currency/ https://archive.ph/SoopN https://www.cnbc.com/2022/07/26/home-price-growth-slowed-in-may-sp-case-shiller-says.html https://www.cnbc.com/2022/07/26/imf-cuts-global-gdp-forecast-as-economic-outlook-grows-gloomy.html https://www.cnbc.com/2022/07/26/shopify-sinks-12percent-after-company-plans-to-lay-off-10percent-of-workers.html https://www.cnn.com/2022/07/25/business/walmart-inflation-prices/index.html https://archive.ph/Wf6Vk https://www.cnbc.com/2022/07/21/jobless-claims-rise-again-in-another-sign-that-labor-market-is-cooling.html https://www.dol.gov/ui/data.pdf https://www.cnbc.com/2022/07/25/1-in-5-americans-dodging-credit-card-statements-as-interest-spikes.html https://finance.yahoo.com/news/recession-fears-rising-rates-buying-141724710.html https://archive.ph/m8ZhP https://www.redfin.com/news/housing-market-update-homes-take-longer-to-sell/ Support my work!: https://Paypal.me/RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/dvr/62adfcc12b5235b8d598b7f4 Thanks for watching my content friends! #BRICS #finance #lending #credit #inflation #recession #bonds #market #housingmarket #china #russia #germany #india #housingslump #economiccrisis #globalfinancialmeltdown #investment #investmentbanks #blackrock #vanguard #statestreet #redfin #mortage #gas #energycrisis #europehttps://nicecrew.tv/static/streaming-playlists/hls/dec66266-91e1-4c65-9792-5edc2db11b5f/368d425a-ad65-43f0-a8b5-d193c7a9079c-master.m3u8https://nicecrew.tv/videos/embed/tvwWSLzr53nVqGmnjPdJoK2946002024-04-03T00:21:48.468ZBRICSfinancelendingcreditinflationYESRadix Verum ☦NOhttps://nicecrew.tv/w/rKXNGZTXneKDEuJqJE16S7https://nicecrew.tv/lazy-static/thumbnails/5a7bd743-935f-41ba-9245-674b2a5aabe3.jpgThe Inflation Reduction Act of 2022 Will Cause MORE Inflation!Democrats drove the economy into a recession and the new Schumer-Manchin “Inflation and Recession Act” worsens inflation and raises taxes on American businesses, job creators, and workers at the worst possible time, according to experts. While our economy is in the midst of a recession and inflation is at a 40-year high, Senate Democrats’ solution is to increase the pain families are already feeling by raising taxes and doubling down on their failing policy agenda. Sen. Joe Manchin’s (D-W.V.) so-called Inflation Reduction Act is nothing more than Build Back Better 2.0. Greenlit by the misguided passage of the CHIPS-Plus Act, this latest attempt to ram through President Biden’s failed policy agenda without a single Republican vote has disaster written all over it. Over $400 billion in spending for left-wing priorities and $700 billion in tax hikes, this package will only worsen matters. Raising Taxes and Ignoring Spending $313 billion corporate tax hike that will be passed on to American families. $124 billion for IRS bureaucrats. $14 billion increase on capital gains taxes that will discourage investment. The package makes NO meaningful effort to curtail reckless spending in Washington. Sources: https://twitter.com/POTUS/status/1552420233578700800 https://twitter.com/tomselliott/status/1552415281405837312 https://www.jec.senate.gov/public/index.cfm/republicans/2021/10/the-economics-of-inflation-and-the-risks-of-ballooning-government-spending https://twitter.com/FreedomWorks/status/1554140038195302403 https://gop-waysandmeans.house.gov/one-pager-democrats-inflation-and-recession-act-makes-bidens-cruel-economy-even-worse/ https://twitter.com/SenCapito/status/1554170572074000386 https://twitter.com/OccupytheFeds/status/1552697487273738242 #recession #inflation #governmentspending #stimulus #covid #inflationreductionact #schumer #manchin #senatedemocrats #finance #investment #business #lending #banks #markets #realestate #consumer #bill #greennewdeal #green...https://nicecrew.tv/static/streaming-playlists/hls/d097d6ff-e486-4475-8690-a74ad780acae/5b56faa5-110a-464b-823f-e56b13e69b69-master.m3u8https://nicecrew.tv/videos/embed/rKXNGZTXneKDEuJqJE16S71125002024-04-03T00:17:25.819ZinflationrecessionpandemiccovidstimulusYESRadix Verum ☦NOhttps://nicecrew.tv/w/fzBBtZb4Js9zBb5jDzMZBhhttps://nicecrew.tv/lazy-static/thumbnails/7d81d531-2ebb-4415-9ee0-c6e9d0b0296d.jpgPutin Scares the UK & Perestroika DeceptionPresident Vladimir Putin said on Sunday the Russian navy would receive hypersonic Zircon cruise missiles within the next few months and the area of their deployment would depend on Russian interests. Putin did not mention Ukraine directly - but the Kremlin chief said he had signed a new navy doctrine, the details of which were not published, and touted the Zircon hypersonic cruise missiles as unique in the world. Putin: Russia is building the new world order right now. According to Russian President Vladimir Putin, authorities of Western countries cling to the shadows of the past and believe that the dominance of the West will be constantly preserved. However, nothing lasts forever, Putin said. BRICS countries have become a significant force worldwide and should play a "crucial" role in bettering the global governance system, an Indian economist has said. The 14th BRICS Summit "concluded with a futuristic and pragmatic agenda not only for BRICS but for developing countries and the world," Mohammed Saqib, secretary-general of the India China Economic and Cultural Council, said in an interview with Xinhua. Sources: https://www.mirror.co.uk/news/world-news/breaking-vladimir-putin-chilling-threat-27620729 https://english.pravda.ru/russia/152411-putin_new_world_order/ http://infobrics.org/post/36244/ https://twitter.com/AnonOpsSE/status/1552347644147679234 https://pbs.twimg.com/media/FYcfhtMXkAEjW0I?format=jpg&name=small https://pbs.twimg.com/media/FY4G1SAWIAAGGrP?format=jpg&name=small https://joshf731.substack.com/p/jewish-controlled-geopolitics-sino https://twitter.com/spriteer_774400/status/1554476917843279877 https://twitter.com/RWApodcast/status/1554416044676096000 https://www.nbcnews.com/politics/congress/pelosi-makes-historic-visit-taiwan-china-threats-rcna40675?cid=sm_npd_nn_tw_ma https://archive.ph/L6xkZ #taiwan #china #russia #brics #hypersonicmissiles #globalgovernance #un #unagenda2030 #agenda2030 #sustainabledevelopment #greenenergy #greengrowth #u...https://nicecrew.tv/static/streaming-playlists/hls/76116ea3-6f51-46f2-9278-7bfc976e53ba/3871731b-02fb-42ce-9035-2703334e3564-master.m3u8https://nicecrew.tv/videos/embed/fzBBtZb4Js9zBb5jDzMZBh1834022024-04-03T00:19:00.337ZBritianRussiaUkraineChinaTaiwanYESRadix Verum ☦NOhttps://nicecrew.tv/w/g7iGeVa7UKTxaHzmdLxHUnhttps://nicecrew.tv/lazy-static/thumbnails/ce4e72f6-7d36-405b-b4c8-885e1804e894.jpgRep's Dan Bishop & Ted Cruz GRILL FBI on Whitmer Kidnapping Hoax!FBI Director Christopher Wray admits to Ted Cruz that the FBI special agent in charge of the Detroit field office during the Whitmer kidnapping debacle is now in charge of the DC field office during the J6 investigation. Rep Dan Bishop: "The FBI did not discover an existing scheme, instead the FBI appears to have contrived the plot and provided logistical and financial support to what was in effect an FBI operation.” Sources: https://rumble.com/v1dzfhb-rep-dan-bishop-exposes-fbis-role-in-kidnapping-plot-of-gov-whitmer.html?mref=ah9c7&mc=cfcoh https://mobile.twitter.com/greg_price11/status/1555216170172780544?s=20&t=tKivMg6ETTKa2Y-SlWYJAg https://radixverum.substack.com/p/the-whitmer-case-and-the-fbis-patcon Support my work!: https://Paypal.me/RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/dvr/62adfcc12b5235b8d598b7f4 Thanks for watching my content friends! #FBI #Detriot #DC #TedCruz #DanBishop #Investigations #Federal #Government #Whitmer #Hoax #Fake #Operation #dupe #Michigan #PATCON #Con #Commentary #Reviewhttps://nicecrew.tv/static/streaming-playlists/hls/7a5a725b-5d9d-4d1c-8a7e-192091fcc239/c6d2e5d2-41f9-4f15-86a8-fea237c0aa7d-master.m3u8https://nicecrew.tv/videos/embed/g7iGeVa7UKTxaHzmdLxHUn1835002024-04-03T00:21:58.351ZChristopher WrayDan BishopTed CruzFBIWhitmerYESRadix Verum ☦NOhttps://nicecrew.tv/w/nY7r56Got4WDUCe4xFjeJzhttps://nicecrew.tv/lazy-static/thumbnails/e66c008e-0542-48ec-8ff9-4b560a8dfac7.jpgFBI Contrived Whitmer Kidnapping Hoax!it was all a shamhttps://nicecrew.tv/static/streaming-playlists/hls/b1e586e9-3bb8-49cd-9177-bcb6523f6259/b9769acc-b8cc-46d1-9bac-a6a19fe2973e-master.m3u8https://nicecrew.tv/videos/embed/nY7r56Got4WDUCe4xFjeJz56002024-04-03T00:17:57.534ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/tzFQq93Docrz8i1ymp3mefhttps://nicecrew.tv/lazy-static/thumbnails/02c1e180-3659-41b1-a80e-aa55da8f7287.jpgTrump Calls Out Fake Whitmer Kidnapping Plot at CPAC 2022Finally, Trump addressed the fake Whitmer Kidnapping plot hoax at CPAC 2022 calling it fake and made up - which it is. The retrial is set to begin tomorrow, and we will be traveling to Michigan to cover the verdict in person. I will continue to provide updates in this case. FBI Director Christopher Wray apparently dodged questions by Republicans because he had to urgently catch a taxpayer-funded flight on a private jet to his weekend vacation as most Americans cannot afford groceries and gas. Sources: https://acecomments.mu.nu/?post=400377 https://twitter.com/Acyn/status/1556071775913508865 https://twitter.com/WSJ/status/1556648974676803584 https://www.wsj.com/articles/federal-prosecutors-face-tough-task-in-retrial-of-men-accused-in-plot-to-kidnap-michigan-gov-whitmer-11659961800?mod=e2tw https://twitter.com/nedryun/status/1555618639297925120 https://twitter.com/lukerosiak/status/1555595171231932418 Support my work!: https://Paypal.me/RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/dvr/62adfcc12b5235b8d598b7f4 Thanks for watching my content friends! #FBI #Whitmer #Covid #Lockdowns #Pandemic #CPAChttps://nicecrew.tv/static/streaming-playlists/hls/df5ad657-953c-4d2c-94a7-c3fc29d04610/66702595-dfc9-4921-9efd-a6463eaa7675-master.m3u8https://nicecrew.tv/videos/embed/tzFQq93Docrz8i1ymp3mef1085002024-04-03T00:18:46.184ZMichiganGov. Gretchen WhitmerFBIChristopher WrayCPACYESRadix Verum ☦NOhttps://nicecrew.tv/w/wR3pFKyH7XntWytMMoaaLZhttps://nicecrew.tv/lazy-static/thumbnails/5d1d8fbe-af8b-430d-9afc-3d5cf369af7e.jpgTrump RAIDED by FBIBreaking news for a Monday night: President Trump announced his home in Palm Beach - Mar-A-Lago - “is currently under siege, raided, and occupied by a large group of FBI agents.” - 30 FBI agents raid took place at 10:00 AM. - The raid is regarding 15 boxes of classified info. - Trump was in NY at the time. - White House was not given notice. - Raid was Court Authorized. - Secret Service knew ahead of time. https://technofog.substack.com/p/the-fbi-has-raided-president-trumps Support my work!: https://Paypal.me/RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/dvr/62adfcc12b5235b8d598b7f4 Thanks for watching my content friends! #Trump #Raid #FBI #FBIRaid #PresidentTrumpRaided #ClassifiedDocuments #NationalArchives #Democrats #politicalpartieshttps://nicecrew.tv/static/streaming-playlists/hls/f9cb16b7-9ff7-468f-9c12-08aac6632d1d/ecbd5cc3-4622-48b7-a2b2-fbb1deaef6f0-master.m3u8https://nicecrew.tv/videos/embed/wR3pFKyH7XntWytMMoaaLZ642032024-04-03T00:18:36.284ZTrumpPresident TrumpFBIFBI RaidPresident Raided by FBIYESRadix Verum ☦NOhttps://nicecrew.tv/w/qTkDfaBfiLVkUQwM3XeDrrhttps://nicecrew.tv/lazy-static/thumbnails/a97086fa-9747-47a0-aade-bb6fa6c85597.jpgFBI Admits to Planting Evidence in Michigan Whitmer Kidnapping Plot RetrialThe retrial is now underway in the USA vs Fox, et al aka the Michigan Whitmer Kidnapping Plot case. The Retrial began on August 9th with jury selection, day one of the retrial yesterday, and then day two today. The FBI was caught in a contradiction on day one, on day two they admitted to planting evidence in a defendant's vehicle to seize it when they arrested him. We learned the FBI can use a device designed to look like a credit card as a listening device - so no one wears a wire anymore. Link to article: https://radixverum.substack.com/p/fbi-admits-to-planting-evidence-in Subscribe to my backup/second channel: https://youtube.com/channel/UCu-wpDZ2sQi2MA7O5HJBm_g Support my work!: https://Paypal.me/RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/channel/Radix-Verum Thanks for watching my content friends! #FBI #Whitmer #AdamFox #BarryCroft #Evidence #Misconduct #Corruption #Entrapment #FBIInformants #CHS #TrueCrime #investigation #Investigations #CourtCasehttps://nicecrew.tv/static/streaming-playlists/hls/c9865d71-48b7-4a01-97d0-55a5071ab9ef/919d0e21-541d-4eae-884e-cb64c6ca320e-master.m3u8https://nicecrew.tv/videos/embed/qTkDfaBfiLVkUQwM3XeDrr2782002024-04-03T00:23:41.492ZGov. Gretchen WhitmerMichiganWhitmer KidnappingPlotHoaxYESRadix Verum ☦NOhttps://nicecrew.tv/w/oPJAAScVisz5hKJkS4UziHhttps://nicecrew.tv/lazy-static/thumbnails/1e732757-3694-4aa1-9682-6f53a59dde68.jpgMichigan Whitmer Fednapping Hoax STATE CASE HAPPENING NOWThe State case in the Michigan Whitmer Kidnapping Hoax is happening now. different rules for state vs federal court.https://nicecrew.tv/static/streaming-playlists/hls/b8d3423f-5f6c-4bf0-8937-6920447b38f7/97bfbb68-1863-4144-b017-6dd615a6d0fe-master.m3u8https://nicecrew.tv/videos/embed/oPJAAScVisz5hKJkS4UziH70002024-04-03T00:18:16.405ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/ivtWeFf3LnAV7KCM1AXgyEhttps://nicecrew.tv/lazy-static/thumbnails/f220aaa4-f068-4d94-b125-ab3b0466aed3.jpgDark Brandon Launches a War on America & The Shape of Things to Come...Joe Biden delivered a speech about the "soul of the nation," which was in reality the announcement and preparation for a new domestic "war on terror." This was designed to prepare the public for the arrest of the left's political opposition under the guise of "defending our democracy," from "extremism." Sources: https://twitter.com/grantstern/status/1565781684456398849 https://twitter.com/JoeBiden/status/1566063575428390913 https://twitter.com/stoolpresidente/status/1565508929270022145 https://twitter.com/TomFitton/status/1565895169853083648 https://twitter.com/TPostMillennial/status/1565795730492911616 https://twitter.com/noreward_norisk/status/1565808245171785731 https://twitter.com/banthebbc/status/1291785959764299776 https://twitter.com/libertytarian/status/1191484131898732545 https://www.goodreads.com/quotes/162691-the-technotronic-era-involves-the-gradual-appearance-of-a-more https://twitter.com/omnologos/status/1542788615809515520 https://www.usatoday.com/story/opinion/contributors/2022/06/22/american-democracy-former-cia-director/7685947001/ https://archive.org/details/handbook-of-hate-memes/page/n89/mode/2up https://archive.ph/exLho https://archive.ph/WhsGV https://archive.ph/ZgwFv https://www.govtrack.us/congress/bills/117/hr4350/text https://twitter.com/egavactip https://twitter.com/egavactip/status/901183313301426179 https://twitter.com/twocatsand_docs/status/1550929230548066305 https://thehill.com/policy/technology/504061-potentially-sensitive-files-from-hundreds-of-police-departments-published/ https://twitter.com/iarnsdorf/status/1451212099800211461 https://twitter.com/micahflee/status/1351685226091593728 https://twitter.com/micahflee/status/1516521193808875527 https://twitter.com/BroThorn/status/1493242012107100160 https://www.wired.com/story/ddosecrets-blueleaks-wikileaks/?mbid=social_twitter&utm_brand=wired&utm_medium=social&utm_social-type=owned&utm_source=twitter https://twitter.com/NewAmericanMag/status/1275609779369623554 https://twitter.c...https://nicecrew.tv/static/streaming-playlists/hls/8dc92465-0cd8-4b84-9829-c94d418cb57a/7e1f9353-3372-479a-aac7-578ce22c4384-master.m3u8https://nicecrew.tv/videos/embed/ivtWeFf3LnAV7KCM1AXgyE5173572024-04-03T00:29:20.039ZJoe BidenPresident BidenSoul of the NationSpeechHG WellsYESRadix Verum ☦NOhttps://nicecrew.tv/w/hE2ErnAbWbxvHH3tutE5r2https://nicecrew.tv/lazy-static/thumbnails/d1cf21b9-c329-4f92-ab64-b57de9f76dde.jpgAnyone Can be Fooled by the Narcissist, Even YOU!Anyone can be fooled by the narcissist, even those who have grown up around these people and have educated themselves on narcissistic abuse. There are different kinds of narcissists out there and they operate in different ways. Covert or vulnerable narcissists are very good at appearing outwardly normal. Sometimes very high IQ narcs are good at the con. Sometimes it is a long con, and they are playing the long game. This could change the normal cycles that they would employ. Sometimes they have nothing to gain from it outside of control and feeding their ego. They are professional con artists. They can make love bombing look innocent. They can be so smooth they fool therapists and psychologists. Many times, these people are gifted, they are charming and charismatic, and they make you feel special. Support my work!: Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/channels/radix-verum Thanks for watching my content friends! #narcissism #narcissist #lovebombing #emotionalabuse #npdhttps://nicecrew.tv/static/streaming-playlists/hls/86e181aa-41ac-4115-b924-453d0524771b/7b4f45a7-9971-40d5-9661-16b6d3f53e73-master.m3u8https://nicecrew.tv/videos/embed/hE2ErnAbWbxvHH3tutE5r21483012024-04-03T00:22:44.812Znarcissismnarcissistnarcissistic abusenpdemotional abuseYESRadix Verum ☦NOhttps://nicecrew.tv/w/7nrqXzsR7MqLEAdXfyY1sShttps://nicecrew.tv/lazy-static/thumbnails/f39a949c-1273-47bd-9687-4bf85594b068.jpgPain, Suffering, & BetrayalIf someone you love and trust has broken your trust and your heart, it can feel like the sting of betrayal. Betrayal only comes from those who are close to us, never from an enemy because they don't have your trust and confidence in the first place. This pain can leave deep wounds and cause you to feel emotional distress. You might feel like you can't allow people to get close to you, and that you cannot be vulnerable with others. That is a really difficult feeling to grapple with. As David in the Bible says in Psalm 55 "If an enemy were insulting me, I could endure it, if a foe were raising himself against me, I could hide from him, but it is you, a man like myself, my companion, my friend..." We are called to follow Christ's example, to forgive those who have trespassed against us. We are told to never repay evil for evil or insult with insult. We can choose to love even those who have hurt us unconditionally. That doesn't mean you have to allow them into your life anymore, but you love them, no matter what. Support my work!: https://radixverum.locals.com Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/channels/radix-verum Thanks for watching my content friends! #pain #suffering #heartbroken #betrayal #friendship #relationships #godfatherhttps://nicecrew.tv/static/streaming-playlists/hls/33951f84-a76b-417b-a225-bb161ea0c356/e8b71d98-d117-414a-908f-15c9861629d3-master.m3u8https://nicecrew.tv/videos/embed/7nrqXzsR7MqLEAdXfyY1sS1043002024-04-03T00:22:03.667ZpainsufferingheartbreakbetrayalfriendshipYESRadix Verum ☦NOhttps://nicecrew.tv/w/vJRAXUe83sNLKYVpCFgu7bhttps://nicecrew.tv/lazy-static/thumbnails/cb7bbde3-ff49-4479-ae61-8b13cc112c32.jpgEU Energy Crisis & The Coming Global Economic CollapseThe EU is now proposing a "mandatory target for reducing electricity use at peak hours" in order to "flatten the curve." This is not a joke. The UK is facing a "deep recession," as the entire world is facing major economic problems. SUBSCRIBE TO MY SECOND CHANNEL: https://youtube.com/channel/UCu-wpDZ2sQi2MA7O5HJBm_g Sources: https://twitter.com/disclosetv/status/1567462388898594816 https://twitter.com/SquawkCNBC/status/1567476509618618376 https://twitter.com/ShellenbergerMD/status/1567550648471941120 https://twitter.com/jsblokland/status/1567510324969865217 https://twitter.com/RobinBrooksIIF/status/1566806725663014914 https://twitter.com/RonStoeferle/status/1567365628389908485 https://twitter.com/KimDotcom/status/1564800613170290688 https://twitter.com/BBCPolitics/status/1567528140070699009 https://twitter.com/Forbes/status/1567597313392091136 https://twitter.com/FistedFoucault/status/1567460298218504192 https://twitter.com/BarnettforAZ/status/1567572385565646852 https://twitter.com/mviser/status/1567571321579503616 Support my work!: https://radixverum.locals.com Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/dvr/62adfcc12b5235b8d598b7f4 Thanks for watching my content friends! #EU #energycrisis #russia #global #economiccrisis #inflation #recession #currency #investment #money #finance #economy #china #renewableenergy #solar #wind #greenenergy #debt #winterhttps://nicecrew.tv/static/streaming-playlists/hls/f0d4d40b-dff1-47eb-b6fe-57e7e15af3de/572f4ab4-72b9-4259-a3a7-f67122c1ddaf-master.m3u8https://nicecrew.tv/videos/embed/vJRAXUe83sNLKYVpCFgu7b1008002024-04-03T00:23:09.294ZEuropean UnionRussiaGlobal Economic MeltdownGlobal RecessionrecessionYESRadix Verum ☦NOhttps://nicecrew.tv/w/iFnkG3iZFQ3S7Yc6ahY3REhttps://nicecrew.tv/lazy-static/thumbnails/10715a0f-5e61-413e-9808-cd27a9e5399e.jpgQueen Elizabeth II Dead at Age 96Queen Elizabeth II, Britain’s longest-serving monarch, has died aged 96, Buckingham Palace has announced. Britain was in mourning after her death, which marks a watershed moment in the life of the nation, ending a reign that spanned 70 years. The Prince of Wales, the Queen’s eldest son, has become the new monarch, King Charles III. Buckingham Palace said in a statement: “The Queen died peacefully at Balmoral this afternoon. The King and The Queen Consort will remain at Balmoral this evening and will return to London tomorrow.” Senior members of the royal family had travelled earlier in the day to be with her at Balmoral, the Queen’s castle in the Scottish Highlands, while at Westminster the mood among senior politicians was sombre. The Queen celebrated the 70th anniversary of her reign this year. She represented continuity and stability for Britain from the postwar era into the 21st century. The country was braced for the death of the monarch on Thursday morning when Buckingham Palace issued a rare medical bulletin on the Queen’s health. The BBC suspended normal programming. Earlier this week, the Queen, who had suffered from mobility issues for some time, oversaw the transition of power from Boris Johnson to new prime minister Liz Truss from Balmoral instead of travelling to London. She became the longest-serving monarch in British history in 2015, surpassing her great-great-grandmother Queen Victoria. Support my work!: https://radixverum.locals.com Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/dvr/62adfcc12b5235b8d598b7f4 Thanks for watching my content friends! #uk #britain #britannia #queenelizabeth #monarch #world #history #thecrown #thequeen #elizabethII #princecharles #buckinghampalace #royalfamily #kingcharleshttps://nicecrew.tv/static/streaming-playlists/hls/8f2a83e2-a307-4b71-a112-f4d1802230a8/fde1040c-7e48-4266-8fe3-e585660bf763-master.m3u8https://nicecrew.tv/videos/embed/iFnkG3iZFQ3S7Yc6ahY3RE494002024-04-03T00:22:35.419Zbuckingham palaceprince charlesqueen elizabethqueen elizabeth IIdeathYESRadix Verum ☦NOhttps://nicecrew.tv/w/6QQf2d7TjehxD2i4tdWg7xhttps://nicecrew.tv/lazy-static/thumbnails/d57fe704-ae23-4681-afc0-62edcca8b0a7.jpgOn PrideOn Pride, Vainglory, and Humility. Support my work!: https://radixverum.locals.com Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/channel/radix-verum Thanks for watching my content friends! #pride #vainglory #humility #lucifer #satan #sins #passions #salvation #vanity #narcissismhttps://nicecrew.tv/static/streaming-playlists/hls/2f4f1fd1-521a-4142-a6a1-4f544aba83e7/24c4a7ca-7c6c-4ee8-a9c4-9a1f2b412569-master.m3u8https://nicecrew.tv/videos/embed/6QQf2d7TjehxD2i4tdWg7x3096002024-04-03T00:26:35.524ZSaint John CassianPridevanityvaingloryhumilityYESRadix Verum ☦NOhttps://nicecrew.tv/w/2AW3Kt9XW7J1m8e4cxdgEYhttps://nicecrew.tv/lazy-static/thumbnails/b91b68e5-cb95-42e6-a257-291f67687e29.jpgStop Pandering to WomenPandering to women is pandering to delusion. Women do not know what they want. They need to be told. Oftentimes, women need men to protect them from themselves and their poor decisions. Modern women are miserable. 1 in 4 women are on SSRIs. Gender Ideology is destroying society, as is feminism and the gynocentric west. Stop seeking the approval of women. Stop going to any length to please women who will never be happy because that doesn’t make them feel fulfilled. In many cases, men pander to women to avoid confrontation because they are pussies. They compromise, rationalize, and second-guess themselves. Women do not respect these kinds of men; these men do not respect themselves. Modern women are never satisfied, they suffer from the “I can do better,” delusion. Don’t get me wrong, men suffer from this as well, but they are less delusional about it. Many women have an over-inflated sense of self-worth to begin with, so pandering to them makes this even worse and confirms their own skewed biases. They lack a strong connection and firm grasp on reality. Men are rational and logical, and they try to figure women out, but women are not rational and logical for the most part. Women are emotional, they are moldable. They will act as disobedient as you let them. Women have had their delusions pandered to since they were children and Disney told them all that they were princesses. They were told they can “have it all,” and they were told being a wage slave was freedom. Women need men to feel fulfilled. Stop pandering, start GUIDING. Support my work!: https://radixverum.locals.com Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/dvr/62adfcc12b5235b8d598b7f4 Thanks for watching my content friends! #women #feminism #masculinity #femaledelusion #delusional #depressio...https://nicecrew.tv/static/streaming-playlists/hls/0cf9bc17-ae8b-46ba-b947-92fd0abb44e0/e78a12cd-7609-4838-92a3-9c6b5bd44319-master.m3u8https://nicecrew.tv/videos/embed/2AW3Kt9XW7J1m8e4cxdgEY9440162024-04-03T00:23:04.277Zpanderingfemale delusionunhappy womenmodern womendatingYESRadix Verum ☦NOhttps://nicecrew.tv/w/vcsLDujh9vHDmJRXmY5Kt6https://nicecrew.tv/lazy-static/thumbnails/756c31bd-4c31-467b-b241-2ea412c2f688.jpgThe Virtues of a WomanA virtuous woman is precious, like a diamond she is invaluable to a man. A lot of my work criticizes modern godless women, so I wanted to make a video honoring the godly women who are out there. They are everything beautiful, sweet, loving, and graceful in this world. They are the mothers raising real, strong men. They are wise women counseling young wives on how to raise children and how to best serve and honor their husbands. Support my work!: https://Radixverum.locals.com Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/channel/radix-verum Thanks for watching my content friends! #Virtue #godly #godlywomen #women #feminine #relationshipshttps://nicecrew.tv/static/streaming-playlists/hls/ec72b337-5931-408f-afcb-8b00caafe80f/ccd210e6-145c-43ee-a637-28c437fbcbc7-master.m3u8https://nicecrew.tv/videos/embed/vcsLDujh9vHDmJRXmY5Kt6438512024-04-03T00:22:55.581Zvirtuewomenwomangodly womenwifeYESRadix Verum ☦NOhttps://nicecrew.tv/w/p2XfPaaR68avqEis8urciQhttps://nicecrew.tv/lazy-static/thumbnails/a3eb7712-74c4-4ad8-a989-26f5e4735191.jpgModern Women are NEVER Satisfied: Gisele & Tom Brady EditionModern women are never happy, and they are never satisfied. You can be a millionaire like Tom Brady, the greatest quarterback and they are still going to complain about their career. You can never please them, you can never do enough. Gisele dated Leonardo DiCaprio for six years before marrying Tom Brady. She's an Alpha Widow and Brady appears to be her "Beta Bucks," guy. Sources: https://www.news.com.au/sport/sports-life/resentful-gisele-bndchen-walks-out-on-tom-brady-amid-trouble-in-marriage/news-story/017db73a5862f45c9791ed89800e34a3 https://www.usmagazine.com/celebrity-news/pictures/tom-brady-and-gisele-bundchen-a-timeline-of-their-relationship/amp/ https://twitter.com/markjburns88/status/1569759497253445634 Support my work!: https://Radixverum.locals.com Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/channel/radix-verum Thanks for watching my content friends! #gisele #giselebundchen #tombrady #patriots #dating #relationships #modernwomen #redpill #mgtowhttps://nicecrew.tv/static/streaming-playlists/hls/ba87fc3c-8644-439a-b8cf-94e99fd63e9e/c46dedfb-5670-4235-8e80-4c549df9cabd-master.m3u8https://nicecrew.tv/videos/embed/p2XfPaaR68avqEis8urciQ514052024-04-03T00:22:57.448Zgiselegisele bundchentom bradydatingrelationshipsYESRadix Verum ☦NOhttps://nicecrew.tv/w/84de8eHABYYVMhTRDn365whttps://nicecrew.tv/lazy-static/thumbnails/ae8d525b-d31d-4d1e-abd7-502c633f8065.jpgNarcissism, Parasitic Entities, and Spiritual WarfareI want to talk today about how narcissistic abuse is spiritual warfare. Before we get into the discussion, I think it’s first helpful to define things. There are different kinds of narcissists, grandiose or overt, covert, or vulnerable, malignant, and parasitic. There may be more types, but generally speaking, narcissism or NPD is characterized by the following traits: 1. An extremely self-centered person who has an exaggerated sense of self-importance. 2. A deep need for excessive attention and admiration 3. A lack of empathy for others 4. Distorted self-image 5. Intensely preoccupied with themselves They tend to embellish and exaggerate their own accomplishments, intelligence, success, power, and looks. Their preoccupation and self-absorption adds to this lack of empathy which leads them to take advantage of others, without feeling regret or guilt. They can be extremely controlling, jealous, and overly sensitive. Because of this over-sensitivity, they might angrily lash out at any criticism or pushback. They perceive it as a direct attack on them and they take it personally. They might on the other hand, depending on what type of narcissist they are instead retreat and give you the cold shoulder, the silent treatment, they might sulk and self-deprecate to guilt you and make you feel bad. You might feel as if you have incredibly wounded this shy, sweet, sensitive person – even if the criticism or pushback was warranted or justified you might find yourself apologizing and trying to lift their spirits. They may act out when they aren’t getting special treatment or aren’t the center of attention. Under the surface, deep inside the narcissist is a wounded child and major insecurity. A parasite is an organism living in, on, or with another organism in order to obtain nutrients, grow, or multiply often in a state that directly or indirectly harms the host. In the human sense, a parasite is someone or something that resembles a biological parasite in living off o...https://nicecrew.tv/static/streaming-playlists/hls/3922bc94-fb7a-4edb-80c0-0a53ca32093a/ec413f00-2107-497c-b211-9feaef1d6e5d-master.m3u8https://nicecrew.tv/videos/embed/84de8eHABYYVMhTRDn365w31470112024-04-03T00:28:53.236Znarcissistic abusenarcissismnarcissistparasitic entitiesparasitesYESRadix Verum ☦NOhttps://nicecrew.tv/w/fotKTfWqrZG4ZkM8PMekuThttps://nicecrew.tv/lazy-static/thumbnails/be38cb6a-2e1e-4cfc-b81f-0e6ef1ed876d.jpgSugar Babies of Stanford: Classless Women and Simps Ruin EVERYTHINGWe are going to be talking about an article entitled "The Sugar Babies of Stanford University," and how feminism and sexual liberation are completely destroying male-female relations and society in general. Source: https://www.piratewires.com/p/the-sugar-babies-of-stanford-university Support my work!: Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/channel/radix-verum Thanks for watching my content friends! #stanford #sugarbabies #dating #relationships #manosphere #mgtow #masculine #feminine #relationshipadvice #redpill #datingadvice #vulnerability #exploitation #sugardaddies #simpinghttps://nicecrew.tv/static/streaming-playlists/hls/748368e8-d09c-4be8-b5fe-32eb093875af/6b089efc-db89-409b-8873-d06388be5281-master.m3u8https://nicecrew.tv/videos/embed/fotKTfWqrZG4ZkM8PMekuT2044002024-04-03T00:25:04.987Zstanford universitysugar babiessugar daddiesrelationshipsdatingYESRadix Verum ☦NOhttps://nicecrew.tv/w/98s1QphA77WWkjkQB59uNPhttps://nicecrew.tv/lazy-static/thumbnails/c5a62740-61bc-4e0f-8046-35a0a555011e.jpgThe Sad World of @RileyReidx3I came across a video about this particular female, who has bragged and laughed about raping a man. It's not funny and if a man bragged about raping a woman he would be in major trouble. Some dude actually wifed her up and had children with her. I do not believe "adult entertainers" should be allowed to have children, sorry. What do you think about Riley Reid and her comments about sexual abuse? Support my work!: Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/channels/radix-verum Thanks for watching my content friends! #RileyReid #pornaddiction #adultentertainment #relationships #dating #redpill #blackpill #pornhttps://nicecrew.tv/static/streaming-playlists/hls/41d358fc-b81c-4461-a08e-ca99e13f306b/8d1a2721-f65b-4f6c-a19b-5eb3fc6fbba8-master.m3u8https://nicecrew.tv/videos/embed/98s1QphA77WWkjkQB59uNP27640152024-04-03T00:25:12.138ZRiley ReidHollywoodPornPorn IndustryAdult EntertainmentYESRadix Verum ☦NOhttps://nicecrew.tv/w/kTckoWQPV8PxkR6YMVA6uBhttps://nicecrew.tv/lazy-static/thumbnails/dcd6d9cc-3871-4f6e-ae46-8ae619f023e5.jpgI Was Deep in Delusion.A few thoughts about my latest video, and modern female delusion and deception. I was deceived and delusional. I humbled myself. Modern Godless society has been so destructive to men and women and relationships. Everyone seems traumatized and unable to connect with others on a deep level. It's very sad. Support my work!: https://radixverum.locals.com Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/channels/radix-verum Thanks for watching my content friends! #delusion #deceit #selfcare #selfdeception #relationships #dating #friendshiphttps://nicecrew.tv/static/streaming-playlists/hls/a1038d48-6c9f-4867-9f80-1101abf7d86f/a1d84eed-6482-44a7-812d-295fea444918-master.m3u8https://nicecrew.tv/videos/embed/kTckoWQPV8PxkR6YMVA6uB1087082024-04-03T00:24:54.465Zdatingredpillrelationshipsself careself helpYESRadix Verum ☦NOhttps://nicecrew.tv/w/kbcbB6evdu8Y8q2JUT6jLKhttps://nicecrew.tv/lazy-static/thumbnails/ecd3cf28-6bbc-4ae0-bf83-af096ccc791c.jpgFBI Admits Under Oath to Lying About the Pretext to Open the Whitmer Fednapping Hoax InvestigationThere is currently a state case in Jackson County, Michigan for 3 men tied to the so-called "Whitmer Kidnapping Plot" hoax. Those men, Pete Musico, Paul Bellar, and Joe Morrison have been charged with providing material support for terrorism. Unlike federal court, state court is able to be televised. During the cross-examination of FBI Special Agent Henrik Impola, we learned that the FBI lied about the pretext to open their investigation into the Wolverine Watchmen Militia. They claimed there were numerous threats to law enforcement officers but had to admit that it was actually just spicy memes, a legal hunting app, and a schematic for a firearm that was posted on a website that Ty Garbin posted a screenshot of. None of that is illegal nor is it any kind of threat to law enforcement. They LIED. Support my work!: https://radixverum.locals.com Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/channels/Radix-Verum Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/9b49f6c2-fda9-41d3-bf59-69292cda8f23/63f2e084-a049-45f7-ada7-49dc454582aa-master.m3u8https://nicecrew.tv/videos/embed/kbcbB6evdu8Y8q2JUT6jLK955012024-04-03T00:24:35.399ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/rDZpy6mXWaEDRLTmCXSBGJhttps://nicecrew.tv/lazy-static/thumbnails/8799e390-1700-4d46-a4b2-a8d16d72202c.jpgThe Latest Psyop: The US Army EgirlThe latest US Military Psyop just dropped: The Egirl. The US Army was 25% short on its recruitment this year, so they are trying to appeal to the younger generation, specifically young men. The interesting thing is the Army seems to be smart enough to know how transparent this all is, so Lunchbaglujan - as she is named on TikTok - acknowledges the psyop and tries to seduce you anyway. "Yes silly boy we are mind fucking and psyopping you, but what if it was the best mind fucking you'll ever get." Sources: https://twitter.com/vylpill/status/1579742380756197376 https://twitter.com/_gvg_2/status/1578946883120398336 https://www.tiktok.com/@lunchbaglujan https://consortiumnews.com/2017/10/13/the-legacy-of-reagans-civilian-psyops/ https://www.usatoday.com/story/news/nation/2022/10/03/us-army-misses-recruiting-goal/8166523001/ Support my work!: https://radixverum.locals.com Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/channels/radix-verum Thanks for watching my content friends! #USArmy #Military #Psyops #PsychologicalWarfare #Egirls #Thots #generationZ #russia #ukraine #europe #USMilitary #seduction #influenceoperations #perception #perceptionmanagementhttps://nicecrew.tv/static/streaming-playlists/hls/cfc25d1e-c46d-4035-bd54-d55ef6681866/d89178f2-9964-4b39-8fb4-d7bda25f2dc3-master.m3u8https://nicecrew.tv/videos/embed/rDZpy6mXWaEDRLTmCXSBGJ1391032024-04-03T00:24:32.013ZUS ArmyArmyUS MilitaryMilitaryPsychological OperationsYESRadix Verum ☦NOhttps://nicecrew.tv/w/ekfECgmkr87JXSzsNPvfrNhttps://nicecrew.tv/lazy-static/thumbnails/234808f5-a0b3-4ff4-a600-b7b91337f001.jpgLegal Bytes McJudas Demands Spite Stream Struggle Session with @LegalMindset and @RekietaLawI wanted to make a video addressing the @LegalBytesMedia @HoegLaw drama with @LegalMindset and @RekietaLaw after watching Bytes mischaracterize what Andrew and Nick have said. I didn't make any videos addressing this before, but I felt compelled to comment on it because Andrew is my good friend and I will always have his back, one hundred percent. @ThatUmbrellaGuy @ValliantRenegade @GoodLawgic @legalvices @mistersen @MigtownPodcast @TheDUIGuyPlus @LawNerdClips Support my work!: https://radixverum.locals.com Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/channel/radix-verum Thanks for watching my content friends! #legalBytes #Lawtube #LegalMindset #rekietalaw #drama #hoeglaw #TheDUIGuy #nickrekieta #censorship #deplatforminghttps://nicecrew.tv/static/streaming-playlists/hls/6bf6f8f0-cc8d-4202-8f1d-7d43f503aa08/42c35e74-80fd-4812-a344-86a1e6073400-master.m3u8https://nicecrew.tv/videos/embed/ekfECgmkr87JXSzsNPvfrN3645042024-04-03T00:28:58.830Zlawtubedramarekieta lawnick rekietalegal mindsetYESRadix Verum ☦NOhttps://nicecrew.tv/w/oGrEMHwwWpYVXqnMJuDdXzhttps://nicecrew.tv/lazy-static/thumbnails/abe89871-f9c4-4271-a333-5966379cc3b3.jpgThe Self Victimization of @Amouranth and Past False Accusations?I have learned a bit more about the Amouranth situation since my Livestream yesterday talking about what little information we know. I cautioned people to not rush to judgment without having more information. I think that many people like @HasanAbi and others are using this whole scandal to virtue signal and pretend they know for sure what is happening between a woman and her husband when that is literally not possible. Only Amouranth and her husband know the full story. We simply don't know and shouldn't be dragging this guy and calling him an abuser without having more information. Remember that Amber Heard tried to set up Johnny Depp by goading him into yelling at her or slamming the cabinet doors while she secretly recorded him and then sent the video to @TMZ. Let's ask for evidence and due process and let's also demand that adults be accountable for their own choices. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/channel/radix-verum Thanks for watching my content friends! #amouranth #amberheard #johnnydepp #animematsuri #allegations #dueprocess #dating #relationships #redpill #metoo #believeallwomen #twitch #streamer #streamers #gamers #gaming #cosplay #toxicrelationshipshttps://nicecrew.tv/static/streaming-playlists/hls/b7ce9ec9-2160-4381-aaff-13d42bc9f3cf/7bb4acc9-ccb9-4ef2-9638-5ce24490b422-master.m3u8https://nicecrew.tv/videos/embed/oGrEMHwwWpYVXqnMJuDdXz2778052024-04-03T00:27:00.995Zamouranthtwitchstreamersonline streamergamingYESRadix Verum ☦NOhttps://nicecrew.tv/w/r9vdD55dAdBe9QgitJM99Nhttps://nicecrew.tv/lazy-static/thumbnails/6d8e1fd8-0555-4ffd-a4f3-97b95c14025d.jpgDarrell Brooks Waukesha Parade Attack Terrorist Disgusting Court Behavior & DisruptionsThe trial of WI vs Darrell Brooks for the Waukesha Christmas Parade Domestic Terror attack has been ongoing, and the entire thing has been made into a spectacle and joke by Brooks who is representing himself. Waukesha Circuit Judge Jennifer Dorow is allowing this to happen and is infantilizing Brooks, treating him like a child, and giving him the opportunity to further hurt the family of the victims. Darrell Brooks is a convicted pedophile. Sources: https://radixverum.substack.com/p/never-forget-the-moment-they-declared https://national-justice.com/waukesha-alleged-attacker-convicted-pedophile-repeat-felon-and-self-described-black-terrorist-who https://justicereport.news/articles/2022/10/13/day-9-jackson-sparks-memory-lives-on-after-brutal-autopsy-report-brooks-asks-case-be-dismissed-due-to-bias-in-bizarre-fifty-minute-rant/ https://justicereport.news/articles/2022/10/17/day-11-brooks-offered-coat-sandwich-uber-ride-and-cellphone-after-fleeing-deadly-parade-attack-as-witnesses-continue-to-testify/ Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/dvr/62adfcc12b5235b8d598b7f4 Thanks for watching my content friends! #waukeshaparade #darrellbrooks #waukesha #truecrime #attack #domesticterrorism #legal #crime #criminal #court #courtcases #legal #lawandorderhttps://nicecrew.tv/static/streaming-playlists/hls/cba46c3f-4468-4422-98f8-3460ef0ec466/aa571560-e7ae-4717-8d4a-6e4b494bd076-master.m3u8https://nicecrew.tv/videos/embed/r9vdD55dAdBe9QgitJM99N1266012024-04-03T00:24:42.021ZwaukeshaChristmas paradeparadeattackterror attackYESRadix Verum ☦NOhttps://nicecrew.tv/w/2ei51FBKaqABPgy5tJcC83https://nicecrew.tv/lazy-static/thumbnails/9fc18f44-85e9-421c-8420-df12060431fb.jpgThe Coolest @strangerthings Halloween Decorations ​I am a huge fan of Halloween and I love to see awesome Halloween decorations. I am also a huge fan of the @Netflix series @strangerthings Stranger Things is set in the fictional rural town of Hawkins, Indiana, during the 1980s. The nearby Hawkins National Laboratory ostensibly performs scientific research for the United States Department of Energy, but secretly does experiments into the paranormal and supernatural, including those that involve human test subjects. The show is in the drama, fantasy, horror, and mystery genres. It has tons of 80s nostalgia and was clearly inspired by dungeons and dragons and shows like the X-Files. I love that it actually gets into real conspiracies like the CIA MKUltra mind control experiments and things like remote viewing and psychic warriors. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/channel/radix-verum Thanks for watching my content friends! #netflix #strangerthings #strangerthings4 #halloween #decorations #trickortreat #horror #fantasy #mystery #drama #thriller #max #vecna #dnd #art #upsidedown #theupsidedown #mkultrahttps://nicecrew.tv/static/streaming-playlists/hls/09f453b0-f478-43d8-ba2c-8334fb2780e0/152e1bb5-a055-4a2e-b6cf-9ae55e135df7-master.m3u8https://nicecrew.tv/videos/embed/2ei51FBKaqABPgy5tJcC83729002024-04-03T00:23:23.201ZStranger ThingsStranger Things Season 4MaxVecnaNetflixYESRadix Verum ☦NOhttps://nicecrew.tv/w/mpVu5xVXqz1ytTAmscmAQohttps://nicecrew.tv/lazy-static/thumbnails/c8f822ea-36fa-45a5-b14a-b4bc4c7877d9.jpgDid the FBI Disappear a Journalist? What Happened to James Gordon Meek? @ABCNews @rollingstoneWhat happened to @ABCNews Emmy-winning producer and journalist James Gordon Meek? @rollingstone reports on the heavy-handed, militarized raid of James Gordon Meek at his Arlington, Virginia residence by the FBI. Meek has not been seen or heard from since the pre-dawn raid on April 27, 2022. All Court records related to the "investigation" and raid on Meeks are sealed. "AT A MINUTE before 5 a.m. on April 27, ABC News’ James Gordon Meek fired off a tweet with a single word: “FACTS.” The network’s national-security investigative producer was responding to former CIA agent Marc Polymeropoulos’ take that the Ukrainian military — with assistance from the U.S. — was thriving against Russian forces. Polymeropoulos’ tweet — filled with acronyms indecipherable to the layperson, like “TTPs,” “UW,” and “EW” — was itself a reply to a missive from Washington Post Pentagon reporter Dan Lamothe, who noted the wealth of information the U.S. military had gathered about Russian ops by observing their combat strategy in real-time. The interchange illustrated the interplay between the national-security community and those who cover it. And no one straddled both worlds quite like Meek, an Emmy-winning deep-dive journalist who also was a former senior counterterrorism adviser and investigator for the House Homeland Security Committee. The first thing Meek’s neighbor John Antonelli noticed that morning was the black utility vehicle with blacked-out windows blocking traffic in both directions on Columbia Pike. It was just before dawn on that brisk April day, and self-described police-vehicle historian Antonelli was about to grab a coffee at a Starbucks before embarking on his daily three-mile walk. He inched closer to get a better vantage, when he saw an olive-green Lenco BearCat G2, an armored tactical vehicle often employed by the Federal Bureau of Investigation, among other law-enforcement agencies." Sources: https://www.rollingstone.com/politics/politics-features/fbi-raid-abc-ne...https://nicecrew.tv/static/streaming-playlists/hls/a54dd735-ca00-4b9f-8e5f-77996af499ce/8073a1e5-1d54-46a5-9784-7f97fb0a0f44-master.m3u8https://nicecrew.tv/videos/embed/mpVu5xVXqz1ytTAmscmAQo1696012024-04-03T00:25:40.445ZJames Gordon MeekABC NewsHuluSimon & SchusterafghanistanYESRadix Verum ☦NOhttps://nicecrew.tv/w/fk8KVnykoFKNpnp7U74uDQhttps://nicecrew.tv/lazy-static/thumbnails/8c567f4b-65c9-4138-bd1c-bb8261cde138.jpg"It's Frustrating!" Prosecutor Breaks Down on Day 14 of Darrell Brooks Trial - Waukesha AttackWe are on day 14 in the WI. vs Darrell Brooks Waukesha Parade Attack Trial and even DA Susan Opper has had enough of Mr. Brooks' disruptive behavior in the Court. State of Wisconsin vs Darrell Brooks - Waukesha Christmas Parade Terror Attack. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/channel/radix-verum Thanks for watching my content friends! #darrellbrooks #waukeshaparade #waukesha #trial #court #susanopperhttps://nicecrew.tv/static/streaming-playlists/hls/740bda7b-2a21-4580-a94c-e418768bdbda/a5a14a35-562b-408f-8d9a-0d5282d2e57a-master.m3u8https://nicecrew.tv/videos/embed/fk8KVnykoFKNpnp7U74uDQ843002024-04-03T00:24:44.195ZDarrell BrooksWaukeshaChristmas ParadeParade AttackTerror AttackYESRadix Verum ☦NOhttps://nicecrew.tv/w/dfTmLRMZpXVLgNHZNVemMChttps://nicecrew.tv/lazy-static/thumbnails/1a99bd16-7eec-404b-a91d-e060cb126cf2.jpg"Is the State of Wisconsin in the Room?" Darrell Brooks Argumentative on Day 14 of Waukesha TrialOn day 14 of the WI. vs Darrell Brooks, the Waukesha Christmas Parade Attack Trial Mr. Brooks continues his argumentative and disruptive behavior. State of Wisconsin vs Darrell Brooks Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/channel/radix-verum Thanks for watching my content friends! #darrellbrooks #waukeshaparade #waukesha #trial #court #crimehttps://nicecrew.tv/static/streaming-playlists/hls/6341ba2f-cfc6-4976-ba04-5cc895ec2afe/a974eef5-69db-4210-b350-e44af60e8a9b-master.m3u8https://nicecrew.tv/videos/embed/dfTmLRMZpXVLgNHZNVemMC217002024-04-03T00:23:29.894Zdarrell brookswaukeshawaukesha paradechristmas paradeparade attackYESRadix Verum ☦NOhttps://nicecrew.tv/w/fAZHbtxCzv2XrmnoQrD2rAhttps://nicecrew.tv/lazy-static/thumbnails/153acfeb-0fe9-4131-baa8-d39feb367e4d.jpg@LegalMindset Targeted by @YouTube Given 7-Day Strike!Our friend Andrew from the @LegalMindset channel has been targeted by YouTube and given a 7-day strike on his channel. Andrew is a lawyer, and it seems that a certain group of lawyer content creators are being unfairly targeted and censored. This is the 3rd lawyer in recent weeks who has faced some type of censorship on the platform. Andrews links: https://legalmindset.locals.com https://rumble.com/user/LegalMindset https://twitter.com/TheLegalMindset/status/1583613821243228161 https://twitter.com/TheLegalMindset/status/1583230725926813696 https://www.youtube.com/c/LegalMindset Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/channel/radix-verum Thanks for watching my content friends! #legalmindset #youtube #censorship #contentcreator #lawtube #lawyerhttps://nicecrew.tv/static/streaming-playlists/hls/7642cb62-dec6-4632-b129-080fe56e4748/cc88c285-5cd8-41c0-88fb-d272921b3ba6-master.m3u8https://nicecrew.tv/videos/embed/fAZHbtxCzv2XrmnoQrD2rA742012024-04-03T00:25:18.393Zandrew esquirethe legal mindsetlegal mindsetlawtubelawyerYESRadix Verum ☦NOhttps://nicecrew.tv/w/16qKVz2BpFMbSL2XzeBERDhttps://nicecrew.tv/lazy-static/thumbnails/f3f30fd7-13a0-41f1-96e9-446b3d8dedd8.jpgThese Lawyers are Being TargetedThe recent #youtube targeting of three lawyers is very concerning. @LegalMindset @RekietaLaw and @RobertGouveiaEsq all received either strikes or in Mr. Rekieta's case - the total takedown of his channel. Rekieta Law was then abruptly reinstated without explanation. The claims of TOS and/or CG violations are unclear and vague. They are also arbitrarily applied. They are also constantly changing, so videos from years ago that were fine can suddenly be flagged and there is no way to know how things will change in the future. YouTube needs to change this. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/channel/radix-verum Thanks for watching my content friends! #legalmindset #rekietalaw #robertgouveia #lawtube #youtube #commentary #legal #law #lawyer #censorshiphttps://nicecrew.tv/static/streaming-playlists/hls/00c1f9e0-68d2-4765-ab44-53a85252c7bf/8179cda7-17ec-45dd-b79c-b47cbcd21ea8-master.m3u8https://nicecrew.tv/videos/embed/16qKVz2BpFMbSL2XzeBERD791002024-04-03T00:25:42.936ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/beMmktrKC3LpSW4WMMEaSshttps://nicecrew.tv/lazy-static/thumbnails/9b4ccd4c-c872-49f8-9391-6ba333862278.jpgAdvice from @RekietaLaw and @LegalMindset on How to Handle Deplatformingadvice from Rekieta and Legal Mindset on how to handle a deplatforming. #lawtube #rekietalaw #legalmindset #lawyerhttps://nicecrew.tv/static/streaming-playlists/hls/52e80100-e9f7-4f60-b2fa-7774f57bd392/37bf3c9a-73cb-4a1a-a420-8f3e1b6094ef-master.m3u8https://nicecrew.tv/videos/embed/beMmktrKC3LpSW4WMMEaSs181002024-04-03T00:25:15.630ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/42Ke79DuhSWZTVVcWhkAf1https://nicecrew.tv/lazy-static/thumbnails/15da26a5-e87c-4215-b8bf-f70e8d91470e.jpgDarrell Brooks Erects #FortGrounz In Last Ditch Effort to Escape!WI vs Darrell Brooks Darrell Brooks starts stacking boxes in front of himself trying to hide and throwing a tantrum. his courtroom antics have been completely out of control! #darrellbrooks #waukesha #Grounz #Fort #ForrGrounz #lawtube #trialhttps://nicecrew.tv/static/streaming-playlists/hls/1889cc77-776b-4034-a0f0-e828a4a19bec/c22a6ffb-3af2-490a-a13a-0fcaab0ef31b-master.m3u8https://nicecrew.tv/videos/embed/42Ke79DuhSWZTVVcWhkAf160002024-04-03T00:25:14.661ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/1kkrG8JPUSmNtjHnDSDQ81https://nicecrew.tv/lazy-static/thumbnails/13c20507-f919-4e6c-8422-d88978aab785.jpgDarrell Brooks Meltdown & Box FortOn Day 16 in the WI vs Darrell Brooks Case, Brooks once again had a meltdown. Due to his refusal to cooperate and behave he was denied the ability to testify or call his mother. He was removed from the courtroom and had to be muted numerous times for outbursts and disruptive behavior. He then decided to build a box fort, which we are calling Fort Grounz. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum https://shing.tv/channel/radix-verum Thanks for watching my content friends! #darrellbrooks #waukesha #waukeshaparade #trial #court #lawtube #meltdown #tantrumhttps://nicecrew.tv/static/streaming-playlists/hls/02b31d20-dde7-4567-986d-1f8c876bc71e/a49d8051-a15c-4886-8d56-ace22f1d1716-master.m3u8https://nicecrew.tv/videos/embed/1kkrG8JPUSmNtjHnDSDQ81370002024-04-03T00:25:47.383Zdarrell brookswaukeshawaukesha paradechristmasparade attackYESRadix Verum ☦NOhttps://nicecrew.tv/w/oevZ5PgYzJ1YrGNHBGMwdThttps://nicecrew.tv/lazy-static/thumbnails/8ea64a9a-c66c-4fc0-a448-6128d6868d9c.jpg@LegalMindset Drops by to Support Your Girl!thanks Andrew, you know I adore you.https://nicecrew.tv/static/streaming-playlists/hls/b40c32ac-6af1-4b51-9dd8-22e39b1b5acb/4b3251eb-b6c1-457c-b46c-9c0485308aef-master.m3u8https://nicecrew.tv/videos/embed/oevZ5PgYzJ1YrGNHBGMwdT77002024-04-03T00:25:16.829ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/b9PkGjmJNDHBfLGkbYvGNEhttps://nicecrew.tv/lazy-static/thumbnails/69e5bb27-fda5-4610-b174-52fa478bd921.jpgThe Moment Darrell Brooks was Found GUILTYA jury has convicted a Wisconsin man of killing six people and injuring dozens of others when he drove his SUV into a Christmas parade last year. Darrell Brooks was found guilty Wednesday of all 76 charges, including six counts of first-degree intentional homicide. He drove into the parade in Waukesha on Nov. 21 after fleeing a domestic disturbance with an ex-girlfriend. Dozens of other people were hurt. Brooks dismissed his public defenders days before his trial began in early October and defended himself throughout the proceedings. He was removed from the courtroom at times for his erratic outbursts and confrontational exchanges with the judge. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum Thanks for watching my content friends! #darrellbrooks #waukesha #waukeshaparade #parade #attack #trial #verdict #guilty #court #law #crime #truecrime #narcissism #narcissisthttps://nicecrew.tv/static/streaming-playlists/hls/523682c4-3fe6-47f9-901d-178c8b1b993a/f8bf69ac-4d9d-44e3-8376-62c4836e0f26-master.m3u8https://nicecrew.tv/videos/embed/b9PkGjmJNDHBfLGkbYvGNE405002024-04-03T00:25:49.945ZDarrell BrooksWaukeshaWaukesha ParadeChristmas ParadeParade AttackYESRadix Verum ☦NOhttps://nicecrew.tv/w/nKTgZ9rAqDDKcmiN8MuXBuhttps://nicecrew.tv/lazy-static/thumbnails/c67f8476-7261-49a8-a2c3-73335221b875.jpgDarrell Brooks Closing Arguments: A Masterclass in GASLIGHTINGDarrell Brooks was found guilty in the November 21, 2021, Waukesha Christmas parade attack. He used his SUV to blow into innocent people for four blocks and never once got out to check on anyone. He displays all the hallmarks of a narcissist and his closing arguments in the trial are a masterclass on gaslighting and emotional manipulation. Brooks has no remorse, and he refuses to take accountability for his actions. He instead proclaims himself to be the victim. He ignores and invalidates the suffering of the family members of his victims. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 https://nicecrew.digital/@RadixVerum Thanks for watching my content friends! #darrellbrooks #waukesha #waukeshaparade #christmas #attack #narcissism #narcissist #gaslighting #emotionalabuse #manipulation #trial #court #closingarguments #crime #truecrime #psychologyhttps://nicecrew.tv/static/streaming-playlists/hls/b0307e62-3497-4c3a-8180-587ca9b5c256/9834b6d8-d207-4865-8dd1-9e18367642f2-master.m3u8https://nicecrew.tv/videos/embed/nKTgZ9rAqDDKcmiN8MuXBu4650562024-04-03T00:31:30.647Zdarrell brookswaukeshawaukesha paradechristmas paradeparade attackYESRadix Verum ☦NOhttps://nicecrew.tv/w/wVx2N15LzcGQjW9j7fg2Kchttps://nicecrew.tv/lazy-static/thumbnails/0fe09d18-bdc6-4ee0-9956-8b75113e3551.jpgMr. Legal Bytes Wants to FIGHT @RekietaLaw & The Problem with ALL Online CommunitiesI wanted to talk about the latest drama between Snakes Bytes, @LegalMindset and Mr. Rekieta. I think that this can be used as an example to highlight the toxic nature of almost all online "communities." They all seem to end up becoming too insular which leads to pettiness, entitlement, and of course, the struggle sessions to try to police other people and demand they get in line. Legal Bytes and her husband demanded a struggle session with Andrew and during said zoom struggle session Mr. Legal Bytes said he wanted to physically fight Nick Rekieta. It's childish and uncalled for and it is toxic and destructive. Infighting accomplishes nothing, and it helps no one. Sources: https://youtu.be/HkW-C6rSC5o https://youtu.be/35Lwp151_Lk https://rumble.com/v1onhck-addressing-new-lawtube-drama-i-hate-the-darrell-brooks-trial-when-did-jp-se.html https://rekietalaw.locals.com/upost/2952960/late-night-locals-livestream https://legalmindset.locals.com @elissaclips @LawNerdClips @MigtownPodcast Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://odysee.com/@RadixVerum:4 Thanks for watching my content friends! #legalbytes #rekietalaw #legalmindset #relationships #lawtube #commentary #contentcreators #youtube #narcissismhttps://nicecrew.tv/static/streaming-playlists/hls/fa6bb3fd-c798-477b-98e4-9a9accb15665/d0d733bd-1fee-45a0-bb88-176fbc98f42e-master.m3u8https://nicecrew.tv/videos/embed/wVx2N15LzcGQjW9j7fg2Kc4000522024-04-03T00:30:53.583ZNick RekietaRekieta LawLegal BytesSnake BytesLegal MindsetYESRadix Verum ☦NOhttps://nicecrew.tv/w/vLgGDSS3sTFpjBt8eXPbpwhttps://nicecrew.tv/lazy-static/thumbnails/a765993d-5f09-4232-b422-c7c65831c2af.jpgMy Mother was Arrested.My mother was arrested for vandalism, and she has a court date coming up where she will probably have to go to AA and pay to repair the property damage. Just wanted to talk about it and my thoughts and feelings on it. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://odysee.com/@RadixVerum:4 Thanks for watching my content friends! #relationships #family #arrest #arrested #narcissism #toxicrelationships #mother #abuse #mentalillnesshttps://nicecrew.tv/static/streaming-playlists/hls/f1076c4d-251f-4169-9940-51e86e57bfe4/9be9415b-6d58-421a-a985-ee6ab4a4a4af-master.m3u8https://nicecrew.tv/videos/embed/vLgGDSS3sTFpjBt8eXPbpw13895192024-04-03T00:26:43.587ZmotherarrestedarresttoxicrelationshipsYESRadix Verum ☦NOhttps://nicecrew.tv/w/7q33kBmLgGhbTaLY5anJkJhttps://nicecrew.tv/lazy-static/thumbnails/1a93fa1a-97d2-47aa-8f31-e86471a4abcd.jpg"Everything is Racist!" @natalielawyerchick vs BASED BRANCA @LawofselfdefenseBy request, I give my thoughts and comments on the Natalie Lawyer Chick vs Andrew Branca spat. I would love to know your thoughts as well! @Lawofselfdefense @RekietaLaw @MigtownPodcast @LawNerdClips @elissaclips @DivinitySaid Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 Thanks for watching my content friends! #KimPotter #Lawtube #nickrekieta #rekietalaw #lawofselfdefense #branca #Law #crime #legal #review #commentary #truecrime #useofforce #prejudicehttps://nicecrew.tv/static/streaming-playlists/hls/33f1f098-7eac-4f77-940a-029c5ea108b8/fc969e8e-850b-4206-9cdb-689ecef506c9-master.m3u8https://nicecrew.tv/videos/embed/7q33kBmLgGhbTaLY5anJkJ2541572024-04-03T00:29:34.762Zandrew brancalaw of self defenseuse of forcenatalie lawyer chicklawtubeYESRadix Verum ☦NOhttps://nicecrew.tv/w/ec3RqEWasg2o1n69Pdm4DXhttps://nicecrew.tv/lazy-static/thumbnails/a0864039-9680-415d-8107-a7f3cce7fa40.jpgCourtney Clenney & The Demonic Modern FemaleToday we are going to talk about Onlyfans Model Courtney Clenney who is accused of murdering her boyfriend Christian Obumseli. Trial begins December 19th in Miami, Florida. The slain boyfriend of Miami social media star Courtney Clenney accused her of horrific physical and verbal abuse weeks before she stabbed him to death, explosive new texts reveal. "Is love going to kill me?" Christian Obumseli wrote in a haunting Feb. 28 message to Clenney, telling her he feels "stupid" for staying with her after she cheated on him and allegedly slashed him in the face. Sources: https://www.foxnews.com/us/onlyfans-model-courtney-clenney-may-have-slashed-beau-face-weeks-killing https://www.courttv.com/title/onlyfans-model-murder-case-courtney-clenney-secret-recordings-released/ https://www.tmz.com/2022/10/19/onlyfans-model-courtney-clenney-boyfriend-cant-feel-arm-final-moment-911-call-christian-obumseli/ https://www.rollingstone.com/culture/culture-news/courtney-clenney-onlyfans-model-murder-case-videos-abuse-1234623874/ https://nypost.com/2022/11/03/texts-reveal-onlyfans-courtney-clenney-previously-stabbed-boyfriend/ Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 Thanks for watching my content friends! #courtneyclenney #christianobumseli #onlyfans #crime #truecrime #modernwomen #relationships #dating #narcissism #abuse #toxicrelationships #trial #legal #law #lawtube #instagram #models #giselebundchen #tombrady #willsmith #jadapinkettsmith #kimkardashian #kanyewest #jeffbezos #redpill #mgtow #marriagehttps://nicecrew.tv/static/streaming-playlists/hls/6ad1bde3-c698-44f9-9b81-650b3dbb1bc5/abadf0a0-45d0-4a1c-ad39-ab125e7c4b33-master.m3u8https://nicecrew.tv/videos/embed/ec3RqEWasg2o1n69Pdm4DX2095052024-04-03T00:28:02.848ZCourtney ClenneyOnlyFansChristian ObumselimurderhomicideYESRadix Verum ☦NOhttps://nicecrew.tv/w/iYhSXDXd2dToaLv4PGBvFChttps://nicecrew.tv/lazy-static/thumbnails/6e17fec6-f02e-4997-a8e0-3b802c5a8bc6.jpgAaron Carter Dead After Trying to Reach out to @kanyewestAaron Carter, a former child pop singer and younger brother of Backstreet Boys’ Nick Carter, has died, a source close to the family told CNN. He was 34. He was found dead in his bathtub, the source said. Authorities gave no information about a possible cause of death. He last tweeted on November 3rd, trying to get in contact with Kayne West. He had a history of alleged mental illness and substance abuse problems. Sources: https://www.cnn.com/2022/11/05/entertainment/aaron-carter-obit/index.html https://www.musicinminnesota.com/aaron-carter/ https://twitter.com/aaroncarter/status/1588372352772976640?t=JMenxr1ALdSKqxkjGn_ckA&s=19 https://twitter.com/ThePerezHilton/status/1370177414945406978?t=Xbhs6BYP53BMSlz1HjfwMg&s=19 https://twitter.com/defilinski/status/1370170740037857286?t=h51gssS0SWELV-obwf74wA&s=19 https://www.the-sun.com/entertainment/1424054/aaron-carter-porn-debut-live-audience-fiancee-debut/ https://starbiz.com/hollywood/aaron-carter-slaps-back-nick-carter-says-he-sexually-abused-him-the-whole-life-10171 Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://Radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 Thanks for watching my content friends! #Aaroncarter #kaynewest #childstars #disneychannel #hollywood #musicindustry #music #nickcarter #backstreetboys #celebrity #mentalillness #substanceabuse #entertainmentindustryhttps://nicecrew.tv/static/streaming-playlists/hls/918768ff-e5d1-48ca-8f74-6df9361c45a6/9f6406d4-a53d-4f55-9add-c2a8eb43c94b-master.m3u8https://nicecrew.tv/videos/embed/iYhSXDXd2dToaLv4PGBvFC938042024-04-03T00:26:11.641Zaaron carterkanye westnick carterbackstreet boyshollywoodYESRadix Verum ☦NOhttps://nicecrew.tv/w/692gkizTamCi42QqAeQ4AWhttps://nicecrew.tv/lazy-static/thumbnails/d4eaf559-312f-4778-a705-2eea830028bb.jpgCrazy Story Time & Lessons About "Friends"I wanted to talk more about my crazy childhood stories and things that happened when I was homeless as a teenager. It helps to illustrate a point about friendships: it is when you are at your lowest and most vulnerable that you learn who your real friends are. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://gab.com/DiggingDeeper https://odysee.com/@RadixVerum:4 Thanks for watching my content friends! #relationships #relationshipadvice #friends #friendship #dating #lifelessons #lessonshttps://nicecrew.tv/static/streaming-playlists/hls/299c6c32-b5bc-4f8a-bb95-a0f7d3bc40e6/d9741628-f53c-485f-9781-6ff037c0b38c-master.m3u8https://nicecrew.tv/videos/embed/692gkizTamCi42QqAeQ4AW1816012024-04-03T00:27:21.295Zrelationshipsrelationship advicefriendsfriendshiplife lessonsYESRadix Verum ☦NOhttps://nicecrew.tv/w/wVc6udovgD1nixBdFHPwjthttps://nicecrew.tv/lazy-static/thumbnails/f23b5152-e997-4f74-8dc0-de64167c2f7d.jpgFTX SCAM EXPOSED! Who is Sam Bankman-Fried & Who Was Backing Him?FTX was founded in 2019 as a crypto exchange and was heavily promoted by many YouTubers and influencers, like @GrahamStephan and others. FTX provided paid sponsorships, seeing your favorite YouTuber who you trust promote something encouraged many people to get involved and invest. Now, these people are losing their money. The company has now filed for bankruptcy and billions in client funds are missing. A reported "hack" has occurred which many believe was actually an inside job. Sam Bankman-Fried had a "backdoor" built into the accounting software that allowed him to move billions without triggering alerts to staff and auditors, etc. "On Friday, Mr. Bankman-Fried resigned as chief executive. The bankruptcy put an end to his frantic efforts to find suitors to save FTX—an ironic twist given that FTX itself bailed out ailing crypto firms earlier this year. And after previously criticizing bad actors in crypto, Mr. Bankman-Fried is himself facing federal probes. He has described the decision to use customer funds as a poor judgment call, according to someone close to the matter." Sources: https://twitter.com/gencostocks/status/1591152036766445568 https://twitter.com/revelation17_14/status/1591459517271011333 https://twitter.com/AshaLogos/status/1591356611003842560 https://twitter.com/WallStreetSilv/status/1591438396588974082 https://twitter.com/BTC_Archive/status/1591365581550551043 https://twitter.com/WatcherGuru/status/1591145672085946368 https://twitter.com/VivekGRamaswamy/status/1591426542030442497 https://twitter.com/SullyCNBC/status/1591132398497845248 https://fortune.com/2022/11/10/sam-bankman-fried-ftx-joe-biden-democratic-party-second-biggest-donor/ https://www.reuters.com/markets/currencies/exclusive-least-1-billion-client-funds-missing-failed-crypto-firm-ftx-sources-2022-11-12/ https://twitter.com/AutismCapital/status/1591273265154392066 https://twitter.com/fintechfrank/status/1591457281442729987 https://twitter.com/LibertyBlitz/status/15914182511329...https://nicecrew.tv/static/streaming-playlists/hls/fa5f6ab9-b2dd-42e4-b1bc-16c7b707762f/f55e856d-1f9f-429e-b6e4-58b62b5ae648-master.m3u8https://nicecrew.tv/videos/embed/wVc6udovgD1nixBdFHPwjt1798022024-04-03T00:27:29.617ZFTXFTX exchangecryptocrypto exchangesam bankman-friedYESRadix Verum ☦NOhttps://nicecrew.tv/w/gCMteVHWS9tpqcyHnEXXM7https://nicecrew.tv/lazy-static/thumbnails/94e8a769-1a1c-4de7-a5d3-bac930bba668.jpgMy Latest VideoPlease check out my most recent video on my backup channel about #Tether and the next Crypto Collapse: Link to Video: https://youtu.be/mtuJPJdMGrg Please subscribe to my backup channel also friends! Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #tether #ftx #crypto #collapse #finance #investing #blockchain #bitcoin #blockfi #binancehttps://nicecrew.tv/static/streaming-playlists/hls/7e9be096-2eca-49f7-b12f-6ca67e77314c/12d6774c-dd1c-4631-bcb0-06fed9c0b9e2-master.m3u8https://nicecrew.tv/videos/embed/gCMteVHWS9tpqcyHnEXXM746002024-04-03T00:25:47.607ZtethercryptocollapseftxLUNAYESRadix Verum ☦NOhttps://nicecrew.tv/w/rycDKS8h55msepvdqf9Vinhttps://nicecrew.tv/lazy-static/thumbnails/0d48a4dd-3678-4d69-bd09-7a80688aaa3e.jpgFinance YouTubers EXPOSED: FTX Scammers Could Face Lawsuits!In this video we look at personal finance gurus and finance youtubers who promoted scams like FTX. We look at @TomNashTV @AndreiJikh @GrahamStephan @FinancialEducation @MeetKevin and @MinorityMindset and we expose them. Their apologies are not enough. They all claim to be "transparent," but they were greedy more than anything else. Some of these guys pushed penny stocks and things like Palantir and Voyager Digital. The Millennial Money channel was wiped recently because they know their audience is upset. The @millennialmoneyclips9633 channel still exists for now. A lot of them seem to be represented by the same "agenct" called Creator Agency and it appears that they might be getting scripts to read from. They all talk like used car salesmen as well. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #finance #personalfinance #youtube #contentcreators #guru #tomnash #andreijikh #grahamstephan #millennialmoney #meetkevin #financialeducation #minoritymindset #FTX #crypto #bitcoin #blockfi #blockchain #investing #portfolio #stocks #markets #scams #exposedhttps://nicecrew.tv/static/streaming-playlists/hls/cef37282-99df-43a7-aa09-2f67f372d803/ce107cc7-6d52-4577-923c-adbb88310778-master.m3u8https://nicecrew.tv/videos/embed/rycDKS8h55msepvdqf9Vin2591502024-04-03T00:29:47.564ZGraham StephanAndrei JihkMeet KevinJeremyFinancial EducationYESRadix Verum ☦NOhttps://nicecrew.tv/w/dkE9KKRb2oQpCT4pvhaeWihttps://nicecrew.tv/lazy-static/thumbnails/82248f73-6a1f-4cc1-b001-cd1941174db7.jpgMullet Man vs Darrell Brooks: Tyler PutlinerWisconsin vs Darrell Brooks: Sentencing and Victim Impact Statements, Day One. Victim Tyler Putlliner, aka Mullet Man, confronts the coward, Darrell Brooks. This young man is a hero. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #MulletMan #darrellbrooks #waukesha #waukeshaparade #christmasparade #paradeattack #trial #court #law #lawtube #TylerPutlinerhttps://nicecrew.tv/static/streaming-playlists/hls/63ec4e91-0e78-41e8-b445-79aeba844ce9/98eea15c-30ee-47eb-b175-b7287edba160-master.m3u8https://nicecrew.tv/videos/embed/dkE9KKRb2oQpCT4pvhaeWi539012024-04-03T00:26:02.437ZWisconsin vs Darrell BrooksDarrell BrooksDarrell Brooks sentencingvictim impact statementstyler putlinerYESRadix Verum ☦NOhttps://nicecrew.tv/w/kzJ99JKFFuPyuXELibjtmJhttps://nicecrew.tv/lazy-static/thumbnails/13541ac5-93f0-4085-b516-1577ec99182f.jpgMarine Chris Owen Slams "Child Killer Sex Offender" Darrell BrooksThe son of Waukesha terror attack victim and dancing grandma Leanna Joy Owen, Marine Chris Owen reads his victim impact statement and tears into Darrell Brooks for killing his mother. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #waukeshaparade #darrellbrooks #waukesha #wisconsin #trial #court #law #legal #lawtubehttps://nicecrew.tv/static/streaming-playlists/hls/9e932623-1967-492c-8e83-fb4d2719598e/c40d16bb-d9da-49ff-b447-1cd1e7651cbb-master.m3u8https://nicecrew.tv/videos/embed/kzJ99JKFFuPyuXELibjtmJ474522024-04-03T00:26:39.247Zdarrell brookswaukeshawaukesha paradeparade attackleanna joy owenYESRadix Verum ☦NOhttps://nicecrew.tv/w/gFKyzUj84M5zZe5Tq7pxoGhttps://nicecrew.tv/lazy-static/thumbnails/dfb0b0a2-50d8-4ced-a6d3-847a5bb3412c.jpgModern Women are NEVER Satisfied: Gisele Replaces Tom Brady, Neil Gaiman's "Open Marriage" FAILSModern women are never satisfied. It seems they are always single, even if they are married. Just after the announcement of the divorce between Gisele Bundchen and Tom Brady, Gisele is being photographed with Joaquim Valente who she is vacationing with in Costa Rica - a place she and Brady used to visit. It seems very cruel and spiteful. Famous author Neil Gaiman, of the hit series The Sandman and American Gods, has announced his divorce with wife Amanda Palmer after their 11-year open marriage fell apart. The former couple share a son together. Sources: https://twitter.com/AshaLogos/status/1591937173913489408 https://pagesix.com/2022/11/14/gisele-with-joaquim-valente-shows-tom-what-hes-missing/ https://twitter.com/iam_johnw/status/1590909304387022853 https://twitter.com/Dominiquetaegon/status/1590706683093094404 https://twitter.com/eliornmask/status/1569397341471260672 https://www.dailymail.co.uk/news/article-11399799/Neil-Gaiman-Amanda-Palmer-announce-divorcing-open-marriage-broke-down.html Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #modernwomen #dating #relationships #relationshipadvice #giselebundchen #tombrady #joaquimvalente #neilgaiman #amandapalmer #redpill #blackpill #mgtow #marriage #feminism #FrancescoTottihttps://nicecrew.tv/static/streaming-playlists/hls/7f05eece-e01c-469c-ae19-46aad956ff38/82817bdf-f75b-4208-8d95-85fb75ea9d6d-master.m3u8https://nicecrew.tv/videos/embed/gFKyzUj84M5zZe5Tq7pxoG1391082024-04-03T00:27:38.477Zmodern womenGisele BundchenTom BradyJoaquim ValenteNeil GaimanYESRadix Verum ☦NOhttps://nicecrew.tv/w/gUTgtpYny7B6yzXDR7d3G3https://nicecrew.tv/lazy-static/thumbnails/ceda1616-bfe8-4e83-a5fb-1c04d3eb8d35.jpgIdaho College Murders Eerily Reminiscent of Ted Bundy Chi Omega MurdersIn the early hours of Nov. 13, four University of Idaho students were brutally stabbed to death in their off-campus home. Nine days later, no arrests have been made, no suspect has been identified, and any motive remains unknown. Police have released few details about the investigation — frustrating the families of the victims, as well as leaving students at the university and residents of the small town of Moscow unsure if they’re safe. The victims are: Kaylee Goncalves, Madison “Maddie” Mogen, Xana Kernodle, and her boyfriend Ethan Chapin. The cause and manner of death for each victim was homicide by stabbing, according to an initial autopsy report. All four victims were stabbed while sleeping in their beds, police said. Police believe the killer used a fixed-blade knife; one shopkeeper who was questioned by police referred to it as a “Rambo”-style military-grade knife. Police have not found the weapon. Each person was stabbed multiple times, police said, and the fatal wounds were in “the chest area or the upper body area," the coroner said. They likely died between 3 a.m. and 4 a.m., according to Moscow’s mayor, Art Bettge. From the outset, police have called it a “targeted attack”; however, they dialed back initial comments that there was “no imminent threat to the community at large.” In a news conference Nov. 16, Police Chief James Fry acknowledged that “there’s still a person out there who committed four horrible, horrible crimes” and that “there is a threat out there still, possibly.” He encouraged residents to be vigilant and to “watch out for each other.” Uniformed troopers from the Idaho State Police have been brought in to assist local police in patrolling the city and university campus. The murders seem eerily reminiscent of the Ted Bundy FSU Chi Omega House murders. Sources: https://www.thebreeze949.com/syndicated-article/?id=1464343 https://www.theguardian.com/us-news/2022/nov/21/university-idaho-killings-moscow-unsolved https://www.cbsnews....https://nicecrew.tv/static/streaming-playlists/hls/80db59a7-4fdf-425f-93a1-dadce3caa4fa/aa8746a2-5e23-4b93-97f6-9aff591358fe-master.m3u8https://nicecrew.tv/videos/embed/gUTgtpYny7B6yzXDR7d3G31248002024-04-03T00:27:43.159ZIdahoIdaho College MurdersUniversity of Idaho murderscollege murderstrue crimeYESRadix Verum ☦NOhttps://nicecrew.tv/w/n7gBMcKcFZhfbLNXqfVboPhttps://nicecrew.tv/lazy-static/thumbnails/3b186480-77c4-446c-9fad-45c9882871cd.jpgBuffalo Mass Shooter Groomed by Federal Agent Pleads GuiltyPayton Gendron pleaded guilty Monday to state charges stemming from the May shooting at a Tops supermarket in Buffalo. Gendron pleaded guilty to 15 charges in all, including domestic terrorism motivated by hate, murder, and attempted murder. He still faces more than two dozen federal charges, some of which carry the possibility of the death penalty. His sentencing is scheduled for Feb. 15, 2023. Domestic terrorism motivated by hate carries a mandatory life sentence. Payton Gendron was groomed by a "retired," federal agent in a discord server where he may have also been communicating with FBI informants. Here is my prior video on Payton: https://youtu.be/HCnfDVRzulc Sources: https://abcnews.go.com/US/buffalo-supermarket-shooting-suspect-expected-plead-guilty-court/story?id=94084794 https://www.foxnews.com/us/buffalo-shooting-federal-agent-knew-shooters-plans-investigation https://www.wsj.com/articles/accused-buffalo-shooter-was-released-deemed-not-a-danger-in-mental-health-evaluation-last-year-11652960576 Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #Buffalo #Discord #Grooming #PaytonGendron #MassShooter #FBI #TrueCrime #Court #Trial #Tops #Twitchhttps://nicecrew.tv/static/streaming-playlists/hls/aaefffac-989d-4d40-b4cb-68ba7f22c37b/f0b7ba06-5687-4b83-a03d-eb1e06e514c0-master.m3u8https://nicecrew.tv/videos/embed/n7gBMcKcFZhfbLNXqfVboP783532024-04-03T00:26:50.747ZBuffaloBuffalo ShooterMass ShooterMass ShootingTopsYESRadix Verum ☦NOhttps://nicecrew.tv/w/ci6y6RVKTpuWS8Vjv9BFDrhttps://nicecrew.tv/lazy-static/thumbnails/fa5e5390-2fb6-4874-b48c-856ba24b7885.jpgHaha Let's Talk About That Time I Got ArrestedSome people think bringing up my mugshot is an own, it is not. I literally don't care, you don't bother me by bringing up my mugshot from when I was young, poor, and an addict. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #mugshot #arrest #arrested #jailhttps://nicecrew.tv/static/streaming-playlists/hls/5b77977f-e28b-42d3-82b8-18f5ebe3780f/3755f2e9-8120-4e01-b1b2-06b2a45820e6-master.m3u8https://nicecrew.tv/videos/embed/ci6y6RVKTpuWS8Vjv9BFDr699062024-04-03T00:27:34.520ZjailarrestarrestedmugshotYESRadix Verum ☦NOhttps://nicecrew.tv/w/mKak2iYi7AyeUpCF8MUzW9https://nicecrew.tv/lazy-static/thumbnails/c85fec50-33fa-4915-9db0-6a57c95f9bf7.jpgReviewing @WheatWaffles Face Ratings & What Woman Actually Find Attractive About MenI wanted to talk about what women actually find attractive in men. I know that as a woman very rarely am I immediately attracted to a guy, but as I get to know his personality, he becomes hotter to me - I notice things about him like the intensity of his gaze or his smile or his freckles. Mr. Wheat Waffles has been rating faces for men and I want them to know that while looks matter they are certainly not the only thing that matters to women. Anyone can be seduced. Sources: https://youtu.be/Jsj6Qr7Z7o0 Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://libertylinks.io/radixverum Thanks for watching my content friends! #dating #datingadvice #attraction #relationships #men #seduction #smv #beautyhttps://nicecrew.tv/static/streaming-playlists/hls/a7fd80fe-3669-42ac-9e92-64c712b9f1f8/77d83eef-8a26-4465-b354-c02f0fce8223-master.m3u8https://nicecrew.tv/videos/embed/mKak2iYi7AyeUpCF8MUzW91800532024-04-03T00:29:29.461Zdatingdating advicemanosphererelationshipsbeautyYESRadix Verum ☦NOhttps://nicecrew.tv/w/jQtV43AjJddDBCaVxKd9YXhttps://nicecrew.tv/lazy-static/thumbnails/77edcb5f-3c1c-41c0-8ea6-6bdd17b7cdf6.jpgThe Twitter Files: The FBI & DNC Demand Big Tech Censorship to Influence ElectionsThis week we have received documented confirmation of what we all already knew was happening - The DNC and the FBI have been working with big tech companies to censor information and to influence elections. Sources: https://twitter.com/mtaibbi/status/1598822959866683394 https://twitter.com/ggreenwald/status/1599058977198731264 https://twitter.com/Eric_Schmitt/status/1598733187135393793 https://libertytree.com/liberty-tree/3526 https://amgreatness.com/2022/10/10/elvis-chan-cyber-conduit-between-fbi-and-big-tech/ https://dailycaller.com/2022/12/02/fbi-companies-censor-americans/ https://twitter.com/ClimateAudit/status/1578589232972431362 https://twitter.com/HansMahncke/status/1593664087698903040 https://americanactionnews.com/social-media/2022/12/02/breaking-agent-testifies-to-fbi-influencing-2020-u-s-presidential-election/ https://twitter.com/JackPosobiec/status/1599131270453538816 Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com https://libertylinks.io/radixverum My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #Twitter #elonmusk #jackdorsey #censorship #bigtech #socialmedia #fbi #dnc #democrats #dnc #newyorkpost #hunterbiden #laptophttps://nicecrew.tv/static/streaming-playlists/hls/9889665e-c8ad-4ea3-9b45-d814300f0fb7/01ed2e62-9269-4482-8aab-81d60da7f93f-master.m3u8https://nicecrew.tv/videos/embed/jQtV43AjJddDBCaVxKd9YX2350582024-04-03T00:30:03.583Ztwittertwitter filescensorshipelon muskvajaya geddeYESRadix Verum ☦NOhttps://nicecrew.tv/w/i5JNwTry4VRALFNVXRFzwBhttps://nicecrew.tv/lazy-static/thumbnails/ef8ff11a-64e6-43ff-a54a-758eb20344c3.jpgDocumentary Teaser: Brandon Caserta Talks about FBI Agent Richard TraskHere is a sneak peek into the documentary I am working on about the Michigan "Whitmer Kidnapping Plot" Hoax perpetrated by the FBI. Help me fund the documentary! Donate via the donation links below. Support my work!: Venmo: RadixVerum https://Paypal.me/RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! Copyright Digging Deeper, LLC #FBI #Whitmer #Michigan #MichiganPlot #BrandonCasertahttps://nicecrew.tv/static/streaming-playlists/hls/8a54b5cc-1369-47f7-bec8-d559563ea75b/63b1dec5-fbe2-487f-a871-8fa58d9f2b38-master.m3u8https://nicecrew.tv/videos/embed/i5JNwTry4VRALFNVXRFzwB272022024-04-03T00:27:03.071ZGretchen WhitmerFBIEntrapmentDocumentaryBrandon CasertaYESRadix Verum ☦NOhttps://nicecrew.tv/w/xseehP8n9pzmxmE5C5CQv1https://nicecrew.tv/lazy-static/thumbnails/68cbf93e-82ad-413d-a5e7-e057ca6ef95a.jpgRadix Reviews: The Pickup Artist Question by @mr.patriarchI enjoyed the stream by Mr. Patriarch critiquing the PUA's and the redpill community. The guys in the manosphere have some very good points, but they also tend to contradict themselves or lack a certain level of self-awareness, incidentally, the same thing they criticize modern women for... Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #redpill #pua #game #relationships #dating #modernwomen #manosphere #blackpill #moderndating #datingadvice #datingappshttps://nicecrew.tv/static/streaming-playlists/hls/feb4ca0a-9923-40b5-972b-058dc35153b2/ab88f10b-b24b-4f18-b9ea-06c8c549c430-master.m3u8https://nicecrew.tv/videos/embed/xseehP8n9pzmxmE5C5CQv133095302024-04-03T00:30:29.268Zrelationshipspick up artistsPUAgamedatingYESRadix Verum ☦NOhttps://nicecrew.tv/w/mRyMPZgCkpdFMnJ558WuV2https://nicecrew.tv/lazy-static/thumbnails/d75c5313-988b-40b1-b886-832ec747c088.jpgChannel Update!Just checking in with everyone, to let you all know what I am working on and what my plans are here. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #update #mychannel #youtube #plans #documentaryhttps://nicecrew.tv/static/streaming-playlists/hls/a8e26cf1-bbcc-405a-ab88-bdf78523b753/8dcdd5dc-3ab9-42f8-8ccf-8ad8fce8575a-master.m3u8https://nicecrew.tv/videos/embed/mRyMPZgCkpdFMnJ558WuV2509012024-04-03T00:28:12.978ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/ij6ELhiEJ2yDZbpUfMmWCRhttps://nicecrew.tv/lazy-static/thumbnails/79600952-0387-4c0e-bdcb-d5455737d5fd.jpgYou NEED to Pay Attention to This!We go over the sentencing hearing for a recent case that will have dramatic implications for all Americans. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #trial #court #courtcase #legal #lawtube #drama #michiganhttps://nicecrew.tv/static/streaming-playlists/hls/8c323d02-4330-4d89-a119-fedc01254221/e9a9392d-876d-4e58-acf5-2cd2bc748ce9-master.m3u8https://nicecrew.tv/videos/embed/ij6ELhiEJ2yDZbpUfMmWCR2632002024-04-02T16:57:09.324ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/iPEJYvw32xfsDWhSYDYn4Qhttps://nicecrew.tv/lazy-static/thumbnails/10561827-d7d9-4876-ac8b-06d7a8a016e7.jpgDid the FBI Create Their Own Version of the CIA's In-Q-Tel Program?Was Exeintel, a "private intelligence and cyber security," firm created by FBI Special Agent Jayson Chambers actually going to be the FBI's own version of the CIA's venture capital firm InQtel - which is obviously engaged in 5th-generation warfare. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://Radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #twitter #twitterfiles #fbi #cia #inqtel #cybersecurity #privateintelligencehttps://nicecrew.tv/static/streaming-playlists/hls/90533079-e4d0-4522-bf69-29b5abca2c62/044405c5-9a54-4cf7-a6f0-80d01812afc6-master.m3u8https://nicecrew.tv/videos/embed/iPEJYvw32xfsDWhSYDYn4Q678552024-04-03T00:31:52.035Ztwittertwitter filessocial mediasilicon valleyfbiYESRadix Verum ☦NOhttps://nicecrew.tv/w/ggrgmgKkeKFxhHzJ7RGfpqhttps://nicecrew.tv/lazy-static/thumbnails/96f6a242-6cf0-40f6-a648-56a82b93aaf8.jpgYouTube is not a career and it's not sustainable.Just wanted to make a video explaining why YouTube is great as a hobby but it's not a real career and it is fleeting and unsustainable. Nothing is guaranteed and the internet is forever. Internet fame and clout is fleeting and not a substitute for being accomplished and doing something impactful and important. It is incredibly hard to get "big" on YouTube and most people won't make it. There is always someone younger, smarter, or more talented than you that can replace you in the heavily oversaturated cesspool that is YouTube. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #youtube #career #contentcreators #influencershttps://nicecrew.tv/static/streaming-playlists/hls/7ba0ce6c-66bf-457a-8ee8-8c91ec29e356/42717e8c-d20d-4a1a-8405-344c827efce2-master.m3u8https://nicecrew.tv/videos/embed/ggrgmgKkeKFxhHzJ7RGfpq1746572024-04-03T00:31:09.223Zcareersyoutubecontent creationinfluencersfameYESRadix Verum ☦NOhttps://nicecrew.tv/w/9vhf6KCbLvt25u339MV3gwhttps://nicecrew.tv/lazy-static/thumbnails/cdc9408f-cd29-48c0-8562-b3676968922e.jpgCollege Degrees Shouldn't Be NecessaryI saw an interesting article about how many large companies are no longer "requiring" things like four-year degrees and are offering alternatives due to a number of reasons, including an excess of jobs and fewer workers willing to take them. Corporations like Google, IBM, and Delta Airlines are all easing "educational" requirements and looking for hires based on skills and experience. I think this is interesting because I have said for a long time now that college is mostly a scam, and they no longer teach actual critical thinking skills. Source: https://finance.yahoo.com/news/bit-musical-chairs-now-big-130000345.html Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #jobs #economy #college #degree #career #corporations #labormarket #economy #inflation #recession #mentorhttps://nicecrew.tv/static/streaming-playlists/hls/44dfb053-2f73-46b2-920b-8db4ed7dd264/259f8f9b-84ca-4e20-9592-ece7e1b58415-master.m3u8https://nicecrew.tv/videos/embed/9vhf6KCbLvt25u339MV3gw1422002024-04-02T16:57:41.999Zcollege degreeseducationeducational requirementscareersapprenticeshipsYESRadix Verum ☦NOhttps://nicecrew.tv/w/t8ZoFtQ7DjE2XEeFiSj4cqhttps://nicecrew.tv/lazy-static/thumbnails/f8790a9b-ee57-473e-996b-f03160cbf335.jpgA Final Message from Barry CroftA message to the American people from Barry Croft.https://nicecrew.tv/static/streaming-playlists/hls/dbc45196-3c64-4e92-a362-117d10a609d2/f6013b25-fa62-4426-a9f9-fe56cf87848b-master.m3u8https://nicecrew.tv/videos/embed/t8ZoFtQ7DjE2XEeFiSj4cq500002024-04-02T16:57:53.333ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/fYqfwQ9hY1N5nxCLDbVY2Fhttps://nicecrew.tv/lazy-static/thumbnails/6e34d20e-ff1c-4e09-a825-43b173662b86.jpgFinal Message by Man Framed by FBI in Whitmer Kidnapping Hoax Before He is SentencedBarry Croft who was framed by the FBI in their Michigan "Whitmer Kidnapping" Hoax case delivers his final message to the American people before his sentencing tomorrow. Please keep him in your prayers. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/7940898b-beb3-40b3-8837-beb2939efb49/b9cbbde3-788c-4a32-ad1c-881292c3ef30-master.m3u8https://nicecrew.tv/videos/embed/fYqfwQ9hY1N5nxCLDbVY2F453002024-04-02T16:58:04.792ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/5Y2nsXaQiQdZFetvTbhV3rhttps://nicecrew.tv/lazy-static/thumbnails/54dbe3e9-4234-477b-813f-4e62c78ae574.jpgHow to Dominate in Any SituationThis is a video going over the general rules of dominance and how you can dominate in any situation. I can go more in-depth on each point in future videos but here I simply wanted to cover around 60 plus rules of dominance and power as a general overview for people. There is an aspect of dark psychology here, but it is important to understand how the world works so you can operate in it effectively and establish yourself as a superior force. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #power #dominance #domination #darkpsychology #psychology #relationships #humanbehaviour #selfimprovement #discipline rules of dominance how to dominatehttps://nicecrew.tv/static/streaming-playlists/hls/28370cd3-7e36-44ec-a3dc-746131d364c1/598ed722-11c3-49fd-b8bc-4aa02f5146da-master.m3u8https://nicecrew.tv/videos/embed/5Y2nsXaQiQdZFetvTbhV3r513012024-04-02T16:58:12.963Zrules of dominancedominatepowerpower dynamicspsychologyYESRadix Verum ☦NOhttps://nicecrew.tv/w/fHRf9m2pGkKgv2GE6SPc1Thttps://nicecrew.tv/lazy-static/thumbnails/f85d6d7e-7fd5-421b-bdea-e4f78ae155a1.jpgHAPPY NEW YEAR!!I cannot believe we are already in 2023! Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/7737c88e-0220-480a-b119-19038e3edfd7/a54663d9-9fde-4ca6-81a2-c4e245d470e8-master.m3u8https://nicecrew.tv/videos/embed/fHRf9m2pGkKgv2GE6SPc1T175002024-04-02T16:58:21.380ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/fXs3Jn3DbuY2wrtrizff3Ghttps://nicecrew.tv/lazy-static/thumbnails/9fb04247-ecc2-49b4-8f08-5af9d9f262c7.jpgDARPA & DOD Transhumanist, Police State Agenda for 2023Here is the link to the DARPA/DOD 2023 Fiscal Budget with programs and projects that are very disturbing. We are sleepwalking into a globalist, transhumanist, smart grid, smart city nightmare. Source: https://twitter.com/eleevn/status/1609465870371389440 https://www.darpa.mil/attachments/U_RDTE_MJB_DARPA_PB_2023_APR_2022_FINAL.pdf Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #DARPA #DOD #SocialEngineering #smartgadgets #smart #newtechnology #transhumanismhttps://nicecrew.tv/static/streaming-playlists/hls/791de692-597a-4d1f-b5fd-bbc70e2ea634/8f82bcec-bd46-49c7-8211-8aa3280227ff-master.m3u8https://nicecrew.tv/videos/embed/fXs3Jn3DbuY2wrtrizff3G1496002024-04-02T16:58:30.627Zdarpadoddepartment of defensemilitarysocial engineeringYESRadix Verum ☦NOhttps://nicecrew.tv/w/2jUYWc9TBbKJ15H9zo2ZgXhttps://nicecrew.tv/lazy-static/thumbnails/03016a67-63d7-4b7e-8e21-90d41ec9ff11.jpgManipulation Tactics Used by Narcissists, Sociopaths & PsychopathsNarcissists, sociopaths, and psychopaths as well as just regular abusers or crappy people all use manipulation tactics to control, intimidate, and suppress other people. It's important to recognize these tactics, so they lose their power and cannot be used on you. Once you see something and are aware of it, you cannot unsee it. Narcissists and abusers rely on your ignorance and good-hearted nature to deceive and manipulate you. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #narcissist #narcissism #psychology #sociopaths #manipulation #influencehttps://nicecrew.tv/static/streaming-playlists/hls/0abd2d77-b08c-45a6-a32d-df35098f9849/dbbe1001-db2b-438e-97af-ed7bb0dc50d2-master.m3u8https://nicecrew.tv/videos/embed/2jUYWc9TBbKJ15H9zo2ZgX2698002024-04-02T16:58:40.573Znarcissismnarcissistic abusemanipulationpsychologyinfluenceYESRadix Verum ☦NOhttps://nicecrew.tv/w/jV8TiezFCcv4uwNoXY9ofxhttps://nicecrew.tv/lazy-static/thumbnails/e1f48555-ad48-469d-9d87-c4bf4c4eb624.jpgFormer Google CEO Eric Schmidt Helping to Fund Salaries of Biden OfficialsThe former CEO of Google, Inc. Eric Schmidt is helping to find the salaries of numerous Biden officials. Some of these officials have been placed with the goal of focusing on AI and clean energy — two areas where Schmidt has investments. Schmidt Futures and other organizations help to pay the salaries of these officials by providing funding to a “Talent Hub” which is part of a FAS “Day One Project.” This Day One Project runs a FAS “Impact Fellowship” program that places “Impact Fellows” in influential government posts. Not only has Schmidt Futures contributed to FAS but Schmidt has considerable ties to top FAS leadership and one of the Impact Fellows who was placed in a federal government role was also listed as an adviser to Schmidt Futures. Source: https://reclaimthenet.org/eric-schmidt-biden-official-salaries/ Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #EricSchmidt #AI #cleanenergy #google #whitehouse #machinelearning #technology #science #bigtech #china #natsec #artificialintelligence #renewableenergy #technocracyhttps://nicecrew.tv/static/streaming-playlists/hls/992fc64f-1b0a-4e15-b54e-5b95d5655d03/81d04144-c967-414b-bfd8-af4154b9f556-master.m3u8https://nicecrew.tv/videos/embed/jV8TiezFCcv4uwNoXY9ofx664002024-04-02T16:58:49.851Zgoogleyoutubeartificial intelligenceclean energymachine learningYESRadix Verum ☦NOhttps://nicecrew.tv/w/9rPpU5edAfvMgtD3jg9LeChttps://nicecrew.tv/lazy-static/thumbnails/81a32df3-82e3-4ec0-98fd-3b1d2007a027.jpgThis is My Dream.This is my dream and my vision for the future. Come help me achieve it! Documentary Fundraiser: https://www.givesendgo.com/RadixVerum Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #dream #vision #goals #purpose #motivationhttps://nicecrew.tv/static/streaming-playlists/hls/4463ec17-6a3d-4b82-9932-89d8fdba0db6/e2400dc1-db45-4a64-929e-b598169a271b-master.m3u8https://nicecrew.tv/videos/embed/9rPpU5edAfvMgtD3jg9LeC1080062024-04-02T16:58:59.416ZdreamvisionmissiongoalpurposeYESRadix Verum ☦NOhttps://nicecrew.tv/w/x6cRi5QYhtkygnQk6zaHCvhttps://nicecrew.tv/lazy-static/thumbnails/e4273945-9a28-4f83-a988-33a030ca506f.jpgOKC & PATCON: Timothy McVeigh's Role in Domestic Black OperationsPATCON aka "Patriot Conspiracy" was an FBI operation that targeted Christian, "neo-Nazi," and right-wing militia groups that may have begun in the 1980s but operated in the early 90s. Timothy McVeigh told his family he was recruited into a covert group of "military consultants," assisting domestic and international police in black operations. He told his initial public defenders the same story. Terry Nichols would later echo this same story. This seems very similar to GLADIO. Sources: https://twitter.com/BoltzmannBooty/status/1424546729836285954 https://twitter.com/BoltzmannBooty/status/1423273605257826310 https://www.deseret.com/2007/2/22/20003336/nichols-says-bombing-was-fbi-op https://twitter.com/BTH_Bill/status/1369852800449081345 Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #OKC #Patcon #GLADIO #blackopshttps://nicecrew.tv/static/streaming-playlists/hls/fbc551f0-58f4-4880-8db1-4e1f5dc79b61/3a6905cc-80fa-4f7b-b90b-c28187f67094-master.m3u8https://nicecrew.tv/videos/embed/x6cRi5QYhtkygnQk6zaHCv2318002024-04-02T16:59:09.977ZPATCONOKCTimothy McVeighTerry NicholsFBIYESRadix Verum ☦NOhttps://nicecrew.tv/w/bzzjYEtPRBRyPPKGFAA3Ajhttps://nicecrew.tv/lazy-static/thumbnails/16c66cb8-086f-46ae-bcea-d59046d806dd.jpgAdam Fox Speaks After Conviction in Whitmer Kidnapping CaseA clip from my first interview with Adam Fox after his conviction in the Michigan Whitmer Kidnapping case. Adam was sentenced to 16 years in prison for his role as a so-called "ringleader" of the Wolverine Watchman group. Adam says he was never the leader and that he was taking direction from the government informants. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #journalism #documentary #film #prison #interviewhttps://nicecrew.tv/static/streaming-playlists/hls/55ab7839-00b5-411c-98a6-cbf54f5f4d5e/f6230842-ed5e-4e80-b41d-35c69676fa41-master.m3u8https://nicecrew.tv/videos/embed/bzzjYEtPRBRyPPKGFAA3Aj425002024-04-02T16:59:18.825ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/vjS5KzTtu5B9WuacQQFDyPhttps://nicecrew.tv/lazy-static/thumbnails/6927f89c-8861-4668-9f30-186b49f835e1.jpgSteven Crowder vs The Daily Wire: The REAL ProblemSteven Crowder has been feuding with the Daily Wire over a contract for around $50 million dollars. There are many people that are commenting on this and the details of the contract. I think the bigger issue here is blacklisting and cancel culture directed from the right to other people on the right. @StevenCrowder @DailyWirePlus @BenShapiro @CandaceOwensPodcast Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #DailyWire #Crowder #StevenCrowder #candaceowens #bigconhttps://nicecrew.tv/static/streaming-playlists/hls/ed7b45e8-9a66-419d-9448-782920ea1dfb/e65dd551-6dd1-467f-b077-f06dbffe5c71-master.m3u8https://nicecrew.tv/videos/embed/vjS5KzTtu5B9WuacQQFDyP1230002024-04-02T16:59:28.417Zdaily wireben shapirocandace owenssteven crowderlouder with crowderYESRadix Verum ☦NOhttps://nicecrew.tv/w/819SCyynnbPytWR4PLto9Mhttps://nicecrew.tv/lazy-static/thumbnails/b74e0703-827e-4cc5-a5c6-03fa9f27176e.jpgImportant Case to Watch if You Care About FreedomPay attention to this if you can about freedom. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/38b57052-b2b1-4b60-b929-c25341d4ddad/ab81c704-3eb7-4419-bb88-257fda68384a-master.m3u8https://nicecrew.tv/videos/embed/819SCyynnbPytWR4PLto9M2213042024-04-02T16:59:38.241ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/6xdUukcf6msRR6vuhomq3rhttps://nicecrew.tv/lazy-static/thumbnails/07bc7b62-b21e-48d7-a507-beb8025c6a1b.jpgIs Time Actually Slowing Down?Could time be slowing down? 18th-century mathematician Henri Poincaré believed that time was slowing down and that there was almost no way for us to tell. In his 1898 book "The Measure of Time," he explains that the rotation of the earth may be becoming slower and slower. He discusses the formation of memory, and more. It is fascinating stuff! Sources: https://twitter.com/CWingUexkull/status/1619939153365585920 https://www.newscientist.com/article/mg19626354-000-is-time-slowing-down/ https://bigthink.com/mind-brain/time-is-actually-slowing-down-and-will-come-to-a-halt-says-a-radical-theory/ Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #time #space #stringtheory #blackhole #memories #clock #multiverse #universe #topology #henripoincarehttps://nicecrew.tv/static/streaming-playlists/hls/2cd9b401-24b9-45ed-aabf-0e394662d2ed/476a8fad-4b43-457f-ab15-7b2fe6fd9d7e-master.m3u8https://nicecrew.tv/videos/embed/6xdUukcf6msRR6vuhomq3r1144002024-04-02T16:59:46.501Ztimedimensionspaceearthhenri poincareYESRadix Verum ☦NOhttps://nicecrew.tv/w/2JDKEEJfq5KL7UA5gUqN71https://nicecrew.tv/lazy-static/thumbnails/00579adc-6179-47e8-95cf-a677bd76652e.jpgBirds of a Feather: Bill Gates EditionBill Gates was recently asked about his relationship with Jeffrey Epstein which he proceeded to lie about, claiming he only had "dinners" with Epstein which he "regrets." The mainstream media has promoted the idea that Melinda Gates disapproved of her husband's relationship with Epstein and that this was a contributing factor in her choice to divorce Gates. The mainstream media pretend that the Gates-Epstein relationship only dates back to 2011 when it goes back decades prior. There were two people employed by Bill Gates who were arrested for CP, and both somehow avoided jail time. One was arrested at the Gates estate back in 2014. Gates was a business partner of Peter Nygard who was also a notorious sex trafficker and criminal. These connections are not a mistake or an accident. This is a pattern of activity and Bill Gates also was very close to the Clintons. As they say, birds of a feather flock together. Sources: https://twitter.com/trebillion/status/1620093486866505728 https://twitter.com/AntonioSabatoJr/status/1620041459444613120 https://www.kiro7.com/news/man-arrested-bill-gates-estate-reportedly-trading-/43531857/ https://www.thecourier.co.uk/fp/education/higher-education/2271976/broughty-ferry-scientist-funded-by-bill-gates-dodges-jail-for-sick-child-image-haul/ https://twitter.com/trebillion/status/1292554489228976128 https://www.buzzfeednews.com/article/stephaniemlee/reginald-archibald-rockefeller-sex-abuse-studies https://unlimitedhangout.com/2021/05/investigative-reports/the-cover-up-continues-the-truth-about-bill-gates-microsoft-and-jeffrey-epstein/ https://twitter.com/KathMLee1/status/1619927688961216513 https://www.thedailybeast.com/bill-gates-praised-pedophile-jeffrey-epstein-kind-of-intriguing My documentary channel!! Please go subscribe! https://www.youtube.com/@kandkfilmofficial Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com...https://nicecrew.tv/static/streaming-playlists/hls/0e0da49d-f3e6-4a18-9f81-7cfca1e59334/751652b6-4d6c-4be0-b5f8-a7465c6fe3cd-master.m3u8https://nicecrew.tv/videos/embed/2JDKEEJfq5KL7UA5gUqN711902002024-04-02T16:59:56.387ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/bdqMVYaSBwhMMfBwo8RJtmhttps://nicecrew.tv/lazy-static/thumbnails/a070c083-4de4-47a3-970c-b44156c60c89.jpgUPDATE on @ABCNews Journalist James Gordon Meek, Raided by FBI Last Year Now Charged with CPWe have an update on the story about @ABCNews journalist and producer James Gordon Meek who was raided by the FBI last April and then subsequently went into hiding. A criminal complaint filed in the Eastern District of Virginia has been unsealed and Mr. Meek has been charged with transportation of CP. The initial reporting on the FBI raid indicated that Meek was allegedly in "possession of classified documents," and there was speculation that Meek was himself some sort of intelligence asset. Sources: https://twitter.com/benfeuerherd/status/1620814077349224448 https://www.independentsentinel.com/the-strange-disappearance-of-james-gordon-meek/ https://www.dailymail.co.uk/news/article-11374411/Missing-ABC-producer-James-Gordon-Meek-seen-public-time-FBI-raid.html?ns_mchannel=rss&ns_campaign=1490&ito=social-twitter_dailymailus https://www.rollingstone.com/politics/politics-features/former-abc-news-producer-james-meek-doj-preps-charges-1234646196/ https://www.burnhamgorokhov.com/statement-responding-to-press-inquiries-regarding-james-gordon-meek/ https://www.semafor.com/article/02/01/2023/fbi-set-to-announce-journalists-arrest-on-child-pornography-charges https://twitter.com/KitKlarenberg/status/1585571166269448195 https://www.justice.gov/opa/pr/man-arrested-transporting-images-child-sexual-abuse https://www.justice.gov/opa/press-release/file/1566416/download Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #abcnews #jamesgordonmeek #journalism #natsec #nationalsecurityhttps://nicecrew.tv/static/streaming-playlists/hls/52b79724-132c-46c9-8c5b-b073b22185f2/7d0a5d9c-522a-444e-b71c-096b1f1de4c0-master.m3u8https://nicecrew.tv/videos/embed/bdqMVYaSBwhMMfBwo8RJtm1414002024-04-02T17:00:07.203Zjames gordon meek3212 un-redactedabc newsjournalismdocumentaryYESRadix Verum ☦NOhttps://nicecrew.tv/w/cvaS7qTWM7CW6wsUquG64rhttps://nicecrew.tv/lazy-static/thumbnails/66e05340-fe7d-4e90-844e-66cdcaeac66d.jpgFILTH: Andrew & Tristan Tate Deep Dive ft. @tristanhaggardI wanted to do a video discussing the Tate brothers and their recent arrest as well as the allegations about their being involved in human trafficking. Big claims require big evidence and I still need to see more evidence to believe they were involved in trafficking. I DO however believe that they are involved in coercive and exploitative conduct. Great video by @tristanhaggard https://youtu.be/067wyxQ5tx4 Sources: https://twitter.com/crabcrawler1/status/1608933467890548736 https://twitter.com/crabcrawler1/status/1608933467890548736 Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #andrewtate #tristiantate #tatebrothers #tate #deepdive #review #manosphere #redpill #masculinity #traditionalhttps://nicecrew.tv/static/streaming-playlists/hls/5d272c69-6c5f-4a25-ba1a-c7812a985b7b/ee183f90-b926-430b-9a32-cbc1a4cd1b93-master.m3u8https://nicecrew.tv/videos/embed/cvaS7qTWM7CW6wsUquG64r2955012024-04-02T17:00:17.486Zandrew tatetristian tatetate brothershuman traffickingmanosphereYESRadix Verum ☦NOhttps://nicecrew.tv/w/mLQrdCkUMnw2ceQYPfCm6Jhttps://nicecrew.tv/lazy-static/thumbnails/1e40e759-9655-47e1-b58e-aec4759767f0.jpgEliza Bleu is Now Targeting These YouTubersI wanted to document all the content creators both on #Twitter and #Youtube who are getting banned and/or censored by her and her team. If you are a content creator that has been flagged by #ElizaBleu please reach out to me via email at: Christina@RadixVerum.com. I am looking to bring all creators together to work as a team, as Eliza clearly has a team working on her behalf to target us. @TheQuartering @LegalMindset @ThatStarWarsGirl @BrittanyVenti @CAMELOT331 @ThatUmbrellaGuy @YellowFlashProductions @ChrissieMayr @griftcast @SteelToeMorningShow @laurenchen @TreeofLogic Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #elizableu #twitter #youtube #contentcreators #creators #livestreaming #censorshiphttps://nicecrew.tv/static/streaming-playlists/hls/a839591b-aa6a-48de-a8e8-7052851089fc/c48e19c4-0bf8-4742-a3ed-5b6b686104e5-master.m3u8https://nicecrew.tv/videos/embed/mLQrdCkUMnw2ceQYPfCm6J1726002024-04-02T17:00:29.221ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/muBs7VEtrzBamxuADHk3ZGhttps://nicecrew.tv/lazy-static/thumbnails/43e03208-15b8-42ce-a299-cc6cd2d7d9c5.jpgFBI Seeks to Become Bigger Than Pentagon with Focus on Environmental Justice, Diversity & EquityThe FBI is looking to expand, and they are seeking a new headquarters that would be twice the size of the pentagon. The FBI has become political and weaponized against certain segments of the American populace. The new FBI HQ would also incorporate Joe Biden's new executive orders on diversity and equity as well as "climate justice." The FBI is already corrupt beyond repair, and this would make it much worse! Sources: https://twitter.com/JMichaelWaller/status/1620631059934359554 https://twitter.com/schwellenbach/status/1620818548741533696 https://amgreatness.com/2023/02/01/planned-new-fbi-hq-is-twice-the-size-of-the-pentagon/ Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #FBI #Pentagon #nationalsecurity #diversity #equity #environmental #environmentaljustice #greenenergy #climate #climatechange #climatejusticehttps://nicecrew.tv/static/streaming-playlists/hls/a5f57220-40e6-423a-9e13-78a82aaf9d82/279d0177-811e-4edd-9369-4646d6948a76-master.m3u8https://nicecrew.tv/videos/embed/muBs7VEtrzBamxuADHk3ZG1452002024-04-02T17:00:41.505Zfbipentagonnational securitypolicediversityYESRadix Verum ☦NOhttps://nicecrew.tv/w/72fNhHSMBU8GJpBMKthaVAhttps://nicecrew.tv/lazy-static/thumbnails/c8e917a7-f689-457d-af26-f36463f0ffcd.jpgNo One is Talking About This! DARPA & IARPA's "Science of Censorship" Project, Brain Hacking & More!DARPA & IARPA are at it again. They are funding college campuses to create massive databases of American citizens who engage in wrong think or thought crimes. They are using "misinformation" about vaccines and electoral skepticism as an excuse calling it "information pollution." Sources: https://www.biometricupdate.com/202302/sprawling-us-intel-project-to-improve-long-distance-biometrics-on-college-campus https://www.michigannewssource.com/2023/01/u-of-m-and-msu-received-federal-grants-to-help-government-better-censor-speech/ https://twitter.com/redvoicenews/status/1621898437313847297 Support the documentary! https://twitter.com/KandKFilm https://www.youtube.com/@UCa86C9KrP8u1ptZU_eOJRmA https://www.givesendgo.com/RadixVerum Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #DARPA #IARPA #censorship #misinformation #data #databases #algorithm #socialmedia #socialengineering #transhumanism #WEF #worldeconomicforum #brain #science #brainhack #ai #biometrics #smart #technologyhttps://nicecrew.tv/static/streaming-playlists/hls/30c3b203-96b0-4b73-b5cf-6cff523c0338/d9e00840-d2c8-475c-86c0-1efc4ef66f23-master.m3u8https://nicecrew.tv/videos/embed/72fNhHSMBU8GJpBMKthaVA2178002024-04-02T17:00:53.194ZcensorshipdarpaiarpadodpentagonYESRadix Verum ☦NOhttps://nicecrew.tv/w/7aSJ7dR6X7JtCrGPW3ofxHhttps://nicecrew.tv/lazy-static/thumbnails/53d2c53e-2b57-4e8a-a047-7073fd4f56c5.jpg"Me or the PS5," Stop Giving These Women Free AttentionI was inspired to go on an anti-simping rant because of the egirls "me or the PS5," "Me or the XBox" thirst trap posts. What is even more desperate and pathetic than these attention-seeking women is the simps who pay them or shower them with free attention and validation. Stop enabling their poor life decisions. They are never going to have sex with you. You are feeding their already massively overinflated egos. You are rewarding low effort and poor lifestyle and behaviors. Why? Remove your attention and make them value it and offer something in return. Plus a lot of these egirls are "sex workers" so they view all these interactions as transactional as well as ego boosting. Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #twitch #twitchstreamers #egirls #models #attention #modernwomen #modernity #relationships #advice #commentaryhttps://nicecrew.tv/static/streaming-playlists/hls/31f7c971-a5b8-45b8-ab2d-5b914113cf37/939d704a-f303-45f8-8f3b-1334ebb12e31-master.m3u8https://nicecrew.tv/videos/embed/7aSJ7dR6X7JtCrGPW3ofxH820002024-04-02T17:01:03.949Zegirlsamouranthtwitchtwitch streamersinstagram modelsYESRadix Verum ☦NOhttps://nicecrew.tv/w/1npgG8UQhyLDfCiok1VvCWhttps://nicecrew.tv/lazy-static/thumbnails/1fa87646-dd84-45f0-9905-4d10622c7c31.jpgFBI Leaks Their Infiltration & Targeting of Denver BLM?The Intercept's Trevor Aaronson just broke a story on the FBI's use of a felon as an informant to infiltrate and try to radicalize and entrap members of the Denver, Colorado #BLM movement. This seems very convenient to me as the Republicans just began their House Oversight Committee investigation into the Weaponization of the Federal Government. It comes as people are calling the FBI out for their Whitmer Kidnapping Hoax - which we are working on a documentary to expose: www.kandkfilm.com Sources: https://archive.is/lY8nD https://www.thedailybeast.com/how-an-fbi-informant-derailed-denvers-blm-movement https://twitter.com/seriations/status/1623358691549274113 https://reason.com/2022/09/04/its-almost-always-the-feds/ https://dailycaller.com/2023/02/09/fbi-recruiting-informants-spy-traditional-catholics-latin-mass-southern-poverty-law-center/ https://www.lifenews.com/2023/02/09/whistleblower-documents-show-fbi-working-with-radical-leftist-group-to-target-pro-life-catholics/ https://twitter.com/alx/status/1623740305034936321 https://twitter.com/restoreorderusa/status/1623769979324624896 Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #FBI #BLM #racialjustice #denver #movement #infiltration #blacklivesmatterhttps://nicecrew.tv/static/streaming-playlists/hls/02fcf5cc-db48-406b-98cf-76c3c7aaca9a/01de64bc-fde3-465b-ab73-ab5f65b92f3e-master.m3u8https://nicecrew.tv/videos/embed/1npgG8UQhyLDfCiok1VvCW1574002024-04-02T17:01:14.510ZFBIinfiltrationinformantsroman catholicsblmYESRadix Verum ☦NOhttps://nicecrew.tv/w/uZiunqeYLtZ67HrMHPnthjhttps://nicecrew.tv/lazy-static/thumbnails/53aca3dd-c610-488e-83af-056900764059.jpgLatest News: Section 230, Layoffs, Stores Closing & Potential Food Shortages ComingThere have been some really important news items this week that are going underreported. The first is 2 cases going to the U.S. Supreme Court that could affect Section 230. An online censorship bill that undermines encryption and privacy. Major layoffs and grocery stores closing retail locations. Sources: https://element.io/blog/the-online-safety-bill-an-attack-on-encryption/ https://techcrunch.com/2023/02/10/google-is-losing-control/ https://www.economist.com/leaders/2023/02/09/the-battle-for-internet-search https://arstechnica.com/information-technology/2023/02/in-paris-demo-google-scrambles-to-counter-chatgpt-but-ends-up-embarrassing-itself/ https://www.cnn.com/2023/02/08/tech/google-ai-bard-demo-error/index.html https://www.reuters.com/technology/google-cautions-against-hallucinating-chatbots-report-2023-02-11/ https://twitter.com/Aristos_Revenge/status/1622840424527265792 https://www.techradar.com/opinion/the-internet-is-falling-out-of-love-with-google-and-its-bings-time-to-shine https://www.techtarget.com/searchenterpriseai/news/365530303/ChatGPT-bursts-into-Microsoft-Bing-as-Google-Bard-rises https://www.engadget.com/google-maps-immersive-view-glancable-directions-170504886.html https://www.theverge.com/2023/2/9/23592647/ai-search-bing-bard-chatgpt-microsoft-google-problems-challenges https://fortune.com/2023/02/07/chatgpt-economist-says-disrupt-job-market-lower-wages-ai/ https://techxplore.com/news/2023-02-americans-dont-companies-personal-dataand.html https://www.investors.com/news/technology/section-230-internet-law-under-threat-nightmare-for-twitter-meta-google-stock/ https://www.usatoday.com/story/tech/columnist/komando/2023/02/09/how-legally-avoid-drone-surveillance-around-your-private-property/11205343002/ https://archive.is/p8LUw https://techcrunch.com/2023/02/09/github-lays-off-10-and-goes-fully-remote/ https://www.king5.com/article/news/local/bellevue/microsoft-layoffs-redmond-bellevue-issaquah/281-16f21ccf-05ab-4a03-8298-a95475940a32 https...https://nicecrew.tv/static/streaming-playlists/hls/eac00e30-6916-47f1-9c3b-b6f757481916/8f11b954-b199-4380-a3f4-33a503ee2e5e-master.m3u8https://nicecrew.tv/videos/embed/uZiunqeYLtZ67HrMHPnthj1313002024-04-02T17:01:25.022ZeconomyinflationdepressionrecessionlayoffsYESRadix Verum ☦NOhttps://nicecrew.tv/w/j9J76umwysp9K2JcdjG57Chttps://nicecrew.tv/lazy-static/thumbnails/dca69196-959e-455c-8da6-a90c0e10767c.jpgBarry Croft, Jr. Statement to Select Subcommittee on the Weaponization of the Federal GovernmentBarry Gordon Croft, Jr was arrested by the FBI on October 7, 2020, and charged with "conspiracy to kidnap" Michigan Governor Gretchen Whitmer. The government later added WMD charges. Barry maintains that he was entrapped and framed by the FBI. He has requested to make a statement to the Subcommittee, urging them to investigate the actions of the FBI in his case. Croft maintains that he is innocent of the charges and did not receive a fair trial. Croft was sentenced to 20 years in prison earlier this year. #WeaponizationSubcommittee #Congress #Senate #House #FBI #Michigan #Whitmerhttps://nicecrew.tv/static/streaming-playlists/hls/92fc64eb-6c2b-47bb-9e13-505834c58fb0/a1fb8cf7-6da9-4454-b462-cde1819c62ec-master.m3u8https://nicecrew.tv/videos/embed/j9J76umwysp9K2JcdjG57C238002024-04-02T17:01:36.693Zweaponization committeeBarry Goron CroftBarry Croft jrfbimichiganYESRadix Verum ☦NOhttps://nicecrew.tv/w/7M1svrZGjT91vLzi2nFD8ghttps://nicecrew.tv/lazy-static/thumbnails/33c80b10-4d45-4e81-9b1d-7211fd517b97.jpgFBI Framed Proud Boys with Fake Manifesto& May Have Spies in Congress!A Motion for Mistrial by defendant Dominic Pezzola in the Proud Boys Seditious Conspiracy Case. The Motion alleges that a "manifesto," called 1776 returns outlined a plan to storm the Capitol attributed to Proud Boys leader Enrique Tarrio and/or another PB member was authored by an FBI/CIA asset. The FBI is targeting traditional Catholics and a Capitol police officer may have lied under oath. Sources: https://twitter.com/julie_kelly2/status/1624782948254744577 https://twitter.com/TPC4USA/status/1624821533943136259 https://twitter.com/amuse/status/1624803004070215681 https://twitter.com/ramzpaul/status/1624626359787048960 https://twitter.com/booth_okc/status/1624627162719588352 https://headlineusa.com/does-fbi-have-spies-in-congress/ https://www.bostonherald.com/2023/02/11/howie-carr-a-rare-salute-to-the-boston-fbi-for-refusing-jan-6-improper-investigations-on-citizens/ Support my work!: Venmo: RadixVerum Cash App: $RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #Trial #FBI #Congress #corruption #proudboys #catholic #churchhttps://nicecrew.tv/static/streaming-playlists/hls/36df9550-d320-404e-86bd-666473699ea1/3bd28d11-099f-4fba-8b90-454943096b0c-master.m3u8https://nicecrew.tv/videos/embed/7M1svrZGjT91vLzi2nFD8g1521002024-04-02T17:01:46.291Zfbimanifestoenrique tarrioproud boystrialYESRadix Verum ☦NOhttps://nicecrew.tv/w/iWcHfQEURN3YVseUjhMgPUhttps://nicecrew.tv/lazy-static/thumbnails/b743e740-ee27-4267-a714-846c9f4d86b1.jpgTrain Derailment in East Palestine Ohio, White Noise, Toxic Chemicals & Other DerailmentsWhat is happening with these train derailments? We had 3 in one day it seems and the one in East Palestine, Ohio looks incredibly dangerous. Reporters have been arrested trying to cover the derailment and "burn" of the hazardous chemicals. There seems to have been some predictive programming with the @Netflix White Noise film that was shot the year prior in the SAME locations. Some of the folks from Ohio who were extras in the Netflix film ended up living the script in real life! Norfolk Southern seems to have been aware of the problems and decided to cut corners anyway. With the substations, farm burnings, balloon incidents and more it seems like there is more to the story here. I am interested in hearing your thoughts! Sources: https://twitter.com/wokesocieties/status/1625116030023393287 https://twitter.com/realstewpeters/status/1625137111845289985 https://twitter.com/WallStreetSilv/status/1625079840020766724 https://twitter.com/LPMisesCaucus/status/1624749331919011853 https://twitter.com/DeepBlueCrypto/status/1625113436844703744 https://twitter.com/CitizenFreePres/status/1625058486777434112 https://twitter.com/unhealthytruth/status/1625142633008881667 https://twitter.com/treblewoe/status/1625134435933818882 https://twitter.com/itsnatlydenise/status/1625294429090095106 https://twitter.com/GonzaloLira1968/status/1625174559363153928 https://www.wlwt.com/article/cincinnati-water-works-water-quality-train-derailment/42837092 https://twitter.com/KanekoaTheGreat/status/1625214707727765504 https://twitter.com/MaxBlumenthal/status/1625180201075326983 https://twitter.com/nickdrom/status/1624389075632373762 https://twitter.com/CitizenFreePres/status/1625213022942953472 https://www.wkrg.com/national/keachi-train-derailment-leaks-acid-products-causes-evacuation-road-closures/?utm_content=Top+Stories&utm_campaign=socialflow&utm_medium=referral&utm_source=t.co https://www.foxcarolina.com/2023/02/13/officials-responding-train-derailment-enoree/ https://twitter.com/realst...https://nicecrew.tv/static/streaming-playlists/hls/913cbcf7-5fab-45e0-9f32-ce8e18b818be/dfe52e89-772b-4f10-a4c8-0cc6b98bd313-master.m3u8https://nicecrew.tv/videos/embed/iWcHfQEURN3YVseUjhMgPU1664002024-04-02T17:01:57.107Zeast palestineohiotrain derailmenttraincrashYESRadix Verum ☦NOhttps://nicecrew.tv/w/ksPcdZWhj6CnRvdSyA7dMWhttps://nicecrew.tv/lazy-static/thumbnails/4f2b2e23-58e8-4fad-8bb7-b90e0070aac3.jpgMen Respond to Study on Men Leaving the Workforce, Male Depression & MoreFriends, I saw a study that describes men exiting the workforce. I asked men to tell me why they thought this was happening and I got tons of replies, some of which I wanted to share with you. Male depression and suicide are on the rise. We need to come up with solutions to these problems. Sources: https://archive.is/hgkzG https://www.foxnews.com/media/mike-rowe-sounds-alarm-men-leaving-workforce-chilling-metric https://twitter.com/WV_TN_DEM/status/1623457343513165825 https://www.cbsnews.com/news/men-workforce-work-companies-struggle-fill-jobs-manufacturing/ https://twitter.com/datepsych/status/1601331888836448256 https://annsilvers.com/blogs/news/depression-in-men-it-happens-more-than-you-think https://twitter.com/LisaBritton/status/1623685337166798848 https://twitter.com/MalePsychology/status/1610598097150681089 Support my work!: Venmo: https://venmo.com/radixverum Cash App: $RadixVerum https://cash.app/$radixverum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #men #work #workforce #male #masculinity #labor #market #dating #depression #corporate #jobs #hr #laborparticipationhttps://nicecrew.tv/static/streaming-playlists/hls/9d9c0e7d-4cd6-461a-ae52-cc059ef1e6a8/7ae47abc-b18b-464b-9fe1-65f09fd47d5f-master.m3u8https://nicecrew.tv/videos/embed/ksPcdZWhj6CnRvdSyA7dMW2973002024-04-02T17:02:09.329Zmenlaborworkforcemanual laborblue collarYESRadix Verum ☦NOhttps://nicecrew.tv/w/6x7HDiM1u4AGhX1xQv7hc1https://nicecrew.tv/lazy-static/thumbnails/93c3a34a-911f-45a8-9338-281452964798.jpgUS Government Informants Behind Assassination of Haitian President?!I wanted to do a video looking at some new information that has come out regarding the defendants in the assassination of Haitian President Jovenel Moïse. That information shows connections to various US intelligence agencies like the CIA, DEA, FBI, and DIA as well as connections to the US Military. I also wanted to lay some groundwork regarding the Clinton Foundation in Haiti after the 2010 earthquake, and the Oxfam/UN Peacekeeping scandals. Sources: https://twitter.com/JakobJohnston/status/1625574503924346880 https://twitter.com/BoltzmannBooty/status/1625628816403038212 https://twitter.com/BoltzmannBooty/status/1486884157133402116 https://booty.substack.com/p/notes-on-the-possibility-of-us-government?sd=pf https://twitter.com/BoltzmannBooty/status/1582910185785659392 https://twitter.com/BoltzmannBooty/status/1581428050373185536 https://twitter.com/BoltzmannBooty/status/1470177245406937092 https://twitter.com/BoltzmannBooty/status/1582719528026324992 https://twitter.com/BoltzmannBooty/status/1520205996932714497 https://archive.is/6RR3W https://www.sott.net/article/330837-Emails-reveal-State-Dept-helped-Clinton-Foundation-donors-get-contracts-for-2010-Haiti-quake-report https://www.sott.net/article/382139-How-37-million-from-the-Clinton-Foundation-disappeared-in-Baltimore Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$radixverum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #haiti #presidentmoise #moise #cia #fbi #clinton #clintonfoundation #regimechangehttps://nicecrew.tv/static/streaming-playlists/hls/2cd5e3e9-2427-4a97-8ea7-0c49085a533e/2c1b915e-bd77-4271-a082-fbd77821f8b3-master.m3u8https://nicecrew.tv/videos/embed/6x7HDiM1u4AGhX1xQv7hc12550002024-04-02T17:02:20.976Zhaitihaitian presidentmoiseassassinationus governmentYESRadix Verum ☦NOhttps://nicecrew.tv/w/8tVrBqBrtB3i3RwDAxXNDShttps://nicecrew.tv/lazy-static/thumbnails/33b601e2-ae24-4235-9b9d-f23eff21b6b5.jpgChemical Warfare in East Palestine, Ohio? A Theory.I came across a very interesting thread on Twitter about the train derailment and subsequent "controlled burn," of incredibly toxic and dangerous chemicals. I haven't seen many people discussing this theory so I figured I would share it with you all. Could the Amish be a target? Source: https://twitter.com/AeonAnimus/status/1625351099782770690 Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$Radixverum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #eastpalestine #ohio #train #derailment #environmental #ecological #toxicwaste #ohiodisaster #amish #pennsylvaniahttps://nicecrew.tv/static/streaming-playlists/hls/3c95fca8-64a6-431c-b456-7c6c012a8314/1fc1c7a8-39e9-4479-af40-1a1741d89491-master.m3u8https://nicecrew.tv/videos/embed/8tVrBqBrtB3i3RwDAxXNDS854002024-04-02T17:02:33.030Zeast palestineeast palestine ohioohiotrain derailmentnorfolk southernYESRadix Verum ☦NOhttps://nicecrew.tv/w/c7QwSHuqt3mnYArW9USrdzhttps://nicecrew.tv/lazy-static/thumbnails/294a0389-2534-40ab-9175-c2aa14a4f00f.jpgI need your help.Please help me get the word out. Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/5a08e5a0-af2b-45a3-8837-45862746596d/7b520b2e-a53a-4b3f-9caa-b78e5c5c6a42-master.m3u8https://nicecrew.tv/videos/embed/c7QwSHuqt3mnYArW9USrdz860002024-04-02T17:02:44.564ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/5ZMMQYbBPB8ZxWjERRZ35Qhttps://nicecrew.tv/lazy-static/thumbnails/582dbbb2-dbd1-4f35-a2fb-f371fca9d8ca.jpgWhat Makes Neuralink so Scary...Neuralink, founded by Elon Musk touts many positive uses of its brain implantation device but as with all technology, there are downsides and unintended consequences that could be very dangerous. Neuralink is a BCI or “brain-computer interface.” It is designed to assist individuals with neurological and psychiatric disorders by decoding and stimulating neural activity. To make that happen, the company plans on using a link containing 1024 electrodes (all together it’s around the size of a penny in length). The electrodes can record signals in the brain, decode the information, and stimulate signals back to the brain to elicit activity. The ultimate goal being to repair nerve cells within the brain that have been damaged. In 2020 alone, three other BCI systems were introduced to the scientific and tech community: Paradromics, Synchron, and a Neural Prosthesis. The paradromics neural implant will give people who are paralyzed a way to communicate. Synchron’s BCI system also provides a means of communication through typing for paralyzed people. Synchron uses a different technology than Neuralink not being implanted into the brain directly but into the chest. Jeff Bezos and Bill Gates are both investors in Synchron. Researchers at the Netherlands Institute for Neuroscience made a neuroprosthetic brain implant that renders artificial vision. Chapters: 00:00 - 00:34 Intro 00:35 - 01:31 What is Neuralink? 01:32 - 02:44 BCI Systems 02:44 - 03:17 Three Little Pigs Demo 03:18 - 04:10 Pong 04:10 - 05:15 Federal Probe 05:15 - 05:16 Concerns 05:16 - 05:40 Transhumanism 05:41 - 06:19 Davos 06:20 - 06:43 "Like a Fitbit for your Brain!" 06:43 - 07:25 Workplace Surveillance 07:26 - 08:05 Dystopian Levels of Oppression 08:05 - 08:34 Hacking/Malfunction 08:34- 09:10 Personal Data Risks 09:10 - 10:26 Pre-Crime 10:27 - 12:15 History of US Government Quest for Mind Control/MKULTRA 12:16 - 17:09 Closing Thoughts Support my work!: Venmo: https://venmo.com/radixverum Cash App: ...https://nicecrew.tv/static/streaming-playlists/hls/28762b3b-993f-4deb-827f-6cb3be338478/6c1e2fa7-e1cb-4e46-a071-042745179fe4-master.m3u8https://nicecrew.tv/videos/embed/5ZMMQYbBPB8ZxWjERRZ35Q10280622024-04-02T17:02:54.668Zneuralinkelon musksilicon valleytechnologyneurotechnologyYESRadix Verum ☦NOhttps://nicecrew.tv/w/aSUABaZ5cDSa7mumgn1gfNhttps://nicecrew.tv/lazy-static/thumbnails/3abb8dce-5f7f-463b-871f-e206af10ca73.jpgThe Government is Trying to Shut Down my Documentary with Ken Silva & Brandon CasertaUrgent update for everyone on the status of my documentary "Kidnap and Kill: An FBI Terror Plot." In October of 2020, a group of men were arrested and charged with conspiracy to kidnap the governor of Michigan, Gretchen Whitmer. Six men were charged federally, and several men were charged in separate state cases. Discovery in the case showed the FBI steering the "plot," and using a network of at least 12 informants and 2 undercover agents to entrap and frame American citizens. The website for the documentary is: https://www.kandkfilm.com You can donate to the documentary at: https://givesendgo.com/radixverum https://youtu.be/APGf2vabwmw Support my work!: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://radixverum.com Thanks for watching my content friends! #documentary #film #trailer #Indie #indiefilm #truecrime #Michigan #Whitmer #censorshiphttps://nicecrew.tv/static/streaming-playlists/hls/4ffdd9ac-42ed-40c0-81da-9458fd587626/bd8743f9-e96c-4bbd-94fd-306a0d3f2fd2-master.m3u8https://nicecrew.tv/videos/embed/aSUABaZ5cDSa7mumgn1gfN3696002024-04-02T17:03:05.910Zdocumentaryfilmindependent filmindietrue crimeYESRadix Verum ☦NOhttps://nicecrew.tv/w/pd2HuYaQ4yd8MgVq2ADKmMhttps://nicecrew.tv/lazy-static/thumbnails/757ee764-7898-4173-81c7-802ae29a1887.jpgCNN Finally Asks What Happened to Terrance Yeakey ꟾ OKCCNN has finally decided to question the official narrative regarding the alleged "suicide," of Oklahoma City Police Department SGT Terrance Yeakey in the aftermath of the OKC bombing. Yeakey was one of the first people in the scene and his heroic actions that day saved many lives. Terry had seen things that conflicted with the official government narrative on OKC, and he had been collecting evidence and doing his own investigation. His body was found under suspicious circumstances in a field in El Reno, Oklahoma. He has his wrists cut, grass embedded in his wounds, and had a gunshot wound from an unusual angle. No autopsy was performed. No investigation into his death was conducted to the dismay of his family. CNN article: https://www.cnn.com/interactive/2023/03/us/oklahoma-city-bombing-yeakey-death-cec-cnnphotos/ Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ https://radixverum.com Thanks for watching my content friends! #TerranceYeakey #OKC #TerryYeakey #truecrime #clinton #fbi #corruption #investigation #news #murrahhttps://nicecrew.tv/static/streaming-playlists/hls/bbf02bf0-891c-46a8-b83d-99368f3f12c9/5461dc92-1199-4d9a-bffc-d6e43009775a-master.m3u8https://nicecrew.tv/videos/embed/pd2HuYaQ4yd8MgVq2ADKmM839002024-04-02T17:03:17.583Zterrance yeakeyterry yeakeyokcokc bombinginvestigationYESRadix Verum ☦NOhttps://nicecrew.tv/w/nf2DGQoYZY44AHNSuHEBxFhttps://nicecrew.tv/lazy-static/thumbnails/fec89cca-c70f-4666-ab4e-3a4d0313ea1a.jpgFBI CAUGHT Fabricating & Destroying Evidence in a MASSIVE J6 SCANDAL in Proud Boys CaseThe FBI was just caught red-handed once again fabricating evidence in federal criminal cases, as well as destroying evidence, obstructing justice, and spying on privileged attorney-client communications. It never ceases to amaze me the sheer levels of rot and corruption inside the federal government. The DOJ was aware of this as well and chose to do nothing. The latest FBI corruption comes from the Proud Boys "seditious conspiracy" federal case and from attorney Nick Smith on behalf of his client Ethan Nordean. Will this FBI Agent be fired and charged with crimes, including perjury? This comes right after we got to see new video of Jacob Chansley the Shaman being escorted around by USCP thanks to Tucker Carlson. Sources: https://twitter.com/julie_kelly2/status/1633808394850127872 https://twitter.com/julie_kelly2/status/1633814793856380928 https://twitter.com/JMichaelWaller/status/1633820499913621505 https://is.gd/SpIDFI https://amgreatness.com/2023/02/17/judge-tim-kellys-court-of-contempt/ https://is.gd/Rpv7o6 https://archive.is/ImfiB https://www.heritage.org/press/oversight-project-announces-litigation-blitz-against-fbi-double-standard-driven-war Support my work! Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #breakingnews #FBI #court #trial #law #corruption #censorship #j6 #ethannordean #proudboys #foxnews #tucker #tuckercarlsonhttps://nicecrew.tv/static/streaming-playlists/hls/ac05576e-9924-4f83-8eb0-d5972ecc2699/d74876ed-6c92-4bd2-9d2b-74994f96ecbb-master.m3u8https://nicecrew.tv/videos/embed/nf2DGQoYZY44AHNSuHEBxF25505152024-04-02T17:03:26.196ZJanuary 6Tucker CarlsonFBIJanuary 6 investigationProud BoysYESRadix Verum ☦NOhttps://nicecrew.tv/w/qppErdXqTaSxPEteXYRYMGhttps://nicecrew.tv/lazy-static/thumbnails/b451e07e-887a-475a-816e-18b75fa4df19.jpgAdam Fox Heartbreaking Message from Florence Supermax ꟾ Whitmer CaseI have urgent and heartbreaking news regarding Adam Fox, from the Whitmer Case. Adam's mother has received a very sad and disturbing letter from Adam who was in the SHU in Florence when he wrote it. The letter is dated 2/24/23 and his mother just received it. Who knows where he is right now. He is still being prevented from making phone calls. Barry is supposed to be in Oklahoma right now awaiting transfer to Terre Haute, Indiana. We have not heard from him in weeks. https://youtu.be/APGf2vabwmw https://www.givesendgo.com/RadixVerum Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ www.radixverum.com Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/c5a00466-77a9-4f23-b7a1-f1cb57720182/3456d90b-c7d3-4f72-a31d-84d77f37de3e-master.m3u8https://nicecrew.tv/videos/embed/qppErdXqTaSxPEteXYRYMG1895012024-04-02T17:03:38.155ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/76PV8ZDeh246LVN3y12TbMhttps://nicecrew.tv/lazy-static/thumbnails/7086769b-b670-4dda-89cb-6fb5f34049e5.jpgFBI & IARPA Project "JANUS" CAUGHT Testing "Unrestrained" A.I. Facial Recognition on AmericansThe FBI and IARPA have been caught testing "unrestrained" AI Facial Recognition on unwitting American citizens without a warrant or consent of the participants. The Project code-named "JANUS" - like the two-faced god of antiquity - was exposed thanks to a 2019 ACLU lawsuit against the DOJ, DEA, and FBI. According to The Washington Post, thousands of pages of internal documents show how closely the FBI and Defense officials worked with academic researchers to refine AI techniques that could help in the identification or tracking of Americans without their awareness or consent. The internal documents reveal that U.S. federal agencies wanted to develop “truly unconstrained” facial recognition tools that could be used in subway and public street cameras, mobile drones, and police body cameras. The advanced technology would be able to quickly detect and accurately process face imagery recorded by surveillance cameras in public places and detect targets from up to 1,000 meters away. The research program, which is code-named “Janus,” would allow the U.S. government to identify and track millions of people at a time. Funded by the Intelligence Advanced Research Projects Agency, (IARPA) which is a high-level research arm of the U.S. intelligence community, the Janus program dates back to 2014. It was set up with the goal of “radically expanding the scenarios in which automated face recognition can establish identity.” According to The Washington Post, the internal documents were unveiled in the American Civil Liberties Union’s (ACLU) ongoing lawsuit against various U.S. agencies over its secretive use of facial recognition technology. Sources: https://archive.is/ImfiB https://petapixel.com/2023/03/08/fbi-tested-truly-unconstrained-facial-recognition-software-on-americans/ https://archive.is/2o87i https://www.aclu.org/legal-document/aclu-v-doj-face-recognition-surveillance-complaint https://petapixel.com/2023/03/07/new-ai-surveillance-camera-tech-knows-who-your-...https://nicecrew.tv/static/streaming-playlists/hls/31671487-e3e1-480f-9c8d-360ef0210745/5c89744e-6d32-48b1-933a-0915398df956-master.m3u8https://nicecrew.tv/videos/embed/76PV8ZDeh246LVN3y12TbM528002024-04-02T17:03:50.116ZFBIDARPAIARPAsurveillanceartificial intelligenceYESRadix Verum ☦NOhttps://nicecrew.tv/w/a6Mm7v5hscWYgdwKrxr37Phttps://nicecrew.tv/lazy-static/thumbnails/5c94fa9c-eadd-43c5-a6e4-7fade7cf9e26.jpgIt's All About to Crash...The most important financial news and underreported news of the week. Ten signs of the coming collapse of everything. The entire system is unsustainable. No. 1: US large bankruptcies in January of this year reached the highest levels since 2010. No. 2: Fed likely to raise interest rates at an increasing pace. No. 3: Europe and US Market Inflation Gauges Converge for the first time since the last global financial crisis. This suggests investors are rethinking their longstanding belief that US inflation is generally higher than in Europe. Some investors are betting on inflation via derivatives on inflation in the eurozone for the second half of the next decade. No. 4: Yield Curve Inversion An inverted treasury yield curve, a trusted method of forecasting recessions historically, is once again flashing warning signals. The spread between the yields of the 2- and 10-year treasuries is on pace to surpass its deepest inversion of 2023 and is approaching the record of minus 0.968 percentage points set on October 2, 1981. Source: https://archive.is/lSd9w No. 5: More layoffs Layoffs have continued for workers in tech and the media (haha honk honk). Disney cut 7k jobs and Newscorp cut 1,250. This month, Dell, eBay, zoom, yahoo, and more laid off 10k. Ericcson – a telecoms giant – announced it was laying off 8 percent of its global workforce. Since last year Google laid off 12k, Meta 11k, Amazon 10k, and Microsoft 10k. Twitter has laid off over 4k. Source: https://archive.is/kb3sO Meta has just announced even more layoffs coming. Source: https://archive.is/JCsBD Palantir lays off 2 percent of its global workforce. Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ www.radixverum.com Thanks for watching my content friends! #finance #inflation #recession #financialnews #retail #investing #in...https://nicecrew.tv/static/streaming-playlists/hls/49b0e9a8-446f-42b3-b5b1-717ef32c150b/2aa6533b-4140-4be0-be0a-f3df5a295855-master.m3u8https://nicecrew.tv/videos/embed/a6Mm7v5hscWYgdwKrxr37P1694042024-04-02T17:04:00.132Zeconomyeconomic newscollapsefinancial collapsepreppingYESRadix Verum ☦NOhttps://nicecrew.tv/w/p7x793zsqyp1agAFJaaZc9https://nicecrew.tv/lazy-static/thumbnails/31692443-6a49-4bab-8e14-efeb917d6a08.jpgSilicon Valley Bank: Second Largest Bank Failure in US History, Bank Runs. 2008 All Over Again?The Silicon Valley Bank (SVB) remarkable 48-hour collapse is the second largest bank failure in US history. The prior one being the collapse of Washington Mutual back in 2008. Washington Mutual was bought up by JP Morgan Chase to try to stem contagion. The FDIC has stepped in to look for a buyer for SVB. Meanwhile, tons of tech, biotech, and medical start-ups had most of their money in SVB. In the weeks prior to the SVB collapse, some senior executives sold off stock. In the hours before the government took over the bank, SVB paid out tons of bonuses to employees. As far as the insider trading goes, who knew what and when did they know it? The head of Risk Management at SVB was spending all her time working on woke LCGT and climate change initiatives rather than apparently doing her job. Sources: https://mobile.twitter.com/KobeissiLetter/status/1634614085424750592 https://mobile.twitter.com/GRDecter/status/1633919731081125890 https://twitter.com/GRDecter/status/1634091448743219201 https://twitter.com/peruvian_bull/status/1634007523618615296 https://techcrunch.com/2023/03/09/silicon-valley-bank-firms-reactions/ https://techcrunch.com/2023/03/09/silicon-valley-back-withdrawal-issues/ https://www.cnbc.com/2023/03/10/silicon-valley-bank-tumbles-for-a-second-day-weighing-on-the-bank-sector-again.html https://twitter.com/amuse/status/1634721472747905025 https://twitter.com/GRDecter/status/1634958322733555714 https://www.axios.com/2023/03/12/silicon-valley-bank-banking-crisis https://marketsentiment.substack.com/p/svb?utm_source=post-email-title&publication_id=371061&post_id=107652104&isFreemail=true&utm_medium=email https://archive.is/IfNGj https://archive.is/nV5Ds https://techcrunch.com/2023/03/11/brex-ceo-is-trying-to-raise-over-1-billion-in-a-weekend-for-svb-related-bridge-loans/ https://www.bloomberg.com/news/articles/2023-03-11/ad-tech-firm-in-canada-has-over-90-of-its-cash-tied-up-in-svb https://www.axios.com/2023/03/11/silicon-valley-bank-roku-roblox-impacte...https://nicecrew.tv/static/streaming-playlists/hls/bb2bd24a-d7df-43b6-a590-e62985d16682/20eb825b-fefc-4ba9-a028-663b8c8b757d-master.m3u8https://nicecrew.tv/videos/embed/p7x793zsqyp1agAFJaaZc92788002024-04-02T17:04:10.685ZSilicon Valley BankSVBbanksbankingbank collapseYESRadix Verum ☦NOhttps://nicecrew.tv/w/6qhaKDNBsS1me9eb3yTMxihttps://nicecrew.tv/lazy-static/thumbnails/e1ff240f-a847-4130-bfb1-489ea145cc78.jpgMajor Banking Crisis as the Fed Bails Out the Rich AGAINYesterday we covered the 2nd largest bank failure in US history with the collapse of Silicon Valley Bank in just 48 hours. Then on Sunday, US regulators shut down Signature Bank. Regional bank shares were halted this morning Trading at multiple banks halted after opening bell this morning. The US Dollar dropped as fed rate hike expectations trimmed with the SVB news. First Republic bank was able to shore up some liquidity thanks to JP Morgan. Janet Yellen and Joe Biden assure us that everything is fine, there is nothing to see here. Four banks have blown up in a week and there will probably be more this week. As usual, this is privatized gains, socialized losses. We will be entering a deep recession and you should make sure that you and your families are prepared. Hard assets are probably good right now - gold is up. Disclaimer: This is not financial advice and I am not a financial advisor just a mom in her basement. Sources: https://archive.is/xOIof https://cointelegraph.com/news/us-fed-announces-25b-in-funding-to-backstop-banks https://archive.is/4QPOo https://archive.is/DesWR https://www.channelnewsasia.com/business/dollar-drops-fed-rate-hike-expectations-trimmed-svb-collapse-3342271 https://nypost.com/2023/03/11/why-the-us-dollar-has-become-an-at-risk-currency/ https://www.cryptopolitan.com/first-republic-bank-nears-collapse/ https://twitter.com/DeItaone/status/1635267245546012672 https://twitter.com/GRDecter/status/1635270594056052738 https://twitter.com/NBCNews/status/1635270092790308864 https://twitter.com/GRDecter/status/1635267412319948802 https://twitter.com/TheMaverickWS/status/1635226018222059520 https://twitter.com/BrianRoemmele/status/1635281542619729921 https://twitter.com/RepThomasMassie/status/1635074378454147074 https://twitter.com/MikeBenzCyber/status/1635122215460151298 https://twitter.com/TheMaverickWS/status/1635228973998428165 https://twitter.com/WallStreetSilv/status/1635273862253543426 https://twitter.com/The_Real_Fly/status/16352...https://nicecrew.tv/static/streaming-playlists/hls/2be181fc-441a-45f8-91e9-9d68a3448aa3/eb8cdc36-ecc9-46e6-be69-5dc276831c50-master.m3u8https://nicecrew.tv/videos/embed/6qhaKDNBsS1me9eb3yTMxi1594002024-04-02T17:04:22.959Zsilicon valley banksignature bankbanksbank crisisbank failuresYESRadix Verum ☦NOhttps://nicecrew.tv/w/xhRU3xgFPoV3W9R8bCeo66https://nicecrew.tv/lazy-static/thumbnails/90f7d64c-c552-494b-bd88-decf53cc5143.jpgYellen Allowed Some Firms to Transfer Funds OUT of Silicon Valley Bank Prior to Seizure by FedsThe Biden Administration along with Janet Yellen at the Fed allowed Israeli firms to quietly transfer around $1 billion out of Silicon Valley Bank prior to the FDIC takeover. Isn't that nice? The CEO of SVB knew in advance and sold off the stock, engaging in illegal insider trading. Will he be held accountable? Peter Thiel, of Palantir and Founders Fund, began warning others to remove funds from SVB when the bank announced it would be selling assets to try to shore up money. Within HOURS depositors tried to remove $42 billion from the bank, in essence, a bank run. What caused so much panic? It took 10 days for the last major bank failure. SVB collapsed in just 48 hours. Also, most of the money in SVB was not insured. Where was it coming from? What about the intelligence community? The IC is tied into Silicon Valley. Google for example got its start in a joint CIA/NSA research grant. Was SVB awash in black ops money? Were they engaged in money laundering? Were they doing business with the Cartels? What about the Jeffrey Epstein lawsuit? Sources: https://www.reuters.com/legal/jpmorgan-must-hand-over-ceo-dimons-records-jeffrey-epstein-lawsuit-2023-03-09/ https://www.jewishpress.com/news/israel/silicon-valley-bank-tanked-dragging-down-500-israeli-startups/2023/03/10/ https://asia.nikkei.com/Business/Finance/Silicon-Valley-Bank-s-China-venture-says-operations-sound https://apnews.com/article/israel-economy-startup-silicon-valley-bank-6249e35821a884ce502576988cce22de https://www.informationliberation.com/?id=63639 https://www.iqt.org/portfolio/ https://www.defenseone.com/technology/2017/11/china-and-cia-are-competing-fund-silicon-valleys-ai-startups/142508/ https://intelligencecommunitynews.com/dhs-st-showcases-silicon-valley-innovation-program/ Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.subst...https://nicecrew.tv/static/streaming-playlists/hls/fd65f2f7-6417-4270-a0d3-4d2eb5454707/6fb7346e-739d-4f69-b92b-c47492c2e72d-master.m3u8https://nicecrew.tv/videos/embed/xhRU3xgFPoV3W9R8bCeo661047002024-04-02T17:04:34.688ZJoe BidenJanet YellenFederal ReserveFedSVBYESRadix Verum ☦NOhttps://nicecrew.tv/w/62pNqL94Qd9wu2FMD74VPXhttps://nicecrew.tv/lazy-static/thumbnails/a0d1806f-e43b-4646-8980-0cb565356018.jpgOde to the BankersThis is my ode to the banking cartels and the global elites. Music Credit: Ross Bugden https://youtu.be/q5w5VX4tAD4 Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #banks #bankers #banking #finance #financialcrisis #markets #marketcrash #globalfinancialcrisis #rothschild #centralbanks #federalreserve #debt #bailouts #lehmanbrothers #goldmansachs #jimcramer #wallstreet #stocks #bankcollapsehttps://nicecrew.tv/static/streaming-playlists/hls/28b01ac8-d6b9-45c9-bf75-7ca16d492409/d8f58923-12c9-4d45-9e67-1170ef95c9a9-master.m3u8https://nicecrew.tv/videos/embed/62pNqL94Qd9wu2FMD74VPX341012024-04-02T17:04:45.328Zbanking crisisbank collapselehman brothersgoldman sachsrothschildYESRadix Verum ☦NOhttps://nicecrew.tv/w/fFevZcUdrN4qhK3gWFk5jWhttps://nicecrew.tv/lazy-static/thumbnails/070f1f00-bbe5-47f6-a8cf-c9b573463d9c.jpgThis Was the Agenda ALL ALONG...I believe that we are seeing a concerted plan on behalf of the powers that be to collapse the financial system, and then present their solution to the desperate masses. I think the goal is to crash the global economy, in what could be a recession worse than the 2008 one and to then offer CBDC's to save the day. They might even call them "freedom coins." The central bankers have had this planned all along. They have devalued the dollar and we have unsustainable levels of debt. The big banks are now benefiting from special protections that small and regional banks do not. How is that for a free market? CBDC's: https://youtu.be/XPxFSlfQxSk Support my work!: Venmo: https://venmo.com/Radixverum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #SVB #siliconvalleybank #signaturebank #silvergatebank #firstrepublic #creditsuisse #banks #bankcrisis #banking #bankcollapse #regionalbanks #bigbanks #bankers #federalreserve #janetyellenhttps://nicecrew.tv/static/streaming-playlists/hls/76da4746-8c12-4847-a713-9ac22e270cc2/3d3e6faf-2f02-4ed7-9f95-ad3e4f94cc86-master.m3u8https://nicecrew.tv/videos/embed/fFevZcUdrN4qhK3gWFk5jW1006002024-04-02T17:04:55.290ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/gs6SnUbSDaXowR5oxp7rCrhttps://nicecrew.tv/lazy-static/thumbnails/417822ce-5146-4726-80df-5da2d51c99b1.jpgPerestroika Deception End Game, WW3, & The Multipolar World OrderFormer KGB official and Soviet defector Anatoliy Golitsyn warned the west about the fake collapse of communism, and the fake fall of the Soviet Union. In his first book, "New Lies for Old," Golitsyn predicted events that took place in Eastern Europe and the Soviet Union between 1989-1991. He has been credited with having a 94 percent prediction success rate, which is unprecedented. All signs seem to be pointing to a future kinetic conflict between the west and a reunited Russia & China working together as a "closed fist" to crush the west. Golitsyn said this was all part of the soviet long-range strategy. Is Chinese Leader Xi Jinping's 3-day visit to Moscow to see Putin a signal of the coming conflict and the future multipolar world order Russia and China and pushing for? Sources: https://twitter.com/apocalypseos/status/1637765820003794944 https://twitter.com/WarMonitors/status/1637768695798743044 https://twitter.com/GraphicW5/status/1637794777646112768 https://twitter.com/CollinRugg/status/1637868331981217792 https://twitter.com/RealPepeEscobar/status/1637824003778723841 https://twitter.com/stmichaelsswor1/status/1635060425921552385 https://www.jpost.com/Opinion/Israel-and-the-unexpected-new-world-order-499310 https://theweek.com/articles/562830/why-russia-should-take-over-israels-defense-from-america https://www.theguardian.com/world/2011/aug/17/israel-soviet-immigrants-transform-country https://www.americanthinker.com/articles/2009/09/the_perestroika_deception.html https://twitter.com/TPostMillennial/status/1637889082633101327 https://twitter.com/nytimes/status/1637788620403736579 https://twitter.com/Kanthan2030/status/1637366822902321153 https://twitter.com/GoldTelegraph_/status/1637882406891053057 https://twitter.com/WarMonitors/status/1637548664741568513 https://www.thegatewaypundit.com/2023/03/putin-meets-with-xi-jinping-announces-plans-for-new-emerging-global-world-order-russia-announces-support-for-china-taiwan-reunification/?utm_source=rss&utm_mediu...https://nicecrew.tv/static/streaming-playlists/hls/7d1e08d8-ef15-4b27-ada1-6cecc7f42905/c4229aba-0c11-4daa-ae29-ebee2df4d81c-master.m3u8https://nicecrew.tv/videos/embed/gs6SnUbSDaXowR5oxp7rCr28000232024-04-02T17:05:04.809Zchinarussiaxi jinpingputinvladimir putinYESRadix Verum ☦NOhttps://nicecrew.tv/w/sA3emWTt3Xc7Aw2ywECARhhttps://nicecrew.tv/lazy-static/thumbnails/b8263490-6ec0-4361-9dde-7275487eab76.jpgCo-Author of "Patriot Act" Michael Chertoff Paid to do "Secret Assignments" for the US Supreme CourtIt has been revealed that the U.S. Supreme Court has been paying Michael Chertoff, via his consulting firm The Chertoff Group, to do "secret assignments" for them related to "security issues." Michael Chertoff is the co-author of the infamous PATRIOT ACT which is responsible for the erosion of civil rights and the creation of a sprawling surveillance and security state in the wake of 9/11. Chertoff was tapped to head the DHS Disinformation Governance Board prior to Nina. Sources: https://www.politico.com/news/2023/03/21/supreme-court-michael-chertoff-00088119 https://twitter.com/hash_tigre/status/1483305844829687809 http://www.takeoverworld.info/chertoff.html https://twitter.com/modernhomesla/status/1233227034186248193 https://www.bushstole04.com/911/alfonso.htm Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #supremecourt #dobbs #dobbsleak #chertoff #chertoffgroup #michaelchertoff #dhs #patriotact #gwot #peterthiel #jeffreyepstein #carbyne911https://nicecrew.tv/static/streaming-playlists/hls/d74e4491-dd16-4e62-adcd-92650019f532/a14890a6-0b69-44e0-968e-21208c064408-master.m3u8https://nicecrew.tv/videos/embed/sA3emWTt3Xc7Aw2ywECARh1018002024-04-02T17:05:16.762Zsupreme courtmichael chertoffchertoff groupdhshomeland securityYESRadix Verum ☦NOhttps://nicecrew.tv/w/bn7s4KBuSPQxdJckLDFxichttps://nicecrew.tv/lazy-static/thumbnails/3f8882f2-b66a-431c-8879-bb9374a65ed9.jpgDOJ Accused of Using FBI Informant to Spy on Proud Boys Defense Team in J6 CaseLawyers for Proud Boys defendant Zachary Rehl have accused the Department of Justice of using FBI Informants to spy on and infiltrate the defense team. The lawyers go on to mention that there could be as many as a dozen undisclosed confidential human sources. They accused the FBI and DOJ of withholding information they are required by the court to produce as part of discovery obligations. Sources: https://twitter.com/julie_kelly2/status/1638619833125183496 https://twitter.com/julie_kelly2/status/1638884598644867073 https://twitter.com/julie_kelly2/status/1638897203501473792 https://headlineusa.com/in-jan-6-case-merrick-garland-recycles-dirty-spy-tactic-used-in-okc-bomb-prosecution/ https://twitter.com/JD_Cashless/status/1638694662696230912 https://twitter.com/NoVA_Campaigns/status/1638511440213471233 DOCUMENTARY TRAILER: https://youtu.be/APGf2vabwmw DOCUMENTARY FUNDRAISER: https://givesendgo.com/radixverum or www.kandkfilm.com Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #doj #fbi #court #proudboys #defense #trial #fbimisconduct #censorship #suppression #dueprocess #j6 #enriquetarrio #joebiggs #zacharyrehl #seditiousconspiracyhttps://nicecrew.tv/static/streaming-playlists/hls/53edfaf8-1d3e-4779-a32f-ddb70da54a69/9ed95db4-6ab8-458c-9e10-958f62cb09a1-master.m3u8https://nicecrew.tv/videos/embed/bn7s4KBuSPQxdJckLDFxic1795002024-04-02T17:05:27.264Zproud boyszachary rehlenrique tarriojoseph biggsseditious conspiracyYESRadix Verum ☦NOhttps://nicecrew.tv/w/sV3tMfe6NWAB1FTjcQdzf8https://nicecrew.tv/lazy-static/thumbnails/eb4d18da-f1b3-4061-a2fe-f7d90789f5f2.jpgFive Banks RAIDED in France as Pension Protests Rage OnFrance’s financial prosecutor is searching 5 banks as part of a probe into tax fraud and money laundering, according to a statement Tuesday. The raids relate to a dividend arbitrage strategy known as Cum-Cum where shareholders transferred stock for a short period to investors based abroad to avoid a dividend tax. Investors held the shares during the period when dividends were paid out and either weren’t taxed or taxes were refunded. They then sold the securities back to the original owner and the amount saved was split between the parties. Sources: https://twitter.com/GRDecter/status/1640690853797670912 https://twitter.com/RadarHits/status/1640687811656392706 https://archive.is/5rhUN https://www.telegraph.co.uk/business/2023/03/28/ftse-100-markets-live-inflation-crypto-trading-news-banks-sugar/?utm_content=telegraph&utm_medium=Social&utm_campaign=Echobox&utm_source=Twitter#Echobox=1680008057 https://www.lemonde.fr/les-decodeurs/article/2023/03/28/la-societe-generale-bnp-paribas-exane-natixis-et-hsbc-visees-par-des-perquisitions-dans-un-scandale-de-fraude-fiscale-hors-norme_6167273_4355770.html?utm_campaign=Lehuit&utm_medium=Social&utm_source=Twitter https://twitter.com/ChuckCallesto/status/1640683051158994944 https://twitter.com/BernieSpofforth/status/1640608962494988291 https://twitter.com/frantruth/status/1636064714340925449 https://twitter.com/sahouraxo/status/1639330527831367680 https://twitter.com/CBSNews/status/1640715698287808512 https://twitter.com/Spriter99880/status/1640716009618427907 https://twitter.com/Risemelbourne/status/1640636147000041472 https://twitter.com/ConMurphyCarlow/status/1640657508590055427 https://twitter.com/rastarocket16/status/1639679588111400962 Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum https://donorbox.org/support-radix https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #france #banks ...https://nicecrew.tv/static/streaming-playlists/hls/d9f58d7c-ecd7-40bf-a2e5-eec42f1afa97/da05fd91-36e8-4b9f-83c9-abeb786506c7-master.m3u8https://nicecrew.tv/videos/embed/sV3tMfe6NWAB1FTjcQdzf81100002024-04-02T17:05:37.973Zfrancebank raidsfive banks raided5 banks raidedmacronYESRadix Verum ☦NOhttps://nicecrew.tv/w/dc4hTJ6MsUHreQK8yJTwnVhttps://nicecrew.tv/lazy-static/thumbnails/f585639f-b508-468c-916c-d2cb8843267e.jpgIt's Just A MemeProbably. https://nicecrew.tv/static/streaming-playlists/hls/62b8dfa9-fd33-4da9-86bb-bbaa033c3b07/4fa1adbd-10d0-41cb-b6be-a926c83b92aa-master.m3u8https://nicecrew.tv/videos/embed/dc4hTJ6MsUHreQK8yJTwnV625132024-04-03T12:38:30.333ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/1gsYdKg5TZWdnqiQEfCWJ1https://nicecrew.tv/lazy-static/thumbnails/bb144c9f-8770-4f7d-969a-ebb440efe255.jpgDay 1 of NO coffee and caffeine. How do y'all do this?Day 1 of NO coffee and caffeine. How do y'all do this?https://nicecrew.tv/static/streaming-playlists/hls/0228c6e7-dcd2-420d-bebe-10ddc8c611dc/60792f4e-336e-489e-8092-9c6c56845586-master.m3u8https://nicecrew.tv/videos/embed/1gsYdKg5TZWdnqiQEfCWJ149582024-04-04T17:21:39.728ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/jVLqPxVBtiUbD29Tu9STTLhttps://nicecrew.tv/lazy-static/thumbnails/7b798e1f-f24e-4cac-97e3-71f9d2d76c93.jpgBizarre Update: Has Russell "Duke" Vane IV Faked his Death?Bizarre update to the last two videos I did covering a story broken by Ford Fischer at News2Share regarding a potential entrapment plot against a Virginia militia group called the Kekoas. source: https://twitter.com/FordFischer/status/1775899091677192415 Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #news #virginia #highstrangenesshttps://nicecrew.tv/static/streaming-playlists/hls/99464b9d-96a6-4f82-bad9-4ce600c2b976/292555f2-cdcd-4e2a-a645-5ee03dffbdb1-master.m3u8https://nicecrew.tv/videos/embed/jVLqPxVBtiUbD29Tu9STTL7455102024-04-04T17:23:09.625ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/mGjguqhU3EvWzRUaJBFe2Rhttps://nicecrew.tv/lazy-static/thumbnails/935e0113-978d-4b2a-9382-77b88cd3ba40.jpgEmergency Alert System: A Faggot On The TimelineEmergency Alert System: A Faggot On The Timelinehttps://nicecrew.tv/static/streaming-playlists/hls/a797c80f-201c-490e-91a2-cbde491a8207/1ac67f63-3254-4215-bb06-cde3d2745d0e-master.m3u8https://nicecrew.tv/videos/embed/mGjguqhU3EvWzRUaJBFe2R72522024-04-05T20:51:57.316ZYESMain owl channelNOhttps://nicecrew.tv/w/hSnTxVPCLQES3DFJa28YGihttps://nicecrew.tv/lazy-static/thumbnails/377d2d8e-5d15-451f-a820-815c4207e20c.jpgJJR - 248 - It's The Final CountdownWith the most shaky disjointed delivery I could muster, I go over the endless warnings and bizarre happenings centered around the eclipse set to take place Monday. Also war over cow ashes and big rock, this week in IRL activism, Romeo where you is, and some bizarre degenerate dance performance to cap the whole train wreck off.https://nicecrew.tv/static/streaming-playlists/hls/889ae581-dfe1-4a0e-9dbe-50905409c0c9/91b48cd8-7353-49b6-92f4-eb387a75dfe8-master.m3u8https://nicecrew.tv/videos/embed/hSnTxVPCLQES3DFJa28YGi66215302024-04-08T04:42:55.444ZYESJust Joe Radio NOhttps://nicecrew.tv/w/3oPogqbfCiqTZqS35hpTVWhttps://nicecrew.tv/lazy-static/thumbnails/1f6da50e-1f73-4fb2-b89c-fc94e24ff3d2.jpgJJR - 249 - Toxicity Rating 88%Sunday night Eclipse Eve solo show I walk through the world's first Toxicity Rating system, Coolock calls shenanigans, trans-terrorist gaslighting, zippertits Joker, it's not about guacamole, Greta milkers, and oh so so muchhttps://nicecrew.tv/static/streaming-playlists/hls/1361d774-8573-4d53-9554-ff189f4522fc/b97a9bf0-46f5-4215-b814-78a6070d6879-master.m3u8https://nicecrew.tv/videos/embed/3oPogqbfCiqTZqS35hpTVW91925492024-04-08T04:41:42.559ZYESJust Joe Radio NOhttps://nicecrew.tv/w/e141KMZHPK5Cdni8rMJ1hUhttps://nicecrew.tv/lazy-static/thumbnails/91a6a554-81cb-4a4b-9a90-988fa3f8cf81.jpgHell Divers 2- Level 8 bug diveHell Divers 2- Level 8 bug divehttps://nicecrew.tv/static/streaming-playlists/hls/6948a8cf-a2a1-4de4-8710-df7dce888214/52ddb03e-8ee7-432f-ba17-f0739758a98e-master.m3u8https://nicecrew.tv/videos/embed/e141KMZHPK5Cdni8rMJ1hU1636092024-04-09T02:15:16.499ZYESMain omega_variant channelNOhttps://nicecrew.tv/w/36FrE8kJmLg7PRU7ZyrUbJhttps://nicecrew.tv/lazy-static/thumbnails/75e03332-779d-4cda-814e-0d8d694fe8c1.jpgJacob Hersant (Future)Jacob Hersant breaks it down for the White people who have not yet awaken. "They will never stop" https://nicecrew.tv/static/streaming-playlists/hls/10fd4dab-2a39-42c1-a5ef-53fb9901dcc6/0ee8f8f3-b00e-43fe-91cd-2c5ca46fd021-master.m3u8https://nicecrew.tv/videos/embed/36FrE8kJmLg7PRU7ZyrUbJ185092024-04-08T22:39:37.485ZYESMain killyourtv channelNOhttps://nicecrew.tv/w/bWLzNPVEGWWHz1Hx52jPujhttps://nicecrew.tv/lazy-static/thumbnails/32172c4d-6462-4728-9004-afaf9e14248d.jpgSuper Floyd 64Super Floyd 64https://nicecrew.tv/static/streaming-playlists/hls/58a1067d-f08e-41f3-be54-bae2783a48a6/84bb26e1-9f47-4d19-ab35-28a703bdc30f-master.m3u8https://nicecrew.tv/videos/embed/bWLzNPVEGWWHz1Hx52jPuj5351252024-04-08T23:04:49.639ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/2nziBk9CGhpPJBf8wuHSZShttps://nicecrew.tv/lazy-static/thumbnails/0a8482ef-52a7-4e35-96ee-b80ac9d7a7cb.jpgFederal Agent Brags About EntrapmentWell it's not *technically* entrapment if you give someone the tools they need to commit terrorism and then brainwash them into committing terrorism. They weren't forced to do the crime you know! https://nicecrew.tv/static/streaming-playlists/hls/0b1c482b-0385-40ae-b038-d35359dbfecc/a54aa38d-3f29-4d4d-a7da-41f1d8e9c0b8-master.m3u8https://nicecrew.tv/videos/embed/2nziBk9CGhpPJBf8wuHSZS468572024-04-09T17:39:01.384ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/34bEuBCQh45U5TGqbiwcJbhttps://nicecrew.tv/lazy-static/thumbnails/33c5990e-6cdb-45a5-8aa9-23c4653ddc01.jpgDid the FBI Target and Entrap a Mentally Ill Teen from Coeur d’Alene?The FBI and DOJ have arrested and charged 18-year-old Alexander Mercurio with "providing material support" for ISIS. Mercurio appeared to have been in contact with around 5 feds. Sources: https://twitter.com/FordFischer/status/1777523101204447308 https://twitter.com/IdahoTribune/status/1777533074299081011 https://www.justice.gov/opa/media/1347116/dl?inline=&utm_medium=email&utm_source=govdelivery https://twitter.com/FordFischer/status/1777365362738098667 Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/10a41492-2ad9-4eff-a52b-70a01e95d61a/f2bf5621-a44e-4800-8ee5-7d4d67f9447e-master.m3u8https://nicecrew.tv/videos/embed/34bEuBCQh45U5TGqbiwcJb1075542024-04-09T19:39:07.782ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/2QgEGCcWpQiJqjRV8nMibmhttps://nicecrew.tv/lazy-static/thumbnails/33bff51e-a69e-4739-8a74-2d42aeb3c74e.jpgEverything on YouTube sucks now and is the same...a rant. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/0ed67eb2-17bc-42fd-9079-98768404c434/c28c68fb-74ee-4651-ac16-546b795271fb-master.m3u8https://nicecrew.tv/videos/embed/2QgEGCcWpQiJqjRV8nMibm9555192024-04-09T20:38:49.698ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/iUmvyWPDDkEWzfoBvj2TUQhttps://nicecrew.tv/lazy-static/thumbnails/56803687-a732-451f-8b25-869d1b180b24.jpgThe ShipwreckersThis is the 2nd release from a planned full album taking audio from Floods audiobook of White Power by George Lincoln Rockwell.https://nicecrew.tv/static/streaming-playlists/hls/90faac41-2692-47f8-a29b-41ac095ee44c/7fa40299-e73c-4cf6-a59e-8e7396bb228d-master.m3u8https://nicecrew.tv/videos/embed/iUmvyWPDDkEWzfoBvj2TUQ227542024-04-10T01:19:40.253ZYESMain killyourtv channelNOhttps://nicecrew.tv/w/rh6njXrzMJ2geYuuENJZjLhttps://nicecrew.tv/lazy-static/thumbnails/cd28ea53-fa4f-4bea-838c-5066223f39c3.jpgWords carry weight and are powerfulI wanted to do a short video today talking about the power and weight of words. This is something the Bible tells us throughout both the Old and New Testaments. Scripture tells us words hold immense power; the Lord spoke the world into being. Our words can shape destinies, build or destroy relationships, and influence the course of history: Proverbs 18:21 tells us “Death and life are in the power of the tongue: and they that love it shall eat the fruit thereof.” James 3:6 warns “And the tongue is a fire, a world of iniquity: so is the tongue among our members, that it defileth the whole body, and setteth on fire the course of nature; and it is set on fire of hell.” Proverbs 12:18 says “There is that speaketh like the piercings of a sword: but the tongue of the wise is health.” Proverbs 15:4 reads “A wholesome tongue is a tree of life: but perverseness therein is a breach in the spirit.” Ephesians 4:29 warns “Let no corrupt communication proceed out of your mouth, but that which is good to the use of edifying, that it may minister grace unto the hearers.” Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #words #powerfulwords #scriptire #bible #prayerhttps://nicecrew.tv/static/streaming-playlists/hls/ccb3acbe-b20e-4588-ba3c-edfa93908d74/719d1c36-4d8c-4a2b-ac47-10b3d1529fbf-master.m3u8https://nicecrew.tv/videos/embed/rh6njXrzMJ2geYuuENJZjL662552024-04-10T18:38:46.917ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/n5qb8jnPFX2JjJw8qtE7behttps://nicecrew.tv/lazy-static/thumbnails/ca1d101d-0512-4be8-ac39-e2b74193735e.jpgFBI Visits Man For Alleged Social Media ActivitiesNever agree to an interview. Always consult legal counsel. Do not let them bully you. They are not your friends. https://nicecrew.tv/static/streaming-playlists/hls/aaadc8f9-a87b-466c-a603-569df5e0df89/fd2f139f-e786-435c-a8cb-f30cb403d257-master.m3u8https://nicecrew.tv/videos/embed/n5qb8jnPFX2JjJw8qtE7be1440332024-04-12T17:54:41.160ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/uheRNWmMs6LdZEB1mMEAP8https://nicecrew.tv/lazy-static/thumbnails/7e3ddadc-b4e5-43fd-80fe-c1cca59e1154.jpgMajor Update! Russell Richardson Vane, IV Arrested?! Confirmed Fed?We have a major update on a story we have been covering broken by Ford Fischer of News2share regarding a man Russell Richardson Vane, IV who was ousted from a Virginia Militia called the Kekoas for allegedly attempting an entrapment scheme. Source: https://twitter.com/FordFischer/status/1778994130258948312 Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/e50452d5-e9f2-46a8-adf2-c9250ea54735/2015df30-c541-4200-8f9e-9d8be5f7765c-master.m3u8https://nicecrew.tv/videos/embed/uheRNWmMs6LdZEB1mMEAP812815122024-04-13T17:47:00.546ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/dRLNQBuFd13ZsykK6ezdashttps://nicecrew.tv/lazy-static/thumbnails/55f205f7-3c37-46ab-896d-07ff2c5f5555.jpgCan I Get a Bagel with Cream CheeseCan I Get a Bagel with Cream Cheesehttps://nicecrew.tv/static/streaming-playlists/hls/6820b8e7-bfa3-482a-946e-dd406a2f612c/f35be201-6fac-43ca-9fc0-c400cddfa6b1-master.m3u8https://nicecrew.tv/videos/embed/dRLNQBuFd13ZsykK6ezdas375372024-04-15T11:33:55.343ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/mLbNbdTbhFFviFsD8zmtfphttps://nicecrew.tv/lazy-static/thumbnails/4bde43e9-2330-4c8b-9f69-ae98c6c94a16.jpghevc test 6should play on Windows and mobile devices, but not Linux.https://nicecrew.tv/static/streaming-playlists/hls/a8222706-39fd-486a-809a-4601c12d4cdf/e781b9e7-159f-49fc-ae71-3897d6b244fb-master.m3u8https://nicecrew.tv/videos/embed/mLbNbdTbhFFviFsD8zmtfp1025432024-04-16T01:22:28.633ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/8fkGojbxfGW7kqpLfwuTRwhttps://nicecrew.tv/lazy-static/thumbnails/62ca97d4-1e08-4e7f-95f8-7ee288dfbb45.jpgUpdate on Militia Provocateur Russell R. Vane IV aka "Duke" - I Attended his Detention HearingI attended the detention hearing for Russell Richardson Vane IV aka "Duke" at the Eastern District Courthouse. It turned into a preliminary hearing that was very strange. Vane definitely works for a government agency and the intelligence community, like his father. Vane was outted by the Virginia Kekoas militia group after he seemingly tried to entrap them and after the story broke and he tried to fake his own death and change his identity he was arrested. I wanted to provide my coverage, see also Ford Fischer with News2Share for more coverage on this story. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/3ab0858c-1627-4d9d-b2f2-1407fcab8ee4/d15fc5ff-e853-4dc3-97bd-e5e11808fa94-master.m3u8https://nicecrew.tv/videos/embed/8fkGojbxfGW7kqpLfwuTRw488592024-04-16T03:26:37.541ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/kvXYxec5JJ7ho6JTVaqKgMhttps://nicecrew.tv/lazy-static/thumbnails/c12f79c9-601e-4df8-b6b7-9d866bfa3eec.jpgCocktails, News & ViewsGeorge & Moddy help make sense of the nonsensical things that are disguised as "News." Chat-Centrichttps://nicecrew.tv/static/streaming-playlists/hls/9e0cb316-c1ac-4c49-986a-d4a12448a4cf/f1d41d47-1cbb-4710-9120-3900270c56d6-master.m3u8https://nicecrew.tv/videos/embed/kvXYxec5JJ7ho6JTVaqKgM69405352024-04-17T02:03:52.708ZYESCocktails With George & ModdyNOhttps://nicecrew.tv/w/qeiykjbTXTN88HFSZycfchhttps://nicecrew.tv/lazy-static/thumbnails/b8d03b6d-727b-4a7b-806b-380ab9117a3b.jpgKYSKYShttps://nicecrew.tv/static/streaming-playlists/hls/c436d128-5e85-490c-a77c-d5c17eb299de/e5757935-0821-4e52-b000-ee61a083507e-master.m3u8https://nicecrew.tv/videos/embed/qeiykjbTXTN88HFSZycfch300112024-04-18T03:41:52.883ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/o6JaQo5L9d6MZQYuTBdX39https://nicecrew.tv/lazy-static/thumbnails/d6ff78c4-6905-411d-a905-b58bfe5222af.jpgBroke(n) by Design: Thoughts on Gen Z and the Cost of Living CrisisI wanted to do a video talking about Gen Z and the cost-of-living crisis. The cost of living has skyrocketed, and we are absolutely in a recession or depression. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #genz #costofliving #costoflivingcrisis #inflation #recession #depression #2024 #economy #jobs #zoomers #debt #boomershttps://nicecrew.tv/static/streaming-playlists/hls/b2f5c1dd-2a8a-494f-a25e-701bfba91628/5fa2fba9-1fbc-42c8-8030-cf307b93ef5b-master.m3u8https://nicecrew.tv/videos/embed/o6JaQo5L9d6MZQYuTBdX3936955292024-04-18T21:53:35.990Zgen zgeneration zgen alphaboomersbaby boomersYESRadix Verum ☦NOhttps://nicecrew.tv/w/7Cayz4uNKxwDCZU8HpkV6nhttps://nicecrew.tv/lazy-static/thumbnails/bf601552-ecd6-43db-8fb8-e9993131b10e.jpgPull That Shit Up JamiePull That Shit Up Jamiehttps://nicecrew.tv/static/streaming-playlists/hls/35a3800c-d18f-4479-a051-9289c503d073/35b0fe7b-1030-4c27-b239-5d2d2a828e32-master.m3u8https://nicecrew.tv/videos/embed/7Cayz4uNKxwDCZU8HpkV6n70082024-04-19T11:20:23.620ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/7ePbN8pcvKAbWGhbT9uc4Jhttps://nicecrew.tv/lazy-static/thumbnails/46a29b50-790d-493b-921e-f86b752cf8d8.jpgCocktails, News and Views with George & Moddy LIVE April 19, 2024George & Moddy help make sense of the nonsensical things that are disguised as "News." Chat-Centric. Good timeshttps://nicecrew.tv/static/streaming-playlists/hls/32849498-956e-4959-bd51-6abb2f1bd7a4/4ddfc74c-5095-4757-b461-8583964289ee-master.m3u8https://nicecrew.tv/videos/embed/7ePbN8pcvKAbWGhbT9uc4J66825202024-04-20T01:58:44.491ZYESCocktails With George & ModdyNOhttps://nicecrew.tv/w/4ddatm5FVGk5VVJ2BJh7s7https://nicecrew.tv/lazy-static/thumbnails/d7402e87-9f6b-4c51-9cbb-5e955d3480f0.jpgThe Effects of DEI in ATCA Southwest and Jetblue air liner almost collided after DEI Americans in Air Traffic Control directed the Southwest air liner to cross a runway where the Jetblue plane was already cleared for takeoff. https://nicecrew.tv/static/streaming-playlists/hls/19ffd64d-8d3a-4c00-b162-097ba94e4f02/109950fe-ae40-476a-a9bd-a7ea18305a1e-master.m3u8https://nicecrew.tv/videos/embed/4ddatm5FVGk5VVJ2BJh7s764042024-04-20T12:55:19.556ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/qXqpwveSs5MZitQT11AeLchttps://nicecrew.tv/lazy-static/thumbnails/2714f3b5-91ef-410d-9c99-0b8deb308ddf.jpgMan Sets Himself on Fire Outside of CourthouseMaxwell Azzarello of St. Augustine, Florida set himself on fire outside of the courthouse where Trump's "hush money" trial is taking place. He was pronounced deceased several hours later. Stop setting yourself on fire for stupid shit. It's gay and does nothing.https://nicecrew.tv/static/streaming-playlists/hls/ca184693-6f31-47a0-8036-30859e98a5e7/dc76676a-9ab2-4733-a5ab-bf12d4243cba-master.m3u8https://nicecrew.tv/videos/embed/qXqpwveSs5MZitQT11AeLc595382024-04-20T13:14:07.615Zmaxwell azzarellotrumpcourtYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/3T1gF6Z3Zkvv6WjuR3n65whttps://nicecrew.tv/lazy-static/thumbnails/feb05fdc-d4ff-4458-9765-6c721a4e7f4c.jpgViva La FührerHappy 4/20, mein niggashttps://nicecrew.tv/static/streaming-playlists/hls/1751604a-546a-4f84-a5af-d1b0458bd5c2/bfe554d9-268f-4457-89ed-65332a77af99-master.m3u8https://nicecrew.tv/videos/embed/3T1gF6Z3Zkvv6WjuR3n65w27651692024-04-20T13:49:16.570Zhitlerviva la vidacoldplay cover420YESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/uF9HsdRcUETDot3QKK5ce8https://nicecrew.tv/lazy-static/thumbnails/129427f7-42a8-4009-bb21-232e6f876678.jpgUpdate on Quitting Coffee and Caffeine!Update on Quitting Coffee and Caffeine!https://nicecrew.tv/static/streaming-playlists/hls/e8374297-d0d4-4474-a90e-80b34e8553b5/ca960442-c793-4918-afcf-c0f334e8e986-master.m3u8https://nicecrew.tv/videos/embed/uF9HsdRcUETDot3QKK5ce8595172024-04-20T16:41:11.785ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/vZuKc3sxLHdHKQYZneGmiuhttps://nicecrew.tv/lazy-static/thumbnails/97a7bc01-9cc9-4aa7-aa95-d703a0c994c7.jpgI have an exciting documentary film update, but I also need your help!I have an exciting update on the status of our independent documentary film, but I am also struggling, and I need your help. Thank you all, I love you all so much! To support the documentary: https://www.kandkfilm.com/donate Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #film #independentfilmmaker #documentary #indiefilm #filmmakinghttps://nicecrew.tv/static/streaming-playlists/hls/f2e0216c-2de3-427e-ae36-085973f1c336/58c6a577-4191-4626-b1ad-6d36179eb018-master.m3u8https://nicecrew.tv/videos/embed/vZuKc3sxLHdHKQYZneGmiu19755122024-04-22T18:47:06.065ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/cooQtrKoyM22hNeXZ6Vtjghttps://nicecrew.tv/lazy-static/thumbnails/004ed124-f14a-481a-9f95-3e1fc915890f.jpgLIVE Cocktails April 23BREAKING! The world goes mad. Moddy & George unpack the madness. It is FA It will FOhttps://nicecrew.tv/static/streaming-playlists/hls/5c34f612-fece-4ad6-a237-3c1a7ee98d67/fea4c3f1-f31f-4acd-ad3c-15b14ad95380-master.m3u8https://nicecrew.tv/videos/embed/cooQtrKoyM22hNeXZ6Vtjg76625442024-04-24T02:15:43.438ZYESCocktails With George & ModdyNOhttps://nicecrew.tv/w/2ehMJkujcG2sN91jGNwAnyhttps://nicecrew.tv/lazy-static/thumbnails/38d8d537-5739-4afd-af0d-b66e8d2f0241.jpgTrials and Tribulations are Actually Blessings (Do NOT Give Up)Trials, tribulations, and failures are not setbacks, but stepping stones on the path to greatness. Adversity builds character, through our struggles and "failures," we discover our true strength and resilience. Imagine how boring life would be if it was devoid of any obstacles. While it may sound appealing at first, such a life would lack the richness and gradation of experience and the depth of character that comes from facing adversity head-on. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #trials #tribulation #blessings #prayer #motivationhttps://nicecrew.tv/static/streaming-playlists/hls/09f42767-2d70-44b4-8855-0369819be2ba/3f79a3b5-1fa8-49e9-a523-d3a046bd2c79-master.m3u8https://nicecrew.tv/videos/embed/2ehMJkujcG2sN91jGNwAny1485562024-04-24T20:45:12.947ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/k6ZovQ9VZBMM3qX5DYpaWhhttps://nicecrew.tv/lazy-static/thumbnails/053cdc0c-6f99-4e3b-9bda-0c0c055b1e2d.jpgCocktails, News & Views With George & Moddy April 26What a week! Campus riots Politicians facing jail time - but not the ones who should be America does a smash and grab of Russian Assets. Russia sez, "Oh yeah?" We have replenished our supply of left turns. Tune in TONIGHT! 8 Easternhttps://nicecrew.tv/static/streaming-playlists/hls/9ab3b859-319a-4c44-ba13-65a6e2ddca48/f8737413-8a4f-4760-a9d2-8b9a2f586114-master.m3u8https://nicecrew.tv/videos/embed/k6ZovQ9VZBMM3qX5DYpaWh67525682024-04-27T02:01:26.635ZYESCocktails With George & ModdyNOhttps://nicecrew.tv/w/aZEpZD5GzghinwRAvyVY2chttps://nicecrew.tv/lazy-static/thumbnails/59053e76-7fa9-4164-8779-a6ad6caa77cd.jpgNewton Mount Kennedy anti-"Migrant" ProtestProtesters clash with police in Newton Mount Kennedy, Ireland, due to their government importing thousands of "migrants" that the Irish do not want.https://nicecrew.tv/static/streaming-playlists/hls/50ef50ec-40fe-44f1-b201-e2f14c94ea8d/866c58e8-d9ea-40c7-84df-2326a24103b1-master.m3u8https://nicecrew.tv/videos/embed/aZEpZD5GzghinwRAvyVY2c3960282024-04-26T20:43:42.477ZirelandmigrantsinvasiongovernmentprotestYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/bErxruQFGL47snvW1KSdL6https://nicecrew.tv/lazy-static/thumbnails/465e548f-4b62-455c-af23-03d67788dc51.jpgViolent CrimeDamn WOKE DEMOCRATS!!!!! https://nicecrew.tv/static/streaming-playlists/hls/56596405-e5e6-4cb7-9078-951cba2e602d/c032c49e-7f33-4839-adc6-5708db7e2e05-master.m3u8https://nicecrew.tv/videos/embed/bErxruQFGL47snvW1KSdL61060112024-04-28T14:00:49.141ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/qWvByncmMbeGoFcJazwY4ahttps://nicecrew.tv/lazy-static/thumbnails/b5504481-707c-4a34-8bbb-190c823a04dd.jpgGretchen "Big Gretch" Whitmer BOOED at NFL Draft in Detroit!Michigan Governor Gretchen Whitmer was met with a chorus of "boos" at the NFL Draft in Detroit. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #whitmer #nfl #NFLDraft #detriot #michiganhttps://nicecrew.tv/static/streaming-playlists/hls/c9f7bdba-2eba-448e-8ae3-434d786de7f7/117554fe-fadb-4d9f-96d8-46cb72c3e107-master.m3u8https://nicecrew.tv/videos/embed/qWvByncmMbeGoFcJazwY4a62522024-04-28T17:41:25.613ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/4N2iywQcu6ws37ezWjP6TShttps://nicecrew.tv/lazy-static/thumbnails/6926590a-030d-423a-9a00-6f91b9b28b20.jpgTrevor Bauer Vindicated AGAIN! Second Accuser Faces Felony Charges and JailTrevor Bauer, former star pitcher for the Dodgers turned victim of #metoo extortion schemes has been vindicated once again as another accuser faces felony charges and up to 16 years in prison. Sources: https://twitter.com/BauerOutage/status/1708904525724270659 https://twitter.com/lindseyhillll/status/1769799182955499724 https://nypost.com/2024/04/16/sports/trevor-bauer-accuser-charged-with-allegedly-defrauding-exiled-mlb-star Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #metoo #trevorbauer #MLB #baseball #sports #falseaccusationshttps://nicecrew.tv/static/streaming-playlists/hls/1eb86ea8-c895-4b77-a33e-a1a30876ee6c/7ac9a995-b97d-405a-b8a7-9a4bd9ff341d-master.m3u8https://nicecrew.tv/videos/embed/4N2iywQcu6ws37ezWjP6TS13475142024-04-28T19:44:45.251ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/wX5x6DjEWMTEdhCGstB8TWhttps://nicecrew.tv/lazy-static/thumbnails/ae4a8b10-0341-4f20-8269-651c2a57c804.jpgWorking on a video ✨Working on a video ✨https://nicecrew.tv/static/streaming-playlists/hls/faa2dcd7-2494-4966-bdc6-3eba99166a28/2d296293-34d2-438c-ad1a-7399bf3e4e78-master.m3u8https://nicecrew.tv/videos/embed/wX5x6DjEWMTEdhCGstB8TW4022024-04-28T23:41:10.915ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/xfbnGCLP7mJ6PAEcKksqtahttps://nicecrew.tv/lazy-static/thumbnails/2a92dca4-2b37-4b6e-a54b-127bd6257ee2.jpgGretchen "Big Gretch" Whitmer BOOED at NFL Draft in Detroit!Michigan Governor Gretchen Whitmer received a very mixed welcome at the NFL Draft in Detroit as she was met with a chorus of partial BOOOOS and not even a kid could be bothered to get excited about her. Sorry for the earlier screw up with the audio. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/fd061ac2-d787-424b-a8ca-5a150f57c367/a321f60f-5d5d-4973-91f2-11a4acfd4b15-master.m3u8https://nicecrew.tv/videos/embed/xfbnGCLP7mJ6PAEcKksqta62042024-04-29T00:41:24.822ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/8PTgLxKvbGriMbnrZfxFVDhttps://nicecrew.tv/lazy-static/thumbnails/873f2ad3-6110-48f7-9136-ff7b1f090210.jpgBootstrappinBootstrappinhttps://nicecrew.tv/static/streaming-playlists/hls/3f5f8674-b37e-4319-b825-560d36657fbb/d010f5fe-c060-45dc-9b08-a8a2e444768b-master.m3u8https://nicecrew.tv/videos/embed/8PTgLxKvbGriMbnrZfxFVD895112024-04-30T13:43:47.102ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/ed71ghjD5XX4Ts47dhePnihttps://nicecrew.tv/lazy-static/thumbnails/de00b3ba-51af-4c3f-9d83-2c00c425523c.jpgCodex Pajeet II: India is the worst country on EarthArchive/mirror of Moonman's magnus opus. This documentary presents the gruesome, disgusting, unfiltered truth about india, narrated by the great Sir David Attenborough in AI voice form. Warning. This film is incredibly revolting and extremely NSFW. Moonman introduced his fine work thus: *After many requests to make a sequel to my original Codex Pajeet. I have finally delivered. For your viewing pleasure, gentlemen of /pol/ I give you Codex Pajeet II: India is the worst country on Earth.* (archived thread: https://archive.4plebs.org/pol/thread/462651292)https://nicecrew.tv/static/streaming-playlists/hls/6af76da1-d705-4fc1-b252-4724997fb7f7/1d3edb16-626f-4cd4-a385-be753d445b86-master.m3u8https://nicecrew.tv/videos/embed/ed71ghjD5XX4Ts47dhePni4931525902024-04-30T16:01:04.651ZNOApocryphaNOhttps://nicecrew.tv/w/txKsfpDbMtWVBNtdqCaqNEhttps://nicecrew.tv/lazy-static/thumbnails/4026fa15-6287-4872-a3e3-2ab70a6b5b08.jpgLife Before the InternetReflections on life before or in the very early stages of the internet. A time when the world was still full of wonder, mystery, and novelty. Time seemed to move more slowly, and things felt more relaxed. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #internet #technology #life #naturehttps://nicecrew.tv/static/streaming-playlists/hls/df15944b-b9e1-4118-a4e3-897761bc051a/ed6057a9-2c9a-4b94-8b45-3b0e41f1f1b9-master.m3u8https://nicecrew.tv/videos/embed/txKsfpDbMtWVBNtdqCaqNE3225112024-04-30T17:01:18.911ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/qNaCsmFAW4Fxbt7DwhZzcZhttps://nicecrew.tv/lazy-static/thumbnails/d52da2cd-4fda-4c98-a7fb-608744bf83a1.jpgQuiet QuittingWhy are the younger generations not pulling themselves up by their bootstraps? https://nicecrew.tv/static/streaming-playlists/hls/c8cd799c-ccac-4f0d-baf2-1daf6288aa43/be921e54-e584-4d80-850b-90eb870d3648-master.m3u8https://nicecrew.tv/videos/embed/qNaCsmFAW4Fxbt7DwhZzcZ1185232024-04-30T20:16:19.760ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/2H8YNH9UauVF3r1eXuJJh2https://nicecrew.tv/lazy-static/thumbnails/9c55e9cc-b09a-438a-81f8-96b8c675d845.jpgConcerning Update on Paul Bellar's AppealI am getting very concerned...   Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/0dd78cfb-6c3e-4cf0-a18a-e55e22c0eb79/70aef7ae-65b7-4370-83ba-c135c83f0051-master.m3u8https://nicecrew.tv/videos/embed/2H8YNH9UauVF3r1eXuJJh2972572024-05-02T17:56:11.295ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/aoQS1qfZ3Wk9oJMpGY7yyYhttps://nicecrew.tv/lazy-static/thumbnails/6d85c2a3-e9b5-4798-9fd2-ce1e65aae6f6.jpgMein Kampf - AudiobookMein Kampf - Adolf Hitler (1925)https://nicecrew.tv/static/streaming-playlists/hls/4c12b928-a4e8-4a47-970d-04ae237f0ba8/d4d6d5a7-5eef-41c9-b962-b6c2c5c12833-master.m3u8https://nicecrew.tv/videos/embed/aoQS1qfZ3Wk9oJMpGY7yyY716135162024-05-03T01:53:11.633Zhitlernational socialismpoliticsmein kampfYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/u1UHL4H3xhsrrEXDz4kZoUhttps://nicecrew.tv/lazy-static/thumbnails/ca374435-35d6-4411-b4e1-df48a5aecba5.jpgBlack Woman Begins NoticingGoyim... We have a problem. https://nicecrew.tv/static/streaming-playlists/hls/e2e05f51-17f2-4547-be71-d665d3c1e0bc/9ae37cac-bc6c-48ac-8110-55282285f612-master.m3u8https://nicecrew.tv/videos/embed/u1UHL4H3xhsrrEXDz4kZoU18051472024-05-03T11:30:48.335ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/uCTFQhBqx1aYnVar7ebYtFhttps://nicecrew.tv/lazy-static/thumbnails/d54cd9a0-378c-4d12-9ba5-2d3174e18153.jpgCocktails News and views - RIP 1A EditionRIP 1A Edition Also: AZ Rancher Wins Shot Put protesters El Salvador investigates own Much Morehttps://nicecrew.tv/static/streaming-playlists/hls/e7e682e4-b071-4e76-8ee3-244f8975f105/a8cfa5a0-e7d4-4aa3-bd32-14423be33e6a-master.m3u8https://nicecrew.tv/videos/embed/uCTFQhBqx1aYnVar7ebYtF72805932024-05-04T02:10:15.451ZYESCocktails With George & ModdyNOhttps://nicecrew.tv/w/1yQVZ9VU6doqGvwYFc55Hthttps://nicecrew.tv/lazy-static/thumbnails/35cac614-5fb7-4f51-9e80-3168ad9b0ae1.jpgAlan Dershowitz - Jews Shouldnt Deny Controlling The MediaAlan Dershowitz - Jews Shouldnt Deny Controlling The Mediahttps://nicecrew.tv/static/streaming-playlists/hls/0495f48e-f631-4c15-964d-f1765fb197a5/53b97c98-2e53-4646-bac9-c2d58b54a4f7-master.m3u8https://nicecrew.tv/videos/embed/1yQVZ9VU6doqGvwYFc55Ht740502024-05-03T18:58:41.559ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/pTdRFPtUZLCxVYEigjTFEXhttps://nicecrew.tv/lazy-static/thumbnails/c4935a7d-ebbc-4fec-8e13-49b2120a5e4a.jpgKosher ASMRshabbos shalom, goyim..https://nicecrew.tv/static/streaming-playlists/hls/c1690b6e-3923-4dca-b028-6b4ab063de07/46d625a3-f605-4a25-9cb7-4ae59f2ef3e8-master.m3u8https://nicecrew.tv/videos/embed/pTdRFPtUZLCxVYEigjTFEX32552024-05-05T01:58:15.536ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/mFYeRYnjSRTw5XDsf5fSBThttps://nicecrew.tv/lazy-static/thumbnails/0960586c-033b-46c6-813c-98019e8f5942.jpgJust Joe Radio *LIVE* on NCTV!! - 5/5/2024, 1:31:17 AMJust Joe Radio *LIVE* on NCTV!!https://nicecrew.tv/static/streaming-playlists/hls/a78b7051-4ce0-48ef-beb3-a59efb937059/e8cbd7a2-02a0-4a74-a8b1-e7205f8b8711-master.m3u8https://nicecrew.tv/videos/embed/mFYeRYnjSRTw5XDsf5fSBT99050452024-05-12T22:17:20.555ZYESJust Joe Radio NOhttps://nicecrew.tv/w/vpxpsC7GgAsMmaMrLdGrXAhttps://nicecrew.tv/lazy-static/thumbnails/188986bd-20a6-414d-abf7-7cb26228a359.jpg"Silent Rage": BOP Evades Oversight for "R*pe Club" Women's Prison FCI DublinThe scandal-plagued prison FCI Dublin, a low-level women's prison that came to be known as the "rape club" has been shut down shortly after a U. S District Court Judge appointed a Special Master to oversee reforms to the prison. The appointment of the Special Master was a first in BOP history. Now, with the closure of the prison it seems there will be no oversight and the women will be traumatized all over again, being moved to other prisons across the country. sources: https://www.ktvu.com/news/powerless-in-prison-the-shutdown-of-fci-dublin https://consortiumnews.com/2023/04/19/john-kiriakou-scrap-the-us-bureau-of-prisons/ https://www.ktvu.com/news/6th-dublin-prison-guard-aka-dirty-dick-arrested-on-sex-charges-fbi-raids-home https://www.deseret.com/indepth/2023/6/14/23728001/fci-dublin-warden-convicted-sexual-assault/ https://www.ktvu.com/news/more-than-60-sex-abuse-retaliation-lawsuits-filed-against-officers-at-fci-dublin Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #prison #jail #inmates #fcidublin #womensprison #bophttps://nicecrew.tv/static/streaming-playlists/hls/ee227b46-2962-4fa5-a0e9-7c58c53e095c/7f0f4808-99f1-4c4c-ae74-b0442592eb55-master.m3u8https://nicecrew.tv/videos/embed/vpxpsC7GgAsMmaMrLdGrXA10455472024-05-07T22:25:31.932ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/kAiYi7Vu2eGeAqFZT1Gy8Jhttps://nicecrew.tv/lazy-static/thumbnails/0669c8c6-9523-4648-953e-9d6928b47286.jpgDon't Blow The WhistleDon't Blow The Whistlehttps://nicecrew.tv/static/streaming-playlists/hls/9ea7ff5c-1e65-4218-9515-34d1ee86b920/572ee157-fae1-4822-86e6-09b62d0ff8f9-master.m3u8https://nicecrew.tv/videos/embed/kAiYi7Vu2eGeAqFZT1Gy8J890152024-05-08T18:42:04.533ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/527J2EmQaXAvmPqaT2GHGghttps://nicecrew.tv/lazy-static/thumbnails/09034ea6-993e-41b5-b8ff-f0cad3dfaa95.jpgKing Jew Complains About GoyimOY VEYhttps://nicecrew.tv/static/streaming-playlists/hls/208c714e-fd8a-4698-a832-19dc8a47f553/98269557-5a20-434f-a242-57dd6216f805-master.m3u8https://nicecrew.tv/videos/embed/527J2EmQaXAvmPqaT2GHGg99572024-05-09T18:49:55.462ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/aES5ezeKnX4D21sD9h1VNehttps://nicecrew.tv/lazy-static/thumbnails/a45975be-4d78-454b-a601-d9b19c645969.jpgDan Schneider sues Quiet on Set Docuseries. Dirty Dan Doth Protest Too Much.I wanted to take a look at Dan Schneider and his bizarre behavior throughout the years. I watched the Quiet on Set Docuseries, which we will talk about without spoilers, and we will get into Dan Schneiders's lawsuit against the documentary series for "Defamation Per Se." Sources: https://twitter.com/nowthisimpact/status/1788585467467682298 https://twitter.com/ObiscureNick/status/1555696509454168064 https://twitter.com/nadiasoinski/status/1121237630241452037 https://twitter.com/ObiscureNick/status/1557945010380648451 https://twitter.com/ObiscureNick/status/1565115984339673088 https://twitter.com/ObiscureNick/status/1537212313723318273 https://www.crazydaysandnights.net/2018/01/four-for-friday-its-about-time-himmmm.html https://www.scribd.com/document/730970211/Dan-Schneider-Defamation-Complaint Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #danschneider #quietonset #nickelodeon #disney #arianagrande #drakebell #brianpeck #documentary #lawsuit #hollywoodhttps://nicecrew.tv/static/streaming-playlists/hls/4e4f5eaa-1550-4c36-9871-8f2c99c78f2d/0c2763cb-1db1-4161-86a9-9a37bae7fc87-master.m3u8https://nicecrew.tv/videos/embed/aES5ezeKnX4D21sD9h1VNe3866002024-05-09T22:31:57.865ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/rJnGbpTK27rurBoGi6Ca8ihttps://nicecrew.tv/lazy-static/thumbnails/ec58719b-ca3b-421a-a1a1-7ead39cef239.jpgOY VEYOY VEYhttps://nicecrew.tv/static/streaming-playlists/hls/d05f12cf-10e9-4f8f-89bd-8f7dde1e3c7b/d7c33bbc-26bc-4bf5-be65-f995665f46fd-master.m3u8https://nicecrew.tv/videos/embed/rJnGbpTK27rurBoGi6Ca8i100102024-05-10T02:44:38.093ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/9kFNLjTjK3aQVarMScrxCEhttps://nicecrew.tv/lazy-static/thumbnails/dc29437b-2153-4ce1-bf19-39e0c5888702.jpgThe narcissist hates your successI wanted to talk today about narcissists and how they react to the success, accomplishments, and achievements of other people. Narcissists often react with seething rage, envy, resentment, and lashing out. This triggered reaction comes from their insatiable need for a constant influx of external validation. How dare anyone else get the spotlight THEY are ENTITLED to. When you success, it threatens their sense of control and superiority. Did you get promoted at work? You did that "on purpose" to make them feel bad when they were having a bad day. This is the mindset of the narcissist. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/4388c5bc-1b2c-458c-a9de-d0dd94e36942/4e685a97-82f9-417d-ab2f-8bbe41f66690-master.m3u8https://nicecrew.tv/videos/embed/9kFNLjTjK3aQVarMScrxCE23760112024-05-10T19:27:28.473ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/g5Se8YYuYGtY8oLwSEVegJhttps://nicecrew.tv/lazy-static/thumbnails/ff198ce1-38b3-4f21-bb6f-27dbb12bd69e.jpgCocktails With George and Moddy May 10George & Moddy help make sense of the nonsensical things that are disguised as "News." Climate TARDS on full Display, CME- Uhoh. Maybe THIS is our SMODhttps://nicecrew.tv/static/streaming-playlists/hls/7a270217-39e0-44ff-8306-0173229f2fcc/e114ddaf-eec7-44a4-8165-53903c25cb77-master.m3u8https://nicecrew.tv/videos/embed/g5Se8YYuYGtY8oLwSEVegJ69665642024-05-11T02:05:16.056ZYESCocktails With George & ModdyNOhttps://nicecrew.tv/w/nbcb1f9CYxLCT3dJMBegHLhttps://nicecrew.tv/lazy-static/thumbnails/5458535c-5e11-47c6-b1c7-cae08433c752.jpgThe Fire RisesThe normies are noticing. https://nicecrew.tv/static/streaming-playlists/hls/ab7c3c1f-1210-45f4-8480-e307c4ae4d6a/313cb6f6-69a9-462c-b751-b7602c2c5aa8-master.m3u8https://nicecrew.tv/videos/embed/nbcb1f9CYxLCT3dJMBegHL3250402024-05-11T15:40:02.392ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/6yGzFQ9WSNtts7P9Jpgg21https://nicecrew.tv/lazy-static/thumbnails/9bdcff45-a6d8-456d-af92-54ee18cc6e2f.jpgNature on May 5, 2024Rabbits and other animals seen on a walk on May 11, 2024https://nicecrew.tv/static/streaming-playlists/hls/2d0e80b4-397d-4a01-83b6-76bd406d93de/6c0945cc-02fa-4fc4-82bc-e97724b37987-master.m3u8https://nicecrew.tv/videos/embed/6yGzFQ9WSNtts7P9Jpgg21169022024-05-12T03:38:59.214ZnaturerabbitsbunniesbunnytreesYESCybershell's CyberStreamsNOhttps://nicecrew.tv/w/8kKXTMCGDsajFYeD1wYdTchttps://nicecrew.tv/lazy-static/thumbnails/45a82f21-d86f-4963-96e9-fcc016f28efa.jpgJJR - 253 - Record Breaking Political ProstrationJJR Muvvers Day edition I walk through political prostration at levels never before seen. Also Bibi's NPD, Israel wants to dance, University apoiogizes for illiterate announcer, crickets will not replace us and so so much more.https://nicecrew.tv/static/streaming-playlists/hls/3b723221-8bd4-4e3c-a6d3-564d7e7a57a9/097d3950-9821-4268-b40a-99a9d207d0eb-master.m3u8https://nicecrew.tv/videos/embed/8kKXTMCGDsajFYeD1wYdTc72875162024-05-13T03:47:05.384ZYESJust Joe Radio NOhttps://nicecrew.tv/w/4nuzAN8RrP2QMuHcCfjrTdhttps://nicecrew.tv/lazy-static/thumbnails/87e813bd-d881-495f-a26d-fd57f157bdb9.jpgI Have Been De-Banked by Bank of America! They are holding my funds hostage...I was informed by Bank of America my business account which I have had for around 7 years was being terminated. They claim this decision was made by their "risk department" but refused to give me any information or allow me access to my funds. https://twitter.com/NotRadix/status/1790080919145005418 Donate to the documentary: https://www.kandkfilm.com/donate Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/1b4ba5d4-93b0-49e3-8c4c-91eca862258e/d6160707-bddb-41bc-8e67-9502f20c74ba-master.m3u8https://nicecrew.tv/videos/embed/4nuzAN8RrP2QMuHcCfjrTd13905282024-05-13T21:51:04.909ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/ahYdDi2rBvL2zEwRxQemYqhttps://nicecrew.tv/lazy-static/thumbnails/deb10c09-2862-483f-88ae-8ba9ea6414e7.jpgDestiny 2 - AVALON Exotic Quest Final BossExplode that nigger right now https://nicecrew.tv/static/streaming-playlists/hls/4b40cb37-f662-46d9-8726-ec0514f69a40/d2dd9e0f-55cf-4d18-992f-f7f23304bfca-master.m3u8https://nicecrew.tv/videos/embed/ahYdDi2rBvL2zEwRxQemYq4240182024-05-20T22:10:39.661ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/q6KMPxHbE21M4ymJVQUm6Uhttps://nicecrew.tv/lazy-static/thumbnails/55159b58-2eb0-4e8a-aa13-7f56ee8a84bf.jpg2024-05-14 05-30-11no editing, just filmed for funhttps://nicecrew.tv/static/streaming-playlists/hls/c3290882-0043-4896-8f7d-c7765cde2fe6/1ab05a0d-e859-4215-b57f-d8aa6b690cbb-master.m3u8https://nicecrew.tv/videos/embed/q6KMPxHbE21M4ymJVQUm6U3092092024-05-14T12:27:34.651ZYESMain omega_variant channelNOhttps://nicecrew.tv/w/jdT9hCFuCmHCETv8oN5mbKhttps://nicecrew.tv/lazy-static/thumbnails/0c79422c-96de-4788-9650-719568270979.jpgBank of America called about my de-banking...Bank of America called about my de-banking...https://nicecrew.tv/static/streaming-playlists/hls/9390f064-b2f3-4e57-8253-050eee8de9bf/aa847881-f484-42fa-88b9-f49a534bcc07-master.m3u8https://nicecrew.tv/videos/embed/jdT9hCFuCmHCETv8oN5mbK345122024-05-16T19:46:17.412ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/9DrHE83zHKcqkpdrQtR2nXhttps://nicecrew.tv/lazy-static/thumbnails/8a06a933-9fac-4440-8386-6b01a22104ff.jpgJesse Kelly Show: Did Bank of America De-Bank an Independent Journalist?My appearance on the Jesse Kelly Show. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/46037a6a-c226-4ed5-ae0a-7b57c15829b5/7a13bd0f-5f08-4bdb-89b1-6549c6ac0b34-master.m3u8https://nicecrew.tv/videos/embed/9DrHE83zHKcqkpdrQtR2nX236032024-05-16T19:46:26.338ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/naWBixVmxjeXrfAMezjuzFhttps://nicecrew.tv/lazy-static/thumbnails/68e0ec8f-07f6-427a-be0b-c3e1763e1881.jpgZoomers at the gym (a rant)It's frustrating when these kids come in, glued to their devices, and monopolize the machines. They seem to have no awareness of others and are inconsiderate. Taking selfies in the women's locker room, where other women are trying to shower and change - why are they like this?! Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #zoomers #gym #cellphones #socialmedia #internet #fitnesshttps://nicecrew.tv/static/streaming-playlists/hls/ab734273-8b25-43d5-86e7-2a962b8870d1/e3ddf8e8-2053-47eb-841d-9529dd366879-master.m3u8https://nicecrew.tv/videos/embed/naWBixVmxjeXrfAMezjuzF11340122024-05-17T19:49:51.391ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/eiU67uxgQpe5iFt5Xd6k1bhttps://nicecrew.tv/lazy-static/thumbnails/0d4c9f8a-96b8-4938-be45-10cb27416d74.jpg🩷🩷🩷 14K SUBS 🩷🩷🩷🩷🩷🩷 14K SUBS 🩷🩷🩷https://nicecrew.tv/static/streaming-playlists/hls/6bc68c10-5d02-44bb-acac-0a5d706cfc1e/6bea7c0a-14e0-49ec-b950-4cbb895686ae-master.m3u8https://nicecrew.tv/videos/embed/eiU67uxgQpe5iFt5Xd6k1b18022024-05-17T23:47:04.813ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/1zneMFu6WeiCdX23VDTwwZhttps://nicecrew.tv/lazy-static/thumbnails/6de4f55d-ce98-4fd2-9df3-825f683c603a.jpgJJR - 254 - Do The Right ThingRaising the black for the first time in years we discuss the ADL suing activists, Catboi's latest coincidence, Clown Show Clapback Congress, non-biinary flamingos and oh so much more. https://nicecrew.tv/static/streaming-playlists/hls/04a8a1f3-455f-420a-b6a5-5b7b143e52a5/2b36e0d5-9179-46fe-b2a8-ed7942b6211b-master.m3u8https://nicecrew.tv/videos/embed/1zneMFu6WeiCdX23VDTwwZ75005832024-05-19T04:02:47.759ZYESJust Joe Radio NOhttps://nicecrew.tv/w/pLpq3dLYBDkJ7d2B6b4Chkhttps://nicecrew.tv/lazy-static/thumbnails/ae7d272b-d883-4ebd-a71b-565e1b122363.jpgI Have AutismI Have Autismhttps://nicecrew.tv/static/streaming-playlists/hls/c0755840-2bbc-4e41-a6f5-b31a7d6ef73b/888d4b4c-0126-4b68-bdf0-3010ad8700be-master.m3u8https://nicecrew.tv/videos/embed/pLpq3dLYBDkJ7d2B6b4Chk90122024-05-19T20:06:17.014ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/qXtkSjvECExCKq7MB4vx8Uhttps://nicecrew.tv/lazy-static/thumbnails/1f8236dd-d661-4432-b029-05be5e683801.jpgRed Dead Redemption 2: Benis Boogaloonow with 50 percent more packet losshttps://nicecrew.tv/static/streaming-playlists/hls/ca1a15eb-f04d-44b3-b650-6fe1d40661fe/128ccf46-a46e-4703-bfa5-081dc6659f1e-master.m3u8https://nicecrew.tv/videos/embed/qXtkSjvECExCKq7MB4vx8U33315732024-05-25T03:04:17.741Zgamingstreamred dead redemptionbenis wenisYESGamingNOhttps://nicecrew.tv/w/eifZzoBcxAeEb19w2qkR2Hhttps://nicecrew.tv/lazy-static/thumbnails/bbaaf6d6-7b7a-43d4-8e27-e353d4cd2545.jpgWhitmer wants to "talk" to the men she helped frame for her "kidnap plot" - the families respondThe woman has no shame. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/6bafafad-6973-4cab-9f66-af44461337df/e4bfe310-b97b-4a59-8ea6-4cc60f4c5fa3-master.m3u8https://nicecrew.tv/videos/embed/eifZzoBcxAeEb19w2qkR2H12195122024-05-19T22:56:22.265ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/1nz1TeYN1GfCv3WFKLMwxEhttps://nicecrew.tv/lazy-static/thumbnails/82081e6c-35dd-4786-aa55-18582bee8583.jpgAmericans are going into MASSIVE DEBT to attend weddingsAlready indebted Americans are taking on even more debt to attend lavish weddings and live beyond their means. Sources: https://archive.is/hzBjQ https://www.newsweek.com/americans-are-going-debt-attend-weddings-1901448 https://www.careypurcell.com/articles/being-a-bridesmaid-is-driving-me-into-bankruptcy https://www.refinery29.com/en-gb/wedding-financial-commitments-bridesmaids https://www.cnbc.com/2024/03/02/newlyweds-went-into-credit-card-debt-for-wedding.html Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/0302f72c-f503-4b5b-9b97-1154709669cc/614308e8-7acb-40d7-8861-5f54e2c79484-master.m3u8https://nicecrew.tv/videos/embed/1nz1TeYN1GfCv3WFKLMwxE1939582024-05-19T23:58:06.939ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/bPmXPM58siVdoifS8Xxd4hhttps://nicecrew.tv/lazy-static/thumbnails/adefd8f1-3b6f-48f8-babe-55ca4499fe74.jpgCheck out my interview with Dinesh D'Souza later today!Check out my interview with Dinesh D'Souza later today!https://nicecrew.tv/static/streaming-playlists/hls/5798432b-1579-4e9c-98cd-f45945628f96/ced6de13-6dc3-49e3-9360-3ca283579604-master.m3u8https://nicecrew.tv/videos/embed/bPmXPM58siVdoifS8Xxd4h13022024-05-21T16:47:21.350ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/45Smrym6LsUh2TUVgFfm4Xhttps://nicecrew.tv/lazy-static/thumbnails/62d43bfc-025d-47fe-b70a-703bd469052e.jpgEx-Google CEO Eric Schmidt is a FREAK!Ex-Google CEO Eric Schmidt is a FREAK!https://nicecrew.tv/static/streaming-playlists/hls/18f96bfd-fee8-4205-bfcb-f0a22e0d11f5/31ef3ff4-7564-4ca3-bb2d-4d32af084e98-master.m3u8https://nicecrew.tv/videos/embed/45Smrym6LsUh2TUVgFfm4X520102024-05-21T20:47:49.953ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/a8YREpzc87Bp3ae8gH1pY3https://nicecrew.tv/lazy-static/thumbnails/29f04010-0adb-4464-8b3c-b330e8aac94b.jpgI need to thank you all for everything!Thank you all so much for your wonderful support. You all are amazing! Help Adam Fox's family: https://www.kandkfilm.com/help-the-guys Support the documentary: https://www.kandkfilm.com/donate Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #film #indiefilm #independentfilmmaker #filmmaking #documentaryhttps://nicecrew.tv/static/streaming-playlists/hls/49ff7e44-aec9-4012-a8ba-ae6c7fbb9c1e/8e961895-fac0-4f59-9563-7553fee7ecf6-master.m3u8https://nicecrew.tv/videos/embed/a8YREpzc87Bp3ae8gH1pY3302592024-05-22T14:49:06.093ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/wVKsJ1e6DXbVEz5U9rKZJvhttps://nicecrew.tv/lazy-static/thumbnails/c281685b-e7ae-4b62-97e5-9b3bc696be87.jpgLovinglife TV archive 06-18-2008I recovered this great video that was scrubbed off the web, made by Lovinglifetv website of South Africa. It really explains the problem of fiat currency and looks back at the 2008 bailout. Of interesting note, is how they called Obama in to "fix it"...not having even ran a lemonade stand much less the economy of a global superpower. He was installed as president as a distraction and first thing he did was approve the bailout. They wanted another bailout later but never got it. Its kind of long and repetitive at times, but worth a watch in full. He was rewarded with more net worth than he was when he attended that meeting for a job well done. Isn't using the office for personal gains illegal? #obama #communism #treason #bailout #federalreservehttps://nicecrew.tv/static/streaming-playlists/hls/fa735cfe-5824-4eea-ace1-bffda2d5aeed/758fd3b7-3a01-4c17-9ee4-f56a81eb143d-master.m3u8https://nicecrew.tv/videos/embed/wVKsJ1e6DXbVEz5U9rKZJv63915222024-05-22T16:53:53.396ZYESMain teknoskillz channelNOhttps://nicecrew.tv/w/jGAQ35nSHx8wTQySVVq4Knhttps://nicecrew.tv/lazy-static/thumbnails/f31d0abd-2772-47c5-ad7d-acbeb874615d.jpgNikola Tesla - Master Of LighningStory of Nikola Tesla who invented alternating current power. Made by PBS, public broadcasting circa 2001.https://nicecrew.tv/static/streaming-playlists/hls/976fb5d7-b407-40e2-abb2-e2c6e19ab9ef/3a0dfa78-04a2-4b48-bff3-9d8129254f78-master.m3u8https://nicecrew.tv/videos/embed/jGAQ35nSHx8wTQySVVq4Kn51850132024-05-22T20:14:42.448ZYESMain teknoskillz channelNOhttps://nicecrew.tv/w/rjyEgxkeynPRszpcin5SRQhttps://nicecrew.tv/lazy-static/thumbnails/8aed6843-a4bd-46cf-b68d-743298126f1a.jpgFather Martins Timeless chalk talk on AlcoholismFather Martin made this in the early 70's on board a Navy ship when drinking was a huge problem in the Navy. The checmical properties of alcohol are discussed as well as their effects on the human mind (I over E) , body and spirit when consumed.https://nicecrew.tv/static/streaming-playlists/hls/cd0bfb4e-d59c-4425-8a6d-49beaf4a2e22/d7a4667d-2a25-48ef-a3b1-e62ddceda95e-master.m3u8https://nicecrew.tv/videos/embed/rjyEgxkeynPRszpcin5SRQ39160102024-05-23T01:22:27.057ZYESMain teknoskillz channelNOhttps://nicecrew.tv/w/xmp9qeeqBJjRyerf83joWThttps://nicecrew.tv/lazy-static/thumbnails/0834db40-5540-4ce4-b5ec-23aa9c256611.jpgInterview with Danean MacAndrews, Former Inmate of FCI Dublin aka the R*pe ClubToday I interviewed Danean MacAndrews, a J 6 misdemeanor defendant and a former inmate at the infamous FCI Dublin aka the "R*pe Club." Danean shares her story and talks about her experiences at FCI Dublin. She is also an advocate for other female inmates. Danean X: https://twitter.com/DaneanHere2 Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/fde47003-9771-458c-bee4-b68ce122f4d7/7869cc14-5312-462c-b3fd-25e83b9c8dbd-master.m3u8https://nicecrew.tv/videos/embed/xmp9qeeqBJjRyerf83joWT4141072024-05-23T22:12:15.484ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/bPioQSJQPW3H8DWF3RLERNhttps://nicecrew.tv/lazy-static/thumbnails/c2edf6b4-a35a-4849-ba1a-43ed7b736df1.jpgCocktails LIVE May 31Top Story news with views and analysis. Chat driven Frequent turns into WTFhttps://nicecrew.tv/static/streaming-playlists/hls/57961028-e6c7-4396-a16a-aa479bcd4290/83e6fd18-83bf-47ce-ab96-dd7238d3bc79-master.m3u8https://nicecrew.tv/videos/embed/bPioQSJQPW3H8DWF3RLERN6614542024-05-24T01:59:24.528ZYESCocktails With George & ModdyNOhttps://nicecrew.tv/w/tWp7V4KRWcCpNWErCekx5rhttps://nicecrew.tv/lazy-static/thumbnails/bc527cf6-368a-4b7c-99f8-5b453bf6c423.jpgGeorge Lincoln Rockwell Edition May 24 - 5/24/2024, 11:39:00 PM HELPFUL LINKS: https://entropystream.live/RedPilledRadio https://goyimtv.com https://odysee.com https://nicecrewdigital.digital Europa The Last Battle: https://europathelastbattle.net Red Pilled Radio: https://twitter.com/RedPilledRadio https://gab.com/GeorgeAngus Donations always appreciated: https://givesendgo.com/redpilledradio Support these great businesses! PepperCave: https://peppercave.com Use Discount Code FLOOD at checkout Huntress Designs: https://embossi.com/ MoneyTree Publishing: Based truths, in print: https://www.moneytreepublishing.com/https://nicecrew.tv/static/streaming-playlists/hls/e23f27b6-6498-43b1-bfcd-f8bf0c6af6e5/23670dba-72c0-404c-8993-18782489dd37-master.m3u8https://nicecrew.tv/videos/embed/tWp7V4KRWcCpNWErCekx5r4875572024-05-25T01:06:11.345ZYESRed Pilled RadioNOhttps://nicecrew.tv/w/4kZJ6kZcjYbX6FK3ToXdV4https://nicecrew.tv/lazy-static/thumbnails/0935d5f1-da52-4cf8-afbc-eca8c8c24b8a.jpgPetting a beautiful horse 🐴Petting a beautiful horse 🐴https://nicecrew.tv/static/streaming-playlists/hls/1b161f52-873d-434e-961e-43030ba59b8d/311ae1c9-df44-4cb0-9717-bb0813f7fd7d-master.m3u8https://nicecrew.tv/videos/embed/4kZJ6kZcjYbX6FK3ToXdV460122024-05-28T03:47:26.457ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/bbCob6ujtbuBbvDjDzDu9Fhttps://nicecrew.tv/lazy-static/thumbnails/de9e5844-bf3c-4ff1-a35c-5f10b2383b41.jpgRed Pilled Radio May 28 - 5/29/2024, 12:05:56 AMHow did Hitler turn around the economy of Germany? HELPFUL LINKS: https://entropystream.live/RedPilledRadio https://goyimtv.com https://odysee.com https://nicecrewdigital.digital Europa The Last Battle: https://europathelastbattle.net Red Pilled Radio: https://twitter.com/RedPilledRadio https://gab.com/GeorgeAngus Donations always appreciated: https://givesendgo.com/redpilledradio Support these great businesses! PepperCave: https://peppercave.com Use Discount Code FLOOD at checkout Huntress Designs: https://embossi.com/ MoneyTree Publishing: Based truths, in print: https://www.moneytreepublishing.com/https://nicecrew.tv/static/streaming-playlists/hls/52773ee5-eaf9-4138-bd96-dbd4751ecadf/6c4ee003-95aa-4523-a094-9c0a9eebe0e8-master.m3u8https://nicecrew.tv/videos/embed/bbCob6ujtbuBbvDjDzDu9F5153052024-05-29T01:37:45.061ZYESRed Pilled RadioNOhttps://nicecrew.tv/w/928i59gw8vPNMDB83jnqTZhttps://nicecrew.tv/lazy-static/thumbnails/a460b1c5-49c3-40c7-9c6b-f90cab3f9f7b.jpgCocktails LIVE May 31 - 6/1/2024, 12:00:25 AMTop Story news with views and analysis. Chat driven Frequent turns into WTFhttps://nicecrew.tv/static/streaming-playlists/hls/40f1592d-0a3c-4977-a918-034385d0750f/69727014-db9f-4d8b-bfad-14b8f78b7df8-master.m3u8https://nicecrew.tv/videos/embed/928i59gw8vPNMDB83jnqTZ7230032024-06-01T02:07:08.182ZYESCocktails With George & ModdyNOhttps://nicecrew.tv/w/x5SUWnPMHobRNCh8hP5Vyqhttps://nicecrew.tv/lazy-static/thumbnails/82b19f17-4248-4288-adf6-7632b911878b.jpgJJR - 255 - No. Political. Solution.Former President of the United States convicted of 34 felonious counts of Being A NaughtyBad Boy in the 1st Degree. The clownshow Trump trial concludes. What does it mean?! What happens next?! Also War for the Black Vote heats up, Auslander Raus, this week in activism, Dassum Boolshet Files and so so much more.https://nicecrew.tv/static/streaming-playlists/hls/fbb9a64d-360e-4f99-afd0-8e99b013c01c/b42306f1-a6a7-4ed1-8076-9371df9a2d5f-master.m3u8https://nicecrew.tv/videos/embed/x5SUWnPMHobRNCh8hP5Vyq729151202024-06-02T03:57:03.343ZYESJust Joe Radio NOhttps://nicecrew.tv/w/uX5ydSmW2PxxWtSXuLEeaJhttps://nicecrew.tv/lazy-static/thumbnails/b0f5b03f-0df0-45cb-9a29-d16bb769e500.jpgRed Pilled Radio Weimar Conditions - 6/4/2024, 11:39:36 PMRequire Weimar Solutions. My Pride won't let me say otherwise https://entropystream.live/RedPilledRadio https://goyimtv.com https://odysee.com https://nicecrewdigital.digital Europa The Last Battle: https://europathelastbattle.net Red Pilled Radio: https://twitter.com/RedPilledRadio https://gab.com/GeorgeAngus Donations always appreciated: https://givesendgo.com/redpilledradio Support these great businesses! PepperCave: https://peppercave.com Use Discount Code FLOOD at checkout Huntress Designs: https://embossi.com/ MoneyTree Publishing: Based truths, in print: https://www.moneytreepublishing.com/https://nicecrew.tv/static/streaming-playlists/hls/ea7098e7-c943-4aee-8ade-ed6ba59b6af8/c53fe494-be1e-4eed-8ff0-24c027ce09ab-master.m3u8https://nicecrew.tv/videos/embed/uX5ydSmW2PxxWtSXuLEeaJ52405212024-06-05T01:12:17.357ZYESRed Pilled RadioNOhttps://nicecrew.tv/w/iLQXPmKyxgL3qkk67HJQZJhttps://nicecrew.tv/lazy-static/thumbnails/0ddc7ca1-e9fd-4e3d-9e3c-256ba64f8ccb.jpgCocktails LIVE June 7 - 6/8/2024, 12:06:12 AMTop Story news with views and analysis. Cocktails tonight: Moddy returns, George will likely misbehave. We weigh in on the Miss Alabama thing. Russian forces on the way to Cuba. Woke Tractor Supply - Say it ain't so Biden D-Day Disaster Much much more.https://nicecrew.tv/static/streaming-playlists/hls/8fee41d9-5342-4d1a-a3ab-30f3afb74974/89ec6660-0c53-4bc1-8a3d-cea83f31055a-master.m3u8https://nicecrew.tv/videos/embed/iLQXPmKyxgL3qkk67HJQZJ6951002024-06-08T02:07:21.998ZYESCocktails With George & ModdyNOhttps://nicecrew.tv/w/fZX1KLpsdPwp2MfDmVJ9HGhttps://nicecrew.tv/lazy-static/thumbnails/db4f928a-0cbd-4053-9c27-972c85601974.jpgHuge News on Whitmer Fednapping APPEALS!!!I am going over two filings for the appeals. I am including source links: https://www.scribd.com/document/741027587/Joe-Morrison-Appeal-Brief https://www.scribd.com/document/741028996/USA-vs-Fox-and-Croft-Appeal-Final-Version-Supplemental-Brief Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/79773d35-c72b-426f-a871-35a5fe20ff32/45c66e4c-178f-4428-b1e8-236d356717b2-master.m3u8https://nicecrew.tv/videos/embed/fZX1KLpsdPwp2MfDmVJ9HG3334042024-06-10T20:33:58.939ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/5Z2KyMiEnva4TBc4ffUTZbhttps://nicecrew.tv/lazy-static/thumbnails/6a784791-258f-4dd6-991c-a8f33c962bde.jpgI am NOT Okay...Just wanted to keep it real. I am going through a tough time. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/285b0758-c81a-49db-a033-21ffa3653c20/aba4746f-03d3-4042-9421-6b89b80f3d5f-master.m3u8https://nicecrew.tv/videos/embed/5Z2KyMiEnva4TBc4ffUTZb4155292024-06-10T20:26:35.268ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/jwrRVvkMuEPtyXgZTREQR4https://nicecrew.tv/lazy-static/thumbnails/a24b1e6d-8091-4469-a87c-bdac25002025.jpgTaberu Tuesday 1tsukuruuuuuuuuhttps://nicecrew.tv/static/streaming-playlists/hls/9604bf08-74d9-4c1d-8751-40c747710f7d/9df38787-8e62-4567-920c-7be1cb9b8591-master.m3u8https://nicecrew.tv/videos/embed/jwrRVvkMuEPtyXgZTREQR430062024-06-12T01:50:15.582ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/9aBbHazzTEFBtoSB4SZhHXhttps://nicecrew.tv/lazy-static/thumbnails/b082f3f5-8e5f-43a3-b7d7-5da1a5f87fcf.jpgTaberu Tuesday 2tsukuruuuuuuuuhttps://nicecrew.tv/static/streaming-playlists/hls/42207c8c-aa08-4091-bc56-6b985302bc69/09107810-b2db-4a9f-9e75-4adf47f73b3b-master.m3u8https://nicecrew.tv/videos/embed/9aBbHazzTEFBtoSB4SZhHX30002024-06-12T01:50:35.887ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/c6J2bLN84GUFVtYmjUbbZRhttps://nicecrew.tv/lazy-static/thumbnails/ca7c3a60-ccdd-4c85-870b-2f4b8c3f184a.jpgTaberu Tuesday 3tsukuruuuuuuuuhttps://nicecrew.tv/static/streaming-playlists/hls/59e123df-73cf-44af-9abc-08343fb40493/deeacd40-0116-4d39-94a2-489cb7fd262d-master.m3u8https://nicecrew.tv/videos/embed/c6J2bLN84GUFVtYmjUbbZR30002024-06-12T01:50:52.453ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/ifqLwZo3ye6bD41Vw2ayXshttps://nicecrew.tv/lazy-static/thumbnails/a3fc2cfd-21f5-46f4-a4b7-1f0f4eb9538a.jpgTaberu Tuesday 4tsukuruuuuuuuuhttps://nicecrew.tv/static/streaming-playlists/hls/8baf08a1-d00b-439a-93c3-0b64cf6d6288/1fab6858-427d-4c3e-86b0-0c36672727ec-master.m3u8https://nicecrew.tv/videos/embed/ifqLwZo3ye6bD41Vw2ayXs50002024-06-12T01:51:09.090ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/bfUZJf6GCqdeazs3c1eEdDhttps://nicecrew.tv/lazy-static/thumbnails/a425ca87-80a3-4303-85f5-b5f47a6ec0c6.jpgTaberu Tuesday 5tsukuruuuuuuuuhttps://nicecrew.tv/static/streaming-playlists/hls/5310757a-b825-4e4c-838d-a1d38cfa549d/585f05b6-0242-4f78-9244-2146872117b3-master.m3u8https://nicecrew.tv/videos/embed/bfUZJf6GCqdeazs3c1eEdD30552024-06-12T01:51:20.830ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/k1iYq5tSeiSBP5Qi8SFJZYhttps://nicecrew.tv/lazy-static/thumbnails/6a6647a9-5c01-4b51-a498-37cb26a48b4a.jpgTaberu Tuesday 6tsukuruuuuuuuuhttps://nicecrew.tv/static/streaming-playlists/hls/99e8b5e9-7da8-4e8c-a55c-69f8e32a6de2/4f79399a-d09c-4107-a46d-d2f667fbdfca-master.m3u8https://nicecrew.tv/videos/embed/k1iYq5tSeiSBP5Qi8SFJZY30042024-06-12T01:51:34.223ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/7YTt4AiMzQdbaLVAReL61uhttps://nicecrew.tv/lazy-static/thumbnails/05258506-32d5-4465-ade0-4bec28ce956c.jpgTaberu Tuesday 7tsukuruuuuuuuuhttps://nicecrew.tv/static/streaming-playlists/hls/38883353-4c83-4a72-9461-d7ad7d444d20/328a1eae-dd55-4cf9-9941-da1e298e4f84-master.m3u8https://nicecrew.tv/videos/embed/7YTt4AiMzQdbaLVAReL61u31032024-06-12T01:51:49.093ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/11L5KzZYJf7BQ1a8VnKYSihttps://nicecrew.tv/lazy-static/thumbnails/cafaef33-b879-4216-8b6d-0103851a27dc.jpgTaberu Tuesday 8tsukuruuuuuuuuhttps://nicecrew.tv/static/streaming-playlists/hls/001b2a9c-73f6-4343-ae99-ff5fb76022ad/702b5290-2171-4ae5-8965-3ab929ee0a88-master.m3u8https://nicecrew.tv/videos/embed/11L5KzZYJf7BQ1a8VnKYSi30042024-06-12T01:52:04.260ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/qStHzjBK3PAnHncQFyWUEKhttps://nicecrew.tv/lazy-static/thumbnails/c5294888-cbf4-48e8-ab07-3c8d396d15b7.jpgTaberu Song Remasteredbecause benis wenis https://nicecrew.tv/static/streaming-playlists/hls/c96798f0-e3dd-4b31-9856-f47ebf6eb867/5a97b3ae-9495-43aa-af41-9815119c6dd0-master.m3u8https://nicecrew.tv/videos/embed/qStHzjBK3PAnHncQFyWUEK875182024-06-12T02:04:22.510ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/5mRwGVszzrx5Po9JqEptJrhttps://nicecrew.tv/lazy-static/thumbnails/b6fbe358-781e-4b28-94e9-73a806244371.jpgCocktails LIVE June 11 - 6/12/2024, 12:01:24 AMTop Story news with views and analysis. https://nicecrew.tv/static/streaming-playlists/hls/234df420-7ff1-482e-8db3-368108474be1/e97266cd-a93a-4d5f-a0a4-c67593a6dcbd-master.m3u8https://nicecrew.tv/videos/embed/5mRwGVszzrx5Po9JqEptJr74285122024-06-12T02:10:31.803ZYESCocktails With George & ModdyNOhttps://nicecrew.tv/w/mtvyFQsLD5BgG9qVYNQRfahttps://nicecrew.tv/lazy-static/thumbnails/743e69b2-bb67-4556-9144-5edd4ca301b0.jpgGIDDOUT MUH WAY LIMBRULGIDDOUT MUH WAY LIMBRULhttps://nicecrew.tv/static/streaming-playlists/hls/a5ce12fd-c2b4-4ebe-ab4c-4a7cd125b5b9/6173a748-a804-4df5-92b2-301a2e70212d-master.m3u8https://nicecrew.tv/videos/embed/mtvyFQsLD5BgG9qVYNQRfa295242024-06-12T19:15:43.208ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/kDdfmsCGV437wHafkody5shttps://nicecrew.tv/lazy-static/thumbnails/86920ba1-0287-4f2a-acce-d9673980028b.jpgRed Pilled and Chill Sunday June 16 - 6/16/2024, 8:06:27 PM https://entropystream.live/RedPilledRadio https://goyimtv.com https://odysee.com https://nicecrewdigital.digital Europa The Last Battle: https://europathelastbattle.net Red Pilled Radio: https://twitter.com/RedPilledRadio https://gab.com/GeorgeAngus Donations always appreciated: https://givesendgo.com/redpilledradio Support these great businesses! PepperCave: https://peppercave.com Use Discount Code FLOOD at checkout Huntress Designs: https://embossi.com/ MoneyTree Publishing: Based truths, in print: https://www.moneytreepublishing.com/https://nicecrew.tv/static/streaming-playlists/hls/9f0fb3a8-e503-4c46-b465-57504b20dca2/517b62e6-8dd5-48ab-9e2b-c77669629ebb-master.m3u8https://nicecrew.tv/videos/embed/kDdfmsCGV437wHafkody5s5188532024-06-16T21:38:04.294ZYESRed Pilled RadioNOhttps://nicecrew.tv/w/5oaCLsTYKURis8cHnejx5Rhttps://nicecrew.tv/lazy-static/thumbnails/1424f7ac-4c2a-43a1-8227-97c7f2e4fa95.jpgdo something silly today #mentalhealth #depression #besillydo something silly today #mentalhealth #depression #besillyhttps://nicecrew.tv/static/streaming-playlists/hls/237cdacc-b6f0-494a-b2d2-3569aeaec9f5/24fc1349-d83d-4c3a-a73c-184d924b9aa5-master.m3u8https://nicecrew.tv/videos/embed/5oaCLsTYKURis8cHnejx5R44042024-06-18T18:25:06.687ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/4g3Gqv9qw6kDsCUMf4TA6zhttps://nicecrew.tv/lazy-static/thumbnails/7893c2ff-89c0-4b40-a1b1-7fbf7feefd78.jpgTaking things one day at a time.I just wanted to give a little update and thank everyone who has reached out to me with words of encouragement and who has prayed for me. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #struggles #depression #faith #prayerhttps://nicecrew.tv/static/streaming-playlists/hls/1a653c0d-4776-4fee-be18-e4f7da38ab33/3db60d2d-5a92-4d4f-ba04-c7df5bb28b4b-master.m3u8https://nicecrew.tv/videos/embed/4g3Gqv9qw6kDsCUMf4TA6z11625112024-06-18T18:27:56.869ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/cU5LPXz5LNaaW6xqv2Jkdihttps://nicecrew.tv/lazy-static/thumbnails/a33d2ddf-158b-4a67-ad2c-9e86b651bf9d.jpgCocktails LIVE June 18 - 6/19/2024, 12:03:20 AMTop Story news with views and analysis. https://nicecrew.tv/static/streaming-playlists/hls/605a2487-51c7-42a5-b8b4-bfe95824efb5/c6714938-4075-4ced-95ab-2bdef992dd73-master.m3u8https://nicecrew.tv/videos/embed/cU5LPXz5LNaaW6xqv2Jkdi8436532024-06-19T02:29:24.552ZYESCocktails With George & ModdyNOhttps://nicecrew.tv/w/2MZMFjMMKbLjygM2EodWEjhttps://nicecrew.tv/lazy-static/thumbnails/72ed57d9-8ea0-4e6c-b289-a158022f051b.jpgIsraeli Citizens Receive American OrgansTravel nurse explains her experience working with Israeli citizens awaiting organ transplants. https://nicecrew.tv/static/streaming-playlists/hls/0e85389d-8d9d-4917-9e8a-773ff7e4d306/61a537da-ecce-4c98-81de-f44e112ed0e0-master.m3u8https://nicecrew.tv/videos/embed/2MZMFjMMKbLjygM2EodWEj140592024-06-20T15:37:20.179ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/wrqAmSuR1jVf48ftW1pLeDhttps://nicecrew.tv/lazy-static/thumbnails/222d99c4-70f8-45e9-a9ca-894f4c3f8914.jpgJJR - 257 - Joontempf Innuh Middluh Pry MumpfBack in action and joined by Matty Boombalatty, we go over the black excellence that was Juneteenth, Houston's Corruption of Color, people have had it with your flags, Benjewman's engagemant farming, and some random vid about a Pay It Forward Chain. It's a decent episode, give it a whirlhttps://nicecrew.tv/static/streaming-playlists/hls/f67ee8df-9294-4c3a-aa54-876232dadf5f/48a83a68-bf1c-4f20-9819-49e77771d32e-master.m3u8https://nicecrew.tv/videos/embed/wrqAmSuR1jVf48ftW1pLeD836552752024-06-23T04:17:52.695ZYESJust Joe Radio NOhttps://nicecrew.tv/w/vDS5scjj7i89Eh4GHnLtLDhttps://nicecrew.tv/lazy-static/thumbnails/1d18f539-d6b9-4a1a-b652-abe068ae713c.jpgHD2- New Jungle EnvironmentLittle gameplay on the newly added jungle environment. Sorry for he frame rate drops, this map has a lot of destructible items. Between that and me having stuff going on in the background of the PC it lagged from time to time.https://nicecrew.tv/static/streaming-playlists/hls/f02266ca-554c-4bd5-bacc-f5fcb587e239/8588b254-2ad9-4469-8c23-1d7c5c9b9203-master.m3u8https://nicecrew.tv/videos/embed/vDS5scjj7i89Eh4GHnLtLD9785172024-06-24T04:42:48.360ZYESMain omega_variant channelNOhttps://nicecrew.tv/w/16YG5yuqZRqHyXqyH2UoYchttps://nicecrew.tv/lazy-static/thumbnails/16002c42-aa76-4a82-812c-c398652fc09d.jpgCocktails LIVE June 25 - 6/26/2024, 12:00:50 AMTop Story news with views and analysis. https://nicecrew.tv/static/streaming-playlists/hls/00d5a7ea-d027-4369-adad-6259fcac90a3/ba92798b-4370-4d54-9e7b-5a5f66464f8f-master.m3u8https://nicecrew.tv/videos/embed/16YG5yuqZRqHyXqyH2UoYc7423012024-06-26T02:09:52.703ZYESCocktails With George & ModdyNOhttps://nicecrew.tv/w/3RJ9pq731jz1c8GhrUBhx3https://nicecrew.tv/lazy-static/thumbnails/46070d2b-b005-4bf1-8f7a-3b763afae2ec.jpgBolivia Coup - Military Assets MobilizingBolivian army coup underway. Right now, tanks and armed forces are deployed to the capital, La Paz. Bolivia has recently expressed a serious interest in joining BRICS. Bolivia was also among the first nations to announce the end of diplomatic relations with Israel over its war in Gaza. See the original post [here](https://nicecrew.digital/@HoroTheWhiteWolf@poa.st/posts/AjKcHDlyJrThdSFspc).https://nicecrew.tv/static/streaming-playlists/hls/1723b1db-f103-4c02-b0fa-6d31bac1e5a0/e5427d44-7d0a-4044-ae5a-6ded74351c2b-master.m3u8https://nicecrew.tv/videos/embed/3RJ9pq731jz1c8GhrUBhx3400132024-06-26T21:14:29.358ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/ffZQ4JpygD2hMqTeeUdnNAhttps://nicecrew.tv/lazy-static/thumbnails/fc13017a-f0a8-47c1-9eca-3bccdf28ca90.jpgRabbi Schmuley SongRabbi Schmuley Songhttps://nicecrew.tv/static/streaming-playlists/hls/7377fe02-1a93-4756-9f98-37afd2d0c382/9e699767-55d7-4180-8227-9bab76a563c2-master.m3u8https://nicecrew.tv/videos/embed/ffZQ4JpygD2hMqTeeUdnNA1225172024-06-26T22:36:08.830ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/ow9L8zJincH9H4rWEyQYWZhttps://nicecrew.tv/lazy-static/thumbnails/55d42743-ea98-4a3d-9458-348188c4d786.jpgPresidential Debate 2024Find out who loves Israel more tonight on NCTV! (don't DMCA strike me I will ignore it) https://nicecrew.tv/static/streaming-playlists/hls/b65ec340-5630-416a-a243-cdfaccf22895/ef1491b7-9b61-4179-9009-4244b93d6a03-master.m3u8https://nicecrew.tv/videos/embed/ow9L8zJincH9H4rWEyQYWZ8215510912024-06-28T03:16:58.478ZbidentrumpisraeldebateusaYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/61hj3krvTZyxiAnjC7Hs3Zhttps://nicecrew.tv/lazy-static/thumbnails/fac9f4c5-5ef4-465a-bd13-9adf806d4d54.jpgBocchi Is Not A Fan(of black people)https://nicecrew.tv/static/streaming-playlists/hls/2887bece-4449-444e-96ae-bb159633349d/6ee52139-20d1-43e0-81ef-506586211ed6-master.m3u8https://nicecrew.tv/videos/embed/61hj3krvTZyxiAnjC7Hs3Z17022024-06-28T18:47:03.696ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/dr85cZyAwWYf3Krtin7phWhttps://nicecrew.tv/lazy-static/thumbnails/a6c5ce4f-f388-4200-9e6b-17514622abd4.jpgWas that a "debate" or a massacre?Was that a "debate" or a massacre?https://nicecrew.tv/static/streaming-playlists/hls/64af9de4-bebb-437d-9028-ed694c61d732/5fe1dab2-e304-484b-8986-165c04671e6b-master.m3u8https://nicecrew.tv/videos/embed/dr85cZyAwWYf3Krtin7phW43542024-06-28T19:49:38.722ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/gUJekTfhn1apYUFUYZACZthttps://nicecrew.tv/lazy-static/thumbnails/43f73d83-5ae1-44aa-a623-33ae28e9ee90.jpgPost-Debate Analysis & Fischer Supreme Court Ruling!I wanted to give my analysis of the "debate" if you can call it that and update everyone on the Fischer ruling that just dropped from the Supreme Court today. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/80d5c7f8-43ff-4e5b-8080-8ddff99cc975/5281fd27-59d0-40d1-829a-bdc22256a431-master.m3u8https://nicecrew.tv/videos/embed/gUJekTfhn1apYUFUYZACZt654052024-06-28T19:55:27.116ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/9CYmVTudgLE2aQhbZVqXBvhttps://nicecrew.tv/lazy-static/thumbnails/cc5e3edb-d2ec-4d97-a0ef-f08dd08faeb3.jpgHow to Make Egg SaladUhhhhhh eggs finna be cooked n smashed n sheeeeeithttps://nicecrew.tv/static/streaming-playlists/hls/45f29e5c-f12c-44e6-9bb3-4144fed067f7/9135dc61-70bc-4822-ae6c-cbeb2bd03332-master.m3u8https://nicecrew.tv/videos/embed/9CYmVTudgLE2aQhbZVqXBv3070242024-06-28T20:43:45.629ZYESBrother TylerNOhttps://nicecrew.tv/w/ufi2zXEgmZxg9CUL1Zccj3https://nicecrew.tv/lazy-static/thumbnails/ccca4498-a339-43f9-b0b0-4097f81b2d76.jpgHHGREGGHHGREGGhttps://nicecrew.tv/static/streaming-playlists/hls/e4bec9ea-1df4-4cfa-aa6a-ec14625cc9ea/18667871-1335-4a1c-9591-ea64234b2d0e-master.m3u8https://nicecrew.tv/videos/embed/ufi2zXEgmZxg9CUL1Zccj3975212024-06-29T06:38:12.738ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/xfVysQ6TL9EbLgPDdGLm7phttps://nicecrew.tv/lazy-static/thumbnails/544074f1-8da1-47e2-8089-306e2f7ef860.jpgAm I PargentHow become prenenananthttps://nicecrew.tv/static/streaming-playlists/hls/fd20b7f4-ae74-4b27-bb28-aa09b41c68e3/86220af3-ee30-4464-9869-fb4663730ccb-master.m3u8https://nicecrew.tv/videos/embed/xfVysQ6TL9EbLgPDdGLm7p120092024-06-29T15:38:34.882ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/qGUsivyLt9LKPcaMdPpU6Dhttps://nicecrew.tv/lazy-static/thumbnails/07e4b4ae-3301-4a84-a9e9-3784fe72ca45.jpgNiceCrew Records - BUSSINReupload because shit's all cattywompushttps://nicecrew.tv/static/streaming-playlists/hls/c811677c-a891-4f01-969f-6bdd3f99445f/1f840d1a-5316-4847-9fbf-fc8c286ebd4f-master.m3u8https://nicecrew.tv/videos/embed/qGUsivyLt9LKPcaMdPpU6D695282024-06-29T16:50:34.055ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/bFussG5N6x1QRGYYPp7PTHhttps://nicecrew.tv/lazy-static/thumbnails/eea529bf-5d8d-4de5-b2ed-9d854fa7960b.jpgSkill proficiency expected from a 5 year old (heavy equipment operation example)My son has been able drive a tractor since about 3-4, but this is just a video documenting the capabilities of a young man. It's supposed to be encouragement to challenge the youth to perform above and beyond what modern faggy society expects of them Fathers raise men, not boys.https://nicecrew.tv/static/streaming-playlists/hls/567eee2e-3410-4b6a-a200-f5dc0c183313/afa7fe9b-9591-4476-8417-2d2b6cf3b896-master.m3u8https://nicecrew.tv/videos/embed/bFussG5N6x1QRGYYPp7PTH5625302024-06-30T00:57:53.864ZYESBrother TylerNOhttps://nicecrew.tv/w/pyAVRfmQWPyZbAbCdqZtHhhttps://nicecrew.tv/lazy-static/thumbnails/4f6859e0-9f2d-46bb-bd14-0dcaa28f7854.jpgSome Amazing News about Joe Morrison, Framed in the Whitmer Fednapping Case!!I wanted to share some wonderful news about Joe's appeal and show you how he looks today!! Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/becf83e6-3135-4cfc-8931-7a9706ee400e/33984747-13cb-463a-875a-f21cc6602d2a-master.m3u8https://nicecrew.tv/videos/embed/pyAVRfmQWPyZbAbCdqZtHh7945202024-06-30T18:38:53.958ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/2RVtp6Ki3GMANhsVrmAkobhttps://nicecrew.tv/lazy-static/thumbnails/ba41d72f-1284-454d-bbaf-c752e3ca6356.jpgThis is so good to hear!This is so good to hear!https://nicecrew.tv/static/streaming-playlists/hls/0f118973-6a66-4092-9730-ab0702c78222/9efdd737-6b9e-47e0-a940-92d031017e33-master.m3u8https://nicecrew.tv/videos/embed/2RVtp6Ki3GMANhsVrmAkob46562024-06-30T19:35:16.931ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/dsXou7Gg7efSmuQpQbAPrUhttps://nicecrew.tv/lazy-static/thumbnails/a9003944-c57c-4966-86ee-e65d37b57ce3.jpgJJR - 258 - Chewing On Their Own TeethSummer Sunday solo show I go over Pedo President eyes popping out, Yaxley goes to Parlor, save the orphans you silly goy, Joe was right (again) and oh so much more.https://nicecrew.tv/static/streaming-playlists/hls/64f122c3-fe3e-45b5-bb6a-b5cc57448d2a/17d8c068-47c0-4e04-ba45-cd4f8ce23533-master.m3u8https://nicecrew.tv/videos/embed/dsXou7Gg7efSmuQpQbAPrU79075612024-07-01T12:20:34.056ZYESJust Joe Radio NOhttps://nicecrew.tv/w/97pc3eqvm8j7SxMapeXGd6https://nicecrew.tv/lazy-static/thumbnails/f0559e4e-ffe5-4918-9c94-e0666bf1c705.jpgPaul Bellar, Framed by the FBI in the Whitmer Fednapping hoax called, please listen & share!Paul Bellar, Framed by the FBI in the Whitmer Fednapping hoax called, please listen & share!https://nicecrew.tv/static/streaming-playlists/hls/41addd0a-801d-4d35-84fd-77859b31e5e5/bafbf3e5-a72d-4a4c-b979-b66694254da5-master.m3u8https://nicecrew.tv/videos/embed/97pc3eqvm8j7SxMapeXGd6133542024-07-01T18:29:24.619ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/76Jew9WmYnJt3g45bzyjw8https://nicecrew.tv/lazy-static/thumbnails/c94b4d16-e0de-4a3f-a8c2-37a7fce77635.jpgOur Women and Race July 1 - 7/1/2024, 11:30:32 PMUpdate on NatSoc University Discuss the importance of not mixing race NS University Telegram: https://t.me/+XWx9d0lRZxdiNDgx Nat Soc Intro – SHARE! https://goyimtv.com/v/2708035411/The-5-minute-video-introduction-to-National-Socialism https://entropystream.live/RedPilledRadio https://goyimtv.com https://odysee.com https://nicecrewdigital.digital Europa The Last Battle: https://europathelastbattle.net Red Pilled Radio: https://twitter.com/RedPilledRadio https://gab.com/GeorgeAngus Donations always appreciated: https://givesendgo.com/redpilledradio Support these great businesses! PepperCave: https://peppercave.com Use Discount Code FLOOD at checkout Huntress Designs: https://embossi.com/ MoneyTree Publishing: Based truths, in print: https://www.moneytreepublishing.com/https://nicecrew.tv/static/streaming-playlists/hls/316393f0-2e2a-4850-9386-858529afc72b/3af4a23a-01e3-4f59-b2b4-aa392bbdb242-master.m3u8https://nicecrew.tv/videos/embed/76Jew9WmYnJt3g45bzyjw86129032024-07-02T01:17:51.282ZYESRed Pilled RadioNOhttps://nicecrew.tv/w/784gscjDGNRhk5KrAJPrN4https://nicecrew.tv/lazy-static/thumbnails/f0867ed3-7034-4321-b378-e0df299b0b50.jpgFourth of Redonkulas | Live From The LairPopp and Battle Dwarf will be giving us a history lesson you probably didn't learn in school tonight at 8 PM EDT! #HistoryLesson #AmericanHistory #Redonkulas To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com!https://nicecrew.tv/static/streaming-playlists/hls/31930d24-f49d-4537-8fb4-2474770abdeb/1fe68fb0-0b10-4fe8-9b5e-d0fdd01b296c-master.m3u8https://nicecrew.tv/videos/embed/784gscjDGNRhk5KrAJPrN480780292024-07-03T02:17:20.120ZHistory LessonAmerican HistoryRedonkulasYESRedonkulas RegimentNOhttps://nicecrew.tv/w/frMQKQwzwLg24A9kbuXuLThttps://nicecrew.tv/lazy-static/thumbnails/6ef76262-ddb1-4493-ae2a-eb2e0a8504bc.jpgCocktails LIVE July 2 - 7/3/2024, 12:02:40 AMThis episode will be really boring. Nothing in the news at all this past week. https://nicecrew.tv/static/streaming-playlists/hls/74f9c928-7c7b-4f2d-944c-854f187af573/f4161a42-7cda-4e88-b597-7cf55cb01f9c-master.m3u8https://nicecrew.tv/videos/embed/frMQKQwzwLg24A9kbuXuLT7478022024-07-03T02:12:40.152ZYESCocktails With George & ModdyNOhttps://nicecrew.tv/w/5Hd7xBkx9Fryv36F1wnSZAhttps://nicecrew.tv/lazy-static/thumbnails/6024cd69-1db5-4351-abb5-002a6e1e899d.jpgMan Expresses Concerns About Yellowstone VolcanoOriginal post [here](https://nicecrew.digital/@lovelymiss/posts/AjXlGNdChUmVTyxCaG). https://nicecrew.tv/static/streaming-playlists/hls/26258396-87e1-4247-9ca1-7d457c01bf7c/3f14163e-760c-4b3f-a1da-9fd9ca957475-master.m3u8https://nicecrew.tv/videos/embed/5Hd7xBkx9Fryv36F1wnSZA48032024-07-03T11:32:36.767ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/nCuKkJfA6TvtTv8ZjX3ArFhttps://nicecrew.tv/lazy-static/thumbnails/d8ea51de-5745-4ace-830d-353e8baa5bbf.jpgJoe Morrison talks about the tactics of FBI Informat Dan ChappelJoe Morrison talks about the tactics of FBI Informat Dan Chappelhttps://nicecrew.tv/static/streaming-playlists/hls/af286758-c552-4000-8d42-0a8c44c00959/f41bb886-1c1a-4e0c-8a45-4bc28b42de75-master.m3u8https://nicecrew.tv/videos/embed/nCuKkJfA6TvtTv8ZjX3ArF53042024-07-03T15:30:12.307ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/4oCBrYoTzSUZkFAVLNL6Kyhttps://nicecrew.tv/lazy-static/thumbnails/7c98f9a7-53be-415c-9184-606014666c76.jpgWhitmer snubbed by Jill Biden & Gavin Newsome 😂 #michigan #biden #whitmer #2024electionsWhitmer snubbed by Jill Biden & Gavin Newsome 😂 #michigan #biden #whitmer #2024electionshttps://nicecrew.tv/static/streaming-playlists/hls/1b745763-01e2-496c-bfd3-099f3181e412/6199d525-635f-4c36-8c29-255ed8000b6c-master.m3u8https://nicecrew.tv/videos/embed/4oCBrYoTzSUZkFAVLNL6Ky54042024-07-03T19:30:26.023ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/kb6Yn4KC8zryqtUMreZRFVhttps://nicecrew.tv/lazy-static/thumbnails/7a08f489-03ae-4ac5-88ce-4b433d67dba6.jpgCultivate a Grateful Heart, Not an Anxious Heart 🤍 #joy #faith #hope #gratefulheart #scriptureCultivate a Grateful Heart, Not an Anxious Heart 🤍 #joy #faith #hope #gratefulheart #scripturehttps://nicecrew.tv/static/streaming-playlists/hls/9b46c0a2-7d3b-4f7a-b927-930ac9186487/061b82f2-8f2c-4347-9397-19f8aca2dd31-master.m3u8https://nicecrew.tv/videos/embed/kb6Yn4KC8zryqtUMreZRFV50002024-07-05T20:39:53.582ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/4Ugo6oTo36PhrHzCh8Hb5whttps://nicecrew.tv/lazy-static/thumbnails/2e317494-ddf4-47f2-aac5-17a358732a7a.jpgWhen you're sad, remember your blessings #blessings #faith #joy #depressionWhen you're sad, remember your blessings #blessings #faith #joy #depressionhttps://nicecrew.tv/static/streaming-playlists/hls/1f979222-e583-48af-b60a-1f6d9567e0c6/d02db3f3-6861-4712-8701-397d3a4c3c45-master.m3u8https://nicecrew.tv/videos/embed/4Ugo6oTo36PhrHzCh8Hb5w20012024-07-05T22:40:12.411ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/rw8wookefsnWmko6uNAo7ihttps://nicecrew.tv/lazy-static/thumbnails/2e8c7e96-f66a-4eed-8c13-99a115d9e27c.jpgAll of your suffering is for a reason #faith #joy #hope #suffering #scripture #prayerAll of your suffering is for a reason #faith #joy #hope #suffering #scripture #prayerhttps://nicecrew.tv/static/streaming-playlists/hls/cea96a96-e884-4233-bb2a-8af4e1603375/c87ea603-7e56-4ddf-a631-fb1badd54517-master.m3u8https://nicecrew.tv/videos/embed/rw8wookefsnWmko6uNAo7i23082024-07-05T22:40:15.424ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/5DCWDqSqQ2bimxcK6RsCRghttps://nicecrew.tv/lazy-static/thumbnails/91b14ce1-b504-4a3f-97d1-63f57f97cf85.jpgNew FBI Whistleblower Reports Retaliation Against Conservatives on @TheFirstonTVI joined Jesse Kelly to talk about the latest FBI whistleblower to come forward with allegations of retaliation against conservatives and dissidents inside the bureau. This latest whistleblower is a registered Democrat who has no reason to lie, and who blew the whistle against other high ranking officials within his department. He was in the security clearance division for the East Coast. His disclosures corroborate the allegations by FBI whistleblower Marcus Allen who was suspended without pay for 2 years while an investigation was carried out. The FBI had to reinstate Allen.https://nicecrew.tv/static/streaming-playlists/hls/25a5d72d-fc19-4991-b7dc-7e986d7ec3b9/c660d7e2-6e37-4483-97f6-28e041b4dfcf-master.m3u8https://nicecrew.tv/videos/embed/5DCWDqSqQ2bimxcK6RsCRg120032024-07-06T01:40:02.770ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/jSnAo7xtwZvgzEqKx6Zqv7https://nicecrew.tv/lazy-static/thumbnails/28ff54c3-41a1-4627-9bdd-6009d4f79b32.jpgHelldivers 2: NiggersCome watch me suck my own ballshttps://nicecrew.tv/static/streaming-playlists/hls/98ccfdcc-9dac-4e53-8e56-3143663f9150/c737ec06-885a-4fc4-a34f-384ef061cf5b-master.m3u8https://nicecrew.tv/videos/embed/jSnAo7xtwZvgzEqKx6Zqv746980432024-07-07T03:39:02.653ZYESGamingNOhttps://nicecrew.tv/w/t9Cu9tCmvoUyT6Yn8xAWYkhttps://nicecrew.tv/lazy-static/thumbnails/0e81f540-d518-4379-b9c6-b13b90e51552.jpgComing soon - Kidnap and Kill: an FBI Terror Plot #michigan #whitmer #fednapping #fbi #filmComing soon - Kidnap and Kill: an FBI Terror Plot #michigan #whitmer #fednapping #fbi #filmhttps://nicecrew.tv/static/streaming-playlists/hls/dbdb2dc7-e4c1-41f2-998a-6e53bf1c7a3b/0f4810f7-f816-492b-8329-cf884a4341c2-master.m3u8https://nicecrew.tv/videos/embed/t9Cu9tCmvoUyT6Yn8xAWYk7032024-07-06T23:40:00.687ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/71x8LGaK8eHMSUdns9LtTghttps://nicecrew.tv/lazy-static/thumbnails/e81ffb69-e1c4-4ed9-ba2c-5dcd96ba325c.jpgMaintaining hope and faith when you've been let down.I wanted to talk about maintaining hope and faith during times of struggle and uncertainty. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #faith #hope #prayer #god #scripturehttps://nicecrew.tv/static/streaming-playlists/hls/30aa04da-2941-4ea3-8b1c-718d8a1e9d49/0cec246d-ba40-4e17-afad-122b5cfd34a9-master.m3u8https://nicecrew.tv/videos/embed/71x8LGaK8eHMSUdns9LtTg9915132024-07-08T19:42:21.032ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/42gVBswqKZMrKBVgy5TPxuhttps://nicecrew.tv/lazy-static/thumbnails/1a8801dc-c5fb-409e-a9cf-81c54ed57af7.jpgWhen you take your eyes off GodThis happens when you take your eyes off the Lord. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/1878f935-44da-449d-93b2-f7385d6e3636/5743c43e-272a-4db3-b1f5-98769f9e75e2-master.m3u8https://nicecrew.tv/videos/embed/42gVBswqKZMrKBVgy5TPxu97042024-07-08T20:39:50.727ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/twm6UUwP9aM8DH7KJHGpvchttps://nicecrew.tv/lazy-static/thumbnails/5c766658-d501-47fd-8340-9c2128703327.jpgN WordN Wordhttps://nicecrew.tv/static/streaming-playlists/hls/dee371f7-18bc-4a3c-9928-a215cdf579a9/91c17b6e-364e-4696-838b-3a89b6565612-master.m3u8https://nicecrew.tv/videos/embed/twm6UUwP9aM8DH7KJHGpvc255222024-07-11T11:58:25.362ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/dfuJ9R8WKV1KZTQE12GZvthttps://nicecrew.tv/lazy-static/thumbnails/f2504f78-3304-4b34-a92f-1c517610361f.jpgGov. Whitmer just went on @ColbertLateShow and lied her face off #michigan #whitmer #latestnewsGov. Whitmer just went on @ColbertLateShow and lied her face off #michigan #whitmer #latestnewshttps://nicecrew.tv/static/streaming-playlists/hls/6333c7bb-2930-4260-956c-21f983da5581/31405e8b-40da-4fd3-a3c5-3344fd111fb9-master.m3u8https://nicecrew.tv/videos/embed/dfuJ9R8WKV1KZTQE12GZvt56582024-07-11T17:35:05.587ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/r3FqYeHbXNR66zyk3rKW8Rhttps://nicecrew.tv/lazy-static/thumbnails/550395fd-d5ad-475c-bbc2-5eb4c92ed418.jpgPresident Trump Shot at RallyOn 07/13/2024 an individual attempted to assassinate President Donald Trump at a rally.https://nicecrew.tv/static/streaming-playlists/hls/cad44103-32a7-480f-a536-36a35afe83a7/0df63303-31b9-4d8d-94e9-2047fedf7f4e-master.m3u8https://nicecrew.tv/videos/embed/r3FqYeHbXNR66zyk3rKW8R1285242024-07-13T22:57:26.626ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/qgjynrTnXrA5Des7fjyWQdhttps://nicecrew.tv/lazy-static/thumbnails/045cb63e-a5a8-439c-a39c-bc95e45eeaa1.jpgEyewitness Provides Account of Trump Assassination AttemptEyewitness Provides Account of Trump Assassination Attempthttps://nicecrew.tv/static/streaming-playlists/hls/c47eebd5-6419-41a5-ac84-1b98760ac4e4/67a524d8-259b-43c8-97c7-4e0d44b12b9b-master.m3u8https://nicecrew.tv/videos/embed/qgjynrTnXrA5Des7fjyWQd2700512024-07-14T00:11:48.663ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/tsXsFth4oxJu2zubedmjRWhttps://nicecrew.tv/lazy-static/thumbnails/853ea421-0abb-4dd4-a6bd-52d5826eb10f.jpgJJR - 259 - A New Level Of LowThe attempted assassination of Trump brings America down to a whole new level of late stage collapse. But what happened?! How much of what we're seeing is real?! We get into it. Also Spaceman save me from the swats, activists spotted in Nashville, international callers, Hulk Hogan is our guy and so so much morehttps://nicecrew.tv/static/streaming-playlists/hls/de6a42a2-038e-40f8-a224-b11c26b2a858/aff36f45-9cf5-4a5e-9ac3-1e845a0d75c7-master.m3u8https://nicecrew.tv/videos/embed/tsXsFth4oxJu2zubedmjRW108144.6666666666666675692024-07-15T04:43:16.772ZYESJust Joe Radio NOhttps://nicecrew.tv/w/qnvHntAgpqUohAknoeeXpYhttps://nicecrew.tv/lazy-static/thumbnails/5420e8c8-ce5b-4f59-921f-9a3f8229f310.jpgAnother Angle of the Trump Assassination AttemptAnother Angle of the Trump Assassination Attempthttps://nicecrew.tv/static/streaming-playlists/hls/c55c422b-0e55-44b8-9b90-9f42d5429682/6f2911b6-3fe4-40fa-8942-1db6e804f20a-master.m3u8https://nicecrew.tv/videos/embed/qnvHntAgpqUohAknoeeXpY4601032024-07-14T20:56:37.243ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/6d1zKMGVxABHQsUxZA9u6fhttps://nicecrew.tv/lazy-static/thumbnails/cf94b728-0e73-43c7-8b38-2a94c85f64a9.jpgTrump Assassination Attempt CompilationThis is a compilation of videos from eyewitnesses that have been put together in an attempt to build a real time account from several different angles. Original post can be found [here](https://x.com/TheMilkBarTV/status/1812731727053488418). https://nicecrew.tv/static/streaming-playlists/hls/2a2afa29-ba11-4808-bc66-d160fb8028e0/fea42c8d-7130-4eea-b3cb-4b2f15aa1b1a-master.m3u8https://nicecrew.tv/videos/embed/6d1zKMGVxABHQsUxZA9u6f26951072024-07-15T11:41:08.556ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/kkxqG4bTPdqrWLdserjhpHhttps://nicecrew.tv/lazy-static/thumbnails/87d94afc-80f2-4c99-b1ea-c89c9b2647de.jpgTrump Assassination Attempt As Told By The JapaneseI fucking love Japan https://nicecrew.tv/static/streaming-playlists/hls/9c982208-b863-4f75-b82b-a63d2d58fa9f/0f762641-07bc-4990-8dce-78660999abd0-master.m3u8https://nicecrew.tv/videos/embed/kkxqG4bTPdqrWLdserjhpH240152024-07-16T01:33:44.906ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/aFaD71mFY4h7uyC815uG5khttps://nicecrew.tv/lazy-static/thumbnails/6e99d3c9-6670-49be-9f11-ae4d4926e3ce.jpgSecret Service Resources DIVERTED from Trump to Jill Biden, Major Questions Remain.We are now learning from RealClearPolitics that Secret Service resources were diverted to Jill Biden's event and away from Trump's because they followed agency protocol applying to Trump as a former president. There were also supplemental agents from different field offices bought in. They claim Trump's own detail was incredibly overworked; some even worked 7 days a week. Trump had requested increased security, but those requests were denied by Mayorkas and DHS. The Secret Service was apparently under investigation by House GOP before this due to another incident where a female Secret Service agent from VP Kamala Harris's detail suffered a mental breakdown and attacked staff. We have also learned the Director of the Secret Service, Kimberly Cheatle who pushed for DEI and 30 percent women in policing by 2030 was a good friend of "Dr." Jill Biden and worked for PepsiCo before her appointment. Sources: https://twitter.com/susancrabtree/status/1812606597753168329 https://www.realclearpolitics.com/articles/2024/07/14/gop_was_investigating_secret_service_before_assassination_attempt__151261.html https://headlineusa.com/secret-service-director-to-testify-at-public-congressional-hearing-on-monday/ Support: https://www.kandkfilm.com/donate https://www.kandkfilm.com/merch Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/4e5a3216-86f2-468f-9ec7-3a4d5ecee4fb/9ce6c1a8-6477-401f-b1da-4b86adb5eaee-master.m3u8https://nicecrew.tv/videos/embed/aFaD71mFY4h7uyC815uG5k19235142024-07-16T17:49:52.235ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/krd7rhpiSBcSjxM4Ui3Khdhttps://nicecrew.tv/lazy-static/thumbnails/55b4a432-9d22-42b2-a6af-2f6f7d4c8acd.jpgIf you're in Michigan, I have a huge favor to ask!! #michigan #helpIf you're in Michigan, I have a huge favor to ask!! #michigan #helphttps://nicecrew.tv/static/streaming-playlists/hls/9d62b143-8523-48f3-9640-33d666fbfdd8/a3d13080-05c8-4a52-bbf0-0b2e32aa190e-master.m3u8https://nicecrew.tv/videos/embed/krd7rhpiSBcSjxM4Ui3Khd54082024-07-16T18:45:11.060ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/hyUaFWxpzYbZvprxJCWyMehttps://nicecrew.tv/lazy-static/thumbnails/c070a1a2-5741-409c-a6f1-b131887b5d29.jpgUpdate from Jackson County, Michigan. I am Heartbroken.Update from Jackson County, Michigan. I am Heartbroken.https://nicecrew.tv/static/streaming-playlists/hls/862a2b14-a508-412a-bef0-d7aa0d949aef/875319c0-8451-4ce6-8359-e4c2fccb50fa-master.m3u8https://nicecrew.tv/videos/embed/hyUaFWxpzYbZvprxJCWyMe565232024-07-19T23:40:30.610ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/iHaBqCVLhcSdagMnVidh3Whttps://nicecrew.tv/lazy-static/thumbnails/254394aa-ed03-4981-9819-5f5ce8e884d9.jpgJJR - 260 - It's So JoeverOk, PedoBiden's out. So who's in?! Conspiracies and predictions abound. We get into it. Also, bubbling cauldron of unsustainability, Trumpamania Runnin' Wild, Nazzies in Nashville, leave Darcy alone, Biden mic drop and oh such morehttps://nicecrew.tv/static/streaming-playlists/hls/8f6ac64e-b459-4f99-8e54-494032c1a9ba/9e977c6f-81ee-4887-b240-97cc2bbce824-master.m3u8https://nicecrew.tv/videos/embed/iHaBqCVLhcSdagMnVidh3W841452682024-07-22T04:01:03.450ZYESJust Joe Radio NOhttps://nicecrew.tv/w/jfCQW7LT36YsNC1rPYvq7hhttps://nicecrew.tv/lazy-static/thumbnails/2e7e3834-3523-438a-9466-b962e3811a9c.jpgDo Not ComeI'm gonna come.https://nicecrew.tv/static/streaming-playlists/hls/93cf9d48-0521-48dc-8a5c-ded3ee8f4b74/54c4ea34-c270-4cdc-a48b-4cc3f102d37f-master.m3u8https://nicecrew.tv/videos/embed/jfCQW7LT36YsNC1rPYvq7h14522024-07-23T02:55:15.536ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/74Ho84a6ToUqfDppCQx9qphttps://nicecrew.tv/lazy-static/thumbnails/79d68603-9c2b-4549-9544-a47fc1e670e1.jpgBohemian Grove, Cremation of Care 2024Archive of the [original video](https://www.youtube.com/watch?v=8Vy8LTmmDvk) on YouTube, in case it gets taken down for whatever reason.https://nicecrew.tv/static/streaming-playlists/hls/311b90c2-8889-4e9b-9e33-acabd699e93f/b2dec960-6e6e-4a86-87d2-6cfb0bff64dc-master.m3u8https://nicecrew.tv/videos/embed/74Ho84a6ToUqfDppCQx9qp215902452024-07-24T14:35:04.543Zbohemian grovecreepyelitesarchive2spookyYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/kjiBuXtqY4EtwCQj7Bqk17https://nicecrew.tv/lazy-static/thumbnails/cc39e563-4456-414e-9470-9c56b22316c2.jpgVDARE Closing AnnouncementPeter Brimelow, who founded VDARE in 1999, announces that he will be dissolving the business due to lawfare brought forth by New York State Attorney General Letitia James.https://nicecrew.tv/static/streaming-playlists/hls/9c6be04f-9f89-40e6-b315-ba1bace9dce2/20ad6ac2-242b-4a68-8be1-2905ab24e1c0-master.m3u8https://nicecrew.tv/videos/embed/kjiBuXtqY4EtwCQj7Bqk174800272024-07-24T21:43:19.063ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/antVrCwfcsemXHRp3DajQwhttps://nicecrew.tv/lazy-static/thumbnails/97bda933-bbd3-4521-b5b8-5e5ddcdd5292.jpgWill Gretchen Whitmer Speak to Man Acquitted in "Kidnap Plot" Running for Sheriff of Wexford County?Eric Molitor, acquitted in the FBI's Whitmer "Kidnap Plot" case tries to take Whitmer up on her offer to talk: Since the publication of her book "True Gretch," Gov. Whitmer has been doing the rounds giving interviews to the media and selling herself to further her national ambitions. In these interviews, she continues to repeat the lies about the FBI's fednapping hoax, in which five of these men have already been acquitted due to egregious entrapment and misconduct. She has timed this to maximize damage to the appeals of the five men currently still incarcerated and appealing their wrongful convictions. In her book, she talks about how she would love to speak to the "men who plotted to kidnap her," but she need look no further than the FBI, DOJ, Michigan State Police & AG's office. She coordinated the "recons" of her vacation cottage, picking a date and time most convenient and working with her security detail. Eric Molitor has a lot of serious questions for her, and so do the American people. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #kandkfilm #ericmolitor #michigan #whitmer #documentary #indiefilm #filmhttps://nicecrew.tv/static/streaming-playlists/hls/4be21304-c26d-4d13-b1ac-dabe83cf1abe/3ab7b982-db6d-47bc-bea7-e64d1dc88bc1-master.m3u8https://nicecrew.tv/videos/embed/antVrCwfcsemXHRp3DajQw263562024-07-25T15:02:56.844Zmichiganwhitmergretchen whitmertrue gretchfbiYESRadix Verum ☦NOhttps://nicecrew.tv/w/wWPng8EpkMBjt4P3PDh9tghttps://nicecrew.tv/lazy-static/thumbnails/7b4e0edd-bd4b-4cb4-b20d-576dc3b1bcff.jpgJJR - 261 - Crazy Conspiracies ConfirmedKicking around crazy but confirmed conspiracy theories with Matty Boombalatty. Also the many faces of Biden, deliberately demonic disgusting display at the Olympics, it's not just a sexual perversion, Alex Jewns at it again, Bibi gets TWO bj's and so much morehttps://nicecrew.tv/static/streaming-playlists/hls/fa998399-b0af-4c0d-b7d6-d8702944b87d/04ea8236-54c2-46b9-9d7c-61d0b8464b18-master.m3u8https://nicecrew.tv/videos/embed/wWPng8EpkMBjt4P3PDh9tg924554222024-07-28T05:25:53.627ZYESJust Joe Radio NOhttps://nicecrew.tv/w/vc8xHMuGqz2MhvjacEs1AHhttps://nicecrew.tv/lazy-static/thumbnails/2ede843b-7ca2-43be-805e-f54b738e2ed7.jpgYou Cant Fly But You Can Tryi usually spend more time playing this than COD surprisingly. its just that good. most recent fragclip from my youtube channel NetRancherhttps://nicecrew.tv/static/streaming-playlists/hls/ec66da82-8a9e-4316-bc4d-9be347a7ac6d/89f99ef6-318a-4c4a-97a9-83059edec3af-master.m3u8https://nicecrew.tv/videos/embed/vc8xHMuGqz2MhvjacEs1AH2210112024-07-28T22:33:31.615Zrobloxphantom forcesmontageclipeditYESCapt. Fuggetaboutit's NetRancherNOhttps://nicecrew.tv/w/gyN6ng9ABVqyLznVUZ38c9https://nicecrew.tv/lazy-static/thumbnails/650a319e-34cf-468b-b48c-f62c9a4c2eed.jpgYou are under attack. Let's talk about the Devil and his Works.We will read the chapter on the Devil and his works from Spiritual Counsels by Father John of Kronstadt. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/7e0d493b-d02e-4c3e-9d90-3d64c2e850a2/dbb33386-dd17-4036-a4bc-346d7e656273-master.m3u8https://nicecrew.tv/videos/embed/gyN6ng9ABVqyLznVUZ38c91961542024-07-29T20:04:15.446ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/niKmNRRMZ4mMHnCVWt61YShttps://nicecrew.tv/lazy-static/thumbnails/c34a5869-b51a-4022-b341-2e8c995b2f75.jpgYes, I'm RacistOriginal song [here](https://www.youtube.com/watch?v=GF9COdMuJr0).https://nicecrew.tv/static/streaming-playlists/hls/ac8a46d7-ffa3-449c-956c-e49e07c8a85a/28877da8-1d84-4d17-bcfa-2d392008d2ba-master.m3u8https://nicecrew.tv/videos/embed/niKmNRRMZ4mMHnCVWt61YS300492024-07-30T01:57:04.823ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/eFdjHtBfhxMN8AmCKXfHtmhttps://nicecrew.tv/lazy-static/thumbnails/d42764a2-77a0-4d29-96a9-b83be00d66b0.jpgSquirrels in a treeSquirrels in a treehttps://nicecrew.tv/static/streaming-playlists/hls/6ec0675a-b1fc-4356-95c0-6a9182e0da76/c517012c-d47d-4e90-adc2-7e91244a554a-master.m3u8https://nicecrew.tv/videos/embed/eFdjHtBfhxMN8AmCKXfHtm68072024-07-30T20:40:25.457ZYESCybershell's CyberStreamsNOhttps://nicecrew.tv/w/svJupVuhoZeXfKLiwKueQ8https://nicecrew.tv/lazy-static/thumbnails/d124fe31-06f9-45fc-98aa-64490ea649af.jpgWe need to talk about Israel, Gaza, and WWIIIThis is something we all need to be aware of and informed about. Please keep everyone in the Middle East in your prayers. Sources: https://x.com/OmarBaddar/status/1815428315915973042 https://x.com/onlyfanon/status/1816506863938363735 https://www.jpost.com/breaking-news/article-812245 https://x.com/Ha_Matar/status/1817885626458337336 https://x.com/MaxBlumenthal/status/1818152941804470725 https://x.com/muhammadshehad2/status/1817888214767620521 Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #israel #middleeast #wwiii #lebanon #iranhttps://nicecrew.tv/static/streaming-playlists/hls/d6b45c1c-0281-4de2-94f3-51f8927f8fcb/cc34905f-19b0-4493-84a2-8caa7190dc55-master.m3u8https://nicecrew.tv/videos/embed/svJupVuhoZeXfKLiwKueQ813875152024-07-31T19:49:40.075ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/dezC4cJdsEJGgqyyVZE9XYhttps://nicecrew.tv/lazy-static/thumbnails/9f6ec9f0-e8ac-4f14-a28d-fca62460feba.jpgFather John of Kronstadt on Sin and Self ExaminationWe are continuing our reading of select passages from My Life in Christ, aka Spiritual Counsels by Father John of Kronstadt. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #prayer #orthodoxy #scripture #spiritualcounsels #sin #spiritualwarfarehttps://nicecrew.tv/static/streaming-playlists/hls/63130d91-955b-4ed3-9db1-382d978c606e/d26f0cc9-36f2-49b4-b714-def8052e0276-master.m3u8https://nicecrew.tv/videos/embed/dezC4cJdsEJGgqyyVZE9XY967532024-07-31T19:48:12.556ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/ojSwwJMoCiaoCpCeDt2vsDhttps://nicecrew.tv/lazy-static/thumbnails/64ace1bd-98c9-4314-a78c-b76c6b50a6ed.jpgHilary - no lingering effectsHilary Clinton in fine shape after a head injuryhttps://nicecrew.tv/static/streaming-playlists/hls/b4cb938c-c875-4f81-9943-6f61d7c21855/f0cdbbce-7976-4c7f-9306-983ff098ee2e-master.m3u8https://nicecrew.tv/videos/embed/ojSwwJMoCiaoCpCeDt2vsD185162024-08-01T03:24:09.979ZYESMain teknoskillz channelNOhttps://nicecrew.tv/w/6VAKggV5v23wXVxqeWhFyzhttps://nicecrew.tv/lazy-static/thumbnails/0712f239-7751-48df-8a7b-cbf262187673.jpgThe USS Liberty Story by Aaron KasparovFull story of the attempted destruction of the USS Navy ship AGTR5 (Advanced General technical research5) by Israel to get the US involved in their 6 day war.https://nicecrew.tv/static/streaming-playlists/hls/2ff986aa-cf87-482c-b700-721c1559e35d/55426273-a277-4ef2-b17d-2aedb4ac2017-master.m3u8https://nicecrew.tv/videos/embed/6VAKggV5v23wXVxqeWhFyz29730342024-08-01T03:47:22.750ZYESMain teknoskillz channelNOhttps://nicecrew.tv/w/ouxVHusbp5cUGdGjxwgNo7https://nicecrew.tv/lazy-static/thumbnails/0a7a42e0-cd33-4137-bcaa-d9e231189910.jpgIf you have been betrayed or you betrayed someone - watch this.Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/b6258d1f-0345-4992-9917-3da37db1e892/a8dd05bb-2e52-4e7b-9c59-7d445c09ebfb-master.m3u8https://nicecrew.tv/videos/embed/ouxVHusbp5cUGdGjxwgNo716173.75512024-08-01T22:49:15.102ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/kjQDDpEH7JckzpqfqypHRBhttps://nicecrew.tv/lazy-static/thumbnails/0593af3b-f5c2-41ff-a329-b0b153e58db9.jpgThe Jews & The White Slave Trade - Dr. William PierceExcellent presentation by the late Dr William Pierce, the leader of the National Alliance.https://nicecrew.tv/static/streaming-playlists/hls/9c7f00e1-a0b9-471a-bdde-99a8672e1119/0486e516-6b46-4ee4-9e04-559c86127065-master.m3u8https://nicecrew.tv/videos/embed/kjQDDpEH7JckzpqfqypHRB1375072024-08-02T12:37:57.301ZYESMain teknoskillz channelNOhttps://nicecrew.tv/w/wJsp2NxRnS9vwbcbcqSbWxhttps://nicecrew.tv/lazy-static/thumbnails/998090ac-f2d1-424f-a217-cddd68cda8fe.jpgCHIMPEESHA talks about KAMALA HARRISLatest news from Chimpeesha Jones on da sheit dey trying to pull off and she be pissedhttps://nicecrew.tv/static/streaming-playlists/hls/f8dfaa79-ec1a-4983-9654-2976bf682ef3/27014b28-b228-4898-a163-1cd951486896-master.m3u8https://nicecrew.tv/videos/embed/wJsp2NxRnS9vwbcbcqSbWx293032024-08-02T12:55:20.806ZYESMain teknoskillz channelNOhttps://nicecrew.tv/w/2rSMRUEJTGAMsuctKHL3q8https://nicecrew.tv/lazy-static/thumbnails/52181d6d-fba1-43b4-ae48-739f5f8f46b7.jpgPajeet Cargo Services IncOffering free bridge demolition services...https://nicecrew.tv/static/streaming-playlists/hls/0bb608a6-7239-4859-8a21-105cdef8384f/fd1a7bec-f48c-47c6-98f1-37b5b353bb67-master.m3u8https://nicecrew.tv/videos/embed/2rSMRUEJTGAMsuctKHL3q823082024-08-02T13:44:04.983ZYESMain teknoskillz channelNOhttps://nicecrew.tv/w/rvmHtr1Cn57pgPAbASxwsfhttps://nicecrew.tv/lazy-static/thumbnails/6cc47eac-beea-4140-8231-5cec4a31df82.jpgJJR - 262 - Is It Finally Happening?!Three hours STACKED with content! Former Mayoral Candidate, devout Christian, and man of action Christopher Wood joins me to detail how he ended up facing a year in jail...over words. Also mass unrest breaking out across Europe begs the question "Is it finally happening?!", the Grand Olympic Humiliation Ritual slash Gaslighting Campaign rages on, attempts to erase the sacred role of fathers, racist laundromats and oh so much more.https://nicecrew.tv/static/streaming-playlists/hls/ce8dcd4b-825b-4060-86f1-f6e82f28abe2/e6975bb5-6919-408d-b47b-2fe44b0a2491-master.m3u8https://nicecrew.tv/videos/embed/rvmHtr1Cn57pgPAbASxwsf1109953152024-08-04T04:50:07.532ZYESJust Joe Radio NOhttps://nicecrew.tv/w/1Bcjn1ds4ZY56W8nNf9Uv4https://nicecrew.tv/lazy-static/thumbnails/73989e19-f5d9-423a-a07e-129fcc4e4217.jpgOn repentance, contrition, and forgiveness - Saint John of KronstadtWe continue reading from Spiritual Counsels, Select Passages from My Life in Christ by Saint John of Kronstadt. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/04ea018c-31cb-48f0-a3df-29af34470185/1ce774d4-57ee-42d8-851c-35b94481bc81-master.m3u8https://nicecrew.tv/videos/embed/1Bcjn1ds4ZY56W8nNf9Uv41767552024-08-04T19:27:48.199ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/k4rVhkSkRqLj1kTbWuqZsAhttps://nicecrew.tv/lazy-static/thumbnails/72b08536-e0ed-46b4-ad8e-38b4438774a3.jpgOn the nature of Spiritual Warfare - You must understand this.Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/9a58d6ba-afbe-4830-a39d-dd89f31c554a/96b25335-1f82-4519-a009-5fb419ed1111-master.m3u8https://nicecrew.tv/videos/embed/k4rVhkSkRqLj1kTbWuqZsA76851122024-08-04T19:25:07.518ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/cxMEYajnYF84tW9U7h9Dewhttps://nicecrew.tv/lazy-static/thumbnails/9f618b49-b893-4f5b-bfa3-cddc4191d9b9.jpgFT991A Panadapter Installation via SDR-Kits.comNerd shit. Basically, makes it where I can look at more than the radio can by itself. The installation of a circuit board that lets me tap into the receive stage of my radio, and be able to "look" at the intermediate frequency in this receiver using an external software defined radio. Kind of a hack - still fun. First 1080p long form video because Matty ">480p"-d me one time.https://nicecrew.tv/static/streaming-playlists/hls/5d84ba79-99c7-43d4-92f7-7ad1c5006e44/ba8d38ff-04e1-4289-8d08-bc1fae3797cf-master.m3u8https://nicecrew.tv/videos/embed/cxMEYajnYF84tW9U7h9Dew35355422024-08-06T10:05:12.573ZYESBrother TylerNOhttps://nicecrew.tv/w/1KyYvmW8FSgAKBcUd2A5LJhttps://nicecrew.tv/lazy-static/thumbnails/ad942356-e356-49ed-9a93-95fd32b42638.jpgThe bionic negrosLatest revision from Sgt BDC BigDaddyCork USMChttps://nicecrew.tv/static/streaming-playlists/hls/06154d9f-363f-4b6c-b922-2b55743ca212/fb91dcb6-0227-4583-a03a-029adaa5a9fc-master.m3u8https://nicecrew.tv/videos/embed/1KyYvmW8FSgAKBcUd2A5LJ715112024-08-06T18:38:21.025ZYESMain teknoskillz channelNOhttps://nicecrew.tv/w/bxAHhXEaytM6kjGZJwwdN7https://nicecrew.tv/lazy-static/thumbnails/33b78f87-6528-480a-aa44-c3af5992041b.jpgJJR - 263 - The QuickeningOccasionally you have to stop, conduct an honest assessment, and then just take stock of where you actually are. You can reflect on how you got there later. It's my contention, the events of this week, are not only historic, troubling, and foreboding. But also direct evidence the world has collectively advanced into the final stages of White genocide. Please. Have seat. Get comfy. Click the link, and allow me to make my case.https://nicecrew.tv/static/streaming-playlists/hls/5564d5e0-d2d4-4634-9802-a6ececbfc132/9fc88472-4077-41c9-a115-50ec6e8f953b-master.m3u8https://nicecrew.tv/videos/embed/bxAHhXEaytM6kjGZJwwdN7787353272024-08-09T00:57:44.032ZYESJust Joe Radio NOhttps://nicecrew.tv/w/nPJvtPPdDt8ggSmsb2ys5whttps://nicecrew.tv/lazy-static/thumbnails/17219b27-b8b9-4c6e-9a97-a34f007efa8b.jpgThe Armory of the Spiritual WarfareWe continue with our reading from Saint John of Kronstadt's Spiritual Counsels Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/b0ba10d1-e430-46e8-bc02-146f64ce317e/59635be8-22b6-430c-8038-598f293285fb-master.m3u8https://nicecrew.tv/videos/embed/nPJvtPPdDt8ggSmsb2ys5w595502024-08-08T21:11:25.982ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/szufrxMQS3NSryc1zkwhiehttps://nicecrew.tv/lazy-static/thumbnails/d4941161-fa6b-4b99-a27c-2394db088bd9.jpgThe Sonichu Demon is Very Real....The Sonichu demon has been causing chaos in the world of e-celebs. One by one, those who wore the Sonichu medallion have fallen, their lives in shambles and ashes, a husk of the person they once were before they called upon the Sonichu demon.   Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/d73a8f01-9ddc-492f-a536-99f445085e27/b1c25fda-40e6-4812-9b8e-91ed5e057861-master.m3u8https://nicecrew.tv/videos/embed/szufrxMQS3NSryc1zkwhie51151272024-08-08T21:11:42.159ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/wN9BFMtr1u3n54bo1oQ6bDhttps://nicecrew.tv/lazy-static/thumbnails/ed4e394b-6ecc-4ad5-bcfb-21e03afb8128.jpgDocumentary BTS - doing some coloring and editing!some BTS for K and K Film!!https://nicecrew.tv/static/streaming-playlists/hls/f963aebc-feb0-4d23-86ab-d42a71a10c7d/7782838e-85fe-4b04-bdff-5b3c72b192a3-master.m3u8https://nicecrew.tv/videos/embed/wN9BFMtr1u3n54bo1oQ6bD275122024-08-10T17:09:27.573ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/71iKqw7opgcV8tM7XC6V75https://nicecrew.tv/lazy-static/thumbnails/872b89a7-19f4-4421-8ad4-6bb4c1ea998f.jpgThe Jews cheap disposable Army of NiggersA++ Video made by Dr Manhattan, describes how the jewish politicians use the nigger to wreck civilized nations from the inside.https://nicecrew.tv/static/streaming-playlists/hls/30a1c51c-70da-4234-94b8-1d546bb1233c/15d7cbfa-7710-4266-b30b-0a2bc83fe18f-master.m3u8https://nicecrew.tv/videos/embed/71iKqw7opgcV8tM7XC6V752995162024-08-11T14:57:53.552ZYESMain teknoskillz channelNOhttps://nicecrew.tv/w/6A7teWiCVcdM1fpvpRey5Ahttps://nicecrew.tv/lazy-static/thumbnails/549dfb08-0859-458f-91d4-c3babeeef61e.jpgUK Resistance PropagandaUK Resistance Propagandahttps://nicecrew.tv/static/streaming-playlists/hls/2d40f7f2-dd97-4611-99ea-f7df6d06c3c2/fb67fee7-f939-4ae4-b131-ef72a66bca4e-master.m3u8https://nicecrew.tv/videos/embed/6A7teWiCVcdM1fpvpRey5A24072024-08-12T11:22:42.068ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/rHVURvmwPQps12kzbDweCehttps://nicecrew.tv/lazy-static/thumbnails/ff6a10fc-e369-4d30-b2cd-07203c140365.jpgSnordster - 1Here Be Stuffhttps://nicecrew.tv/static/streaming-playlists/hls/d04f2f60-b1ef-4540-ae85-0fd629f87609/e2dcabba-732a-4727-8d5c-b68e31a63b77-master.m3u8https://nicecrew.tv/videos/embed/rHVURvmwPQps12kzbDweCe1110042024-08-14T20:23:18.379ZYESMain ChannelNOhttps://nicecrew.tv/w/xw1CymmFu3zQinkZexPPgBhttps://nicecrew.tv/lazy-static/thumbnails/c4271b1f-1670-4d12-a640-dd15ef8a786a.jpgSnordster - 2SNORDSTER: You Cause Chain Reactions in Nature that Are Going to Come for Your Asshttps://nicecrew.tv/static/streaming-playlists/hls/ff3bffff-fd13-46f5-9d6f-3a321587cb4d/5b244073-41e9-4772-8276-a5863fad94c6-master.m3u8https://nicecrew.tv/videos/embed/xw1CymmFu3zQinkZexPPgB611082024-08-14T20:44:52.058ZYESMain ChannelNOhttps://nicecrew.tv/w/b2xvbrukAaQjgN5KuzmuQvhttps://nicecrew.tv/lazy-static/thumbnails/d051d792-3f5f-43f7-8871-2cdfede5d52d.jpgA Grand Day Out - Wallace and GromitThe classic - the moon is made of cheese. A simple archive of a cultural classic.https://nicecrew.tv/static/streaming-playlists/hls/51328b7b-1984-4fe2-8091-a9af7b2df55d/ed7de85c-a435-41b7-92a7-6924291f26b6-master.m3u8https://nicecrew.tv/videos/embed/b2xvbrukAaQjgN5KuzmuQv14375162024-08-16T06:29:48.259ZYESBrother TylerNOhttps://nicecrew.tv/w/fM4rkbTwbuFqLQwE8nYgURhttps://nicecrew.tv/lazy-static/thumbnails/7c090048-64e0-48d3-943a-d944361ad445.jpgThis Land Is Mine♡ Copying is an act of love. Please copy and share. https://copyheart.org/ Nina's original article (2012) with viewer's guide: https://blog.ninapaley.com/2012/10/01/this-land-is-mine/ https://nicecrew.tv/static/streaming-playlists/hls/77aa8763-0c06-4530-ab03-390485dc7c05/3b4ab610-0ce5-465b-8fe3-c0b0fd9a2df8-master.m3u8https://nicecrew.tv/videos/embed/fM4rkbTwbuFqLQwE8nYgUR2125112024-08-17T00:42:51.766ZAnimationFree CultureIsraelJewishSeder-MasochismYESMain ChannelNOhttps://nicecrew.tv/w/wwvoDjUwujF2YqUA6WSTFDhttps://nicecrew.tv/lazy-static/thumbnails/11e12e50-0bdc-4a06-84cd-f7d82e65bab1.jpgGodly friendships in a deceitful and vain world.“The self-love and cleverness of men, alienating them from each other and perverting the law, have cut our single human nature into many fragments.” + St. Maximos the Confessor There is a lack of decency, dignity, and honor among the people of the world today. We are in a throwaway and disposable society—the generation of indifference and apathy. Everyone sees everyone else as disposable or a replaceable commodity in the deceitful and vain world. This is why it's so important to cultivate godly and heavenly friendships. Jesus spoke about the highest form of friendship in John 15 when he said "Greater love hath no man than this, that a man lay down his life for his friends. Ye are my friends, if ye do whatsoever I command you. Henceforth I call you not servants; for the servant knoweth not what his lord doeth: but I have called you friends; for all things that I have heard of my Father I have made known unto you."https://nicecrew.tv/static/streaming-playlists/hls/f73495db-869f-4307-a586-a1b4253a6af7/ff80453f-3e4f-47e2-b492-a17a6ff38c22-master.m3u8https://nicecrew.tv/videos/embed/wwvoDjUwujF2YqUA6WSTFD18722.51122024-08-19T12:04:53.513ZfaithscripturefriendshipsprayerYESRadix Verum ☦NOhttps://nicecrew.tv/w/2hT9j9onLHVRgGbAW34xn2https://nicecrew.tv/lazy-static/thumbnails/b1722fb9-f4f1-4a05-8d89-bf3193631e75.jpgcan you fly bobby finalcan you fly bobby finalhttps://nicecrew.tv/static/streaming-playlists/hls/0a748ea2-f053-4be0-83b3-b7dc51323bf7/2487a35c-20a4-4a01-a6a8-5dd63fa5be7a-master.m3u8https://nicecrew.tv/videos/embed/2hT9j9onLHVRgGbAW34xn222082024-08-20T16:35:08.304ZYESMain lolocaustianity channelNOhttps://nicecrew.tv/w/xxrT4XEdm2ZsAmcMDqqEJ9https://nicecrew.tv/lazy-static/thumbnails/b196a315-8663-4069-9ed3-1357fde09108.jpgSpooksville: UK Tech Tycoon Mike Lynch Missing, Co-Defendant DEADBritish billionaire tech entrepreneur Mike Lynch, co-founder of Autonomy and Darktrace, and Jonathan Bloomer, Chairman of Morgan Stanley International are missing after yacht Bayesian was wrecked off the coast of Sicily. 22 people were on board, 15 were recused. Stephen Chamberlain, his former VP of Finance was hit by a car in Cambridgeshire on Saturday and has passed away less than 48 hours before Lynch's disappearance. Lynch worked with the US/UK intelligence community and his tech was used by spooks. Arch neocon Richard Pearle helped found Autonomy. Sources: https://www.ft.com/content/62573c65-6504-4b6b-8031-266a6a8b3830 https://x.com/KlonnyPin_Gosch/status/1825654072176947606 https://www.standard.co.uk/business/uk-tech-star-mike-lynch-claims-hp-targeted-him-because-he-is-wealthy-a4102216.html https://www.bbc.com/news/av/business-20421624 https://x.com/smallcapsteve/status/1825870231765434591 https://x.com/MichaelEWriter/status/1825648751618232715 https://x.com/Livooo/status/1825879094434611524https://nicecrew.tv/static/streaming-playlists/hls/ff6f4e03-e181-4301-9eac-1cd7bf1a5f04/969407ae-14f1-42e7-82cb-c1f0693c329d-master.m3u8https://nicecrew.tv/videos/embed/xxrT4XEdm2ZsAmcMDqqEJ912422.5572024-08-20T19:22:20.633Zmike lynchuktechspooksautonomyYESRadix Verum ☦NOhttps://nicecrew.tv/w/29N8dBoDuaVnxpZu9uiqqAhttps://nicecrew.tv/lazy-static/thumbnails/dd0cca92-61ac-4206-a0cf-d4396cb82056.jpgNigger Was The Race That God Gave Me ft. Harold and SusieVote for this song at NationalTop40.com 0/ https://nicecrew.digital/@HaroldRosenthal@poa.st https://nicecrew.digital/@SusieChan@poa.sthttps://nicecrew.tv/static/streaming-playlists/hls/09538396-7cd2-4a40-b7ff-ce2d15b3e6da/7b980fd8-cb60-42a3-a2ce-8369f9f6b7a4-master.m3u8https://nicecrew.tv/videos/embed/29N8dBoDuaVnxpZu9uiqqA2085302024-08-24T07:53:13.839ZYESReichsgesetzNOhttps://nicecrew.tv/w/tZjaYvHaZCG9HEFjtoCmTdhttps://nicecrew.tv/lazy-static/thumbnails/91129b1e-f8a8-40d4-8845-96a53d257af1.jpgKIDNAP and KILL: An FBI Terror Plot | OFFICAL TRAILEROn October 8, 2020, the FBI announced the arrest of thirteen men who were allegedly “attempting to formulate a plan to kidnap Michigan Governor Gretchen Whitmer” and “otherwise use violence to overthrow the state government.” This event, dubbed the “Whitmer Fednapping Hoax” was astroturfed by every mainstream media outlet as proof that individuals they consider “far-right” are dangerous domestic terrorists. The FBI used a network of at least 12 informants and 2 undercover agents to create a domestic terror plot that never materialized. This documentary will dive deep into the anatomy of the FBI's most recent frame job and shed a light on the corruption plaguing federal law enforcement. ------------------------------------- This film can only happen with your support! FUNDRAISER LINK http://www.kandkfilm.com ------------------------------------- https://twitter.com/KandKFilm media inquiries: contact@kandkfilm.com (c) Digging Deeper, LLChttps://nicecrew.tv/static/streaming-playlists/hls/e2a7566b-f975-4f22-a9b9-5a42ab5fe14a/bb872a14-b3da-46c1-9ceb-33ef8a30d5b8-master.m3u8https://nicecrew.tv/videos/embed/tZjaYvHaZCG9HEFjtoCmTd1315182024-08-29T17:36:04.204Zdocumentarytrailerindependent filmwhitmerfbiYESKidnap and Kill: an FBI Terror PlotNOhttps://nicecrew.tv/w/aAvskDCebZgio6b247jV5Hhttps://nicecrew.tv/lazy-static/thumbnails/43b5f42b-a5a9-48e8-bc01-3ada6006b0b2.jpgComing soon!!Coming soon!! https://nicecrew.tv/static/streaming-playlists/hls/4db3b017-df95-40a6-aa0c-e007c974bbd5/83a0e2bc-fe45-4888-a398-b19e6628c613-master.m3u8https://nicecrew.tv/videos/embed/aAvskDCebZgio6b247jV5H565922024-08-30T21:53:54.137ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/svhX5pKshw7EJuJUJnFzhxhttps://nicecrew.tv/lazy-static/thumbnails/5b76a908-5495-466d-86c4-733e5060b8a1.jpgVolcano Daydream (David Bowie - Moonage Daydream parody)Volcano Daydream (David Bowie - Moonage Daydream parody) Lyrics: I'm an incinerator A red hot oven that burns every jew I'm the Vulcanator The god of fire, I'll un-forge these jews Keep your mouth shut It gets the lava if I hear 'nother word This time they'll be removed from the world I've got a rollercoaster with your name on it It goes up the hill and over the crater lip Speeding down, down into the fire below Kvetch in a volcano daydream, oh ya Don't bake 'em lonely Join 'em with the traitors and family The church of Vulcan Is a lovely place for kikes to seethe Feed me juden Let me know that you belong in here My chimney sends your ash in the air I've got a rollercoaster with your name on it It goes up the hill and over the crater lip Speeding down, down into the fire below Kvetch in a volcano daydream, oh yahttps://nicecrew.tv/static/streaming-playlists/hls/d6a49ebb-2dc1-454d-956d-89f920bc560b/f34901c5-59a4-45fe-9bc3-a4a665bf9e25-master.m3u8https://nicecrew.tv/videos/embed/svhX5pKshw7EJuJUJnFzhx286032024-08-31T10:26:20.028ZYESReichsgesetzNOhttps://nicecrew.tv/w/648hE66pMtffkywwVQN29Rhttps://nicecrew.tv/lazy-static/thumbnails/416bb54c-6643-47da-b1df-5e53556949f7.jpgNazi Boy (Alan Jackson - Country Boy parody)Nazi Boy (Alan Jackson - Country Boy parody) Lyrics: Excuse me ma'am, would you like a flyer About these jews, you know they are all liers What you think? Maybe you can help us Gas these jews and throw em in the oven 'Cause I'm a Nazi boy, I've got a Luger 9 Get on the train, you're going for a ride Up to the camps, from the ghettos I will take jews where they need to go 'Cause I'm a Nazi boy You sure look good, seig heilin' right beside me All these muds, we'll kick em off of our streets Hang em up, or we can burn em down On the lamp posts all around downtown 'Cause I'm a Nazi boy, I've got a Luger 9 Get on the train, you're going for a ride Up to the camps, from the ghettos I will take jews where they need to go 'Cause I'm a Nazi boy The Panzer V's got a cannon for the main gun I'm dropping commies with a Mauser machine gun 'Cause I'm a Nazi boy My trumpet's loud, a Jericho tune I crank it up, just to scare these jews Stukas approach, an allied post I drop my bomb and turn them all to toast 'Cause I'm a Nazi boy, I've got a Luger 9 Get on the train, you're going for a ride Up to the camps, from the ghettos I will take jews where they need to go 'Cause I'm a Nazi boy Marching deep giving all the haters mean mugs They can't stop us, send em back to where they came from Cause I'm a Nazi boy, I've got a Luger 9 Get on the train, you're going for a ride Up to the camps, from the ghettos Ya I will take jews where they need to go 'Cause I'm a Nazi boy Ya I'm a Nazi boy, I've got a Luger 9 Get on the train, you're going for a ride Up to the camps, from the ghettos I will take jews where they need to go 'Cause I'm a Nazi boy Ya I'm a Nazi boy Oh, I'm just a Nazi boy A nice big ole Nazi boyhttps://nicecrew.tv/static/streaming-playlists/hls/28ed6a5d-ff9e-4fd7-aaa6-0e3d97dd6bf5/ce1d9c27-4898-4d71-aae1-8d178ac5d016-master.m3u8https://nicecrew.tv/videos/embed/648hE66pMtffkywwVQN29R240562024-08-31T10:34:54.722ZYESReichsgesetzNOhttps://nicecrew.tv/w/4hVREfzmFoE2g8ywUN19twhttps://nicecrew.tv/lazy-static/thumbnails/def8c31d-f9bc-4d59-b48f-7c10bd90fec3.jpgkikes Without A Place (Billy Idol - Eyes Without A Face parody)kikes Without A Place (Billy Idol - Eyes Without A Face parody) Video footage is from Der Ewige Jude (The Eternal Jew) https://odysee.com/@Reichsgesetz:8/Der-Ewige-Jude-%28The-Eternal-Jew%29-1940:c?r=AijjwrQj3ydKQQSL5xsFe87y5c3c77ak&lid=eb3ab6ebf8c356a55fd9897e269b1f7a9265823f Lyrics: Never lose your hope One more based meme Could bring their fall Invaders in our home But it won't be long Before we see them gone jews they do deceive And they do cheat But we will see them beat kikes without a place kikes without a place kikes without a place God sure hates your race You're kikes without a place Anywhere you go Everyone hates you For all the things you do No one is your friend It's more than just 110 Removing you again kikes without a place kikes without a place kikes without a place God sure hates your race You're kikes without a place When you get the chance, you make a dip Into someone else's nation, then make it shit Open our borders to invaders Ooh, but niggers ain't cool Giving hand outs to all kinds Turning Hollywood anti-white Bringing us down... I've got a bus for the niggers' home trip And they better hop on or their gonna get lit But I'm thinking of jews who brought em here, so Say your prayers Say your prayers Say your prayers Now I hate the kikes And you wonder why I surely despise Every single jew Has got to be removed That's all there's left to do It's about time They pay for their crimes kikes without a place kikes without a place kikes without a place God sure hates your race You're kikes without a place Such a demon race You're kikes without a place You know it's getting close... https://nicecrew.tv/static/streaming-playlists/hls/1aa881a0-e7c6-43cc-9ca8-56e82975993c/bbcc8373-0535-4033-a285-c7c3b44ad7e2-master.m3u8https://nicecrew.tv/videos/embed/4hVREfzmFoE2g8ywUN19tw300582024-08-31T10:43:00.666ZYESReichsgesetzNOhttps://nicecrew.tv/w/wJfK4vw98dnDPujWiexTqehttps://nicecrew.tv/lazy-static/thumbnails/25d6d8dc-6c62-46c4-8222-738559e5216d.jpgJJR - 264 - Controlling the ConversationClamping down on unfiltered discourse. Censoring social media rising to the level of political persecution. Christine Loughead aka Canadian Girl joins us to talk about her experience being arrested over internet words. Also Telegram takedown, Spaceman v. Brazil,pissed off Pooja, racist traffic cameras, $99 limited edition jpeg's and oh so so much morehttps://nicecrew.tv/static/streaming-playlists/hls/f8d87bc5-5d1f-41d8-a696-330f834b7471/83c4f6f1-407a-4c2a-a5a4-95ba364b5150-master.m3u8https://nicecrew.tv/videos/embed/wJfK4vw98dnDPujWiexTqe1051754452024-09-01T05:04:33.580ZYESJust Joe Radio NOhttps://nicecrew.tv/w/52V8vFVwWgzejFyrFeAWCAhttps://nicecrew.tv/lazy-static/thumbnails/a67d76e7-d27b-4d04-b1ec-87bec020f24e.jpgDiagnosing tips for finding cause of power window failureBenishttps://nicecrew.tv/static/streaming-playlists/hls/20a90a67-2e1e-4c8d-ba10-bf7e88224fa2/971278f9-0222-4c75-b721-278d504e5425-master.m3u8https://nicecrew.tv/videos/embed/52V8vFVwWgzejFyrFeAWCA150532024-09-01T18:37:27.102ZYESBrother TylerNOhttps://nicecrew.tv/w/uLTg3vdZVEoASztp7pZYZqhttps://nicecrew.tv/lazy-static/thumbnails/6c4a5319-eb06-44ee-bce8-836ff39089d9.jpgUN PoliceContractor describes constructing another room at police buildings that has a room full of UN Uniforms to don in the "SHTF" event.https://nicecrew.tv/static/streaming-playlists/hls/e90432b4-704a-4dae-9b0e-7cefc1f8663a/503745a7-68b4-4ac3-938e-228a0a49e6f6-master.m3u8https://nicecrew.tv/videos/embed/uLTg3vdZVEoASztp7pZYZq1250212024-09-04T18:48:45.056ZYESMain teknoskillz channelNOhttps://nicecrew.tv/w/jXKMcY7cyznWQppiW4rUDahttps://nicecrew.tv/lazy-static/thumbnails/a0156fed-b2a3-4f28-9c71-34418c86cf34.jpgJJR - 265 - Advancing the ConversationContent! Sunday night solo show I go over the quickly spreading Venezuelan virus, the Haitian locust like invasion of Springfield, Ohio, Chasin' that bank (all the way to jail), WW2 mythology suffers a major hit, and so much more..https://nicecrew.tv/static/streaming-playlists/hls/998d621d-0bd6-4857-9944-3fbd4ab95b53/20191cda-d8ba-45a8-989c-f44ac686b536-master.m3u8https://nicecrew.tv/videos/embed/jXKMcY7cyznWQppiW4rUDa1002251332024-09-09T04:40:34.274ZYESJust Joe Radio NOhttps://nicecrew.tv/w/jndnvCRveBieDNNSwygfathttps://nicecrew.tv/lazy-static/thumbnails/d81b6d8e-af66-4db7-97cd-212dfe7858eb.jpgTim Sayre Urges the Weaponization Committee to Investigate the FBI's Gov. Whitmer "Kidnap Plot" CaseStatement by Tim Sayre addressed to the Weaponization Committee, urging them to look into the FBI's misconduct and criminal actions in the Gov. Whitmer "kidnap plot," of which he was a target. The FBI utilized its assets to fund, plan, and attempt to bring to fruition a plan to commit terrorist acts against state actors on domestic soil and chose an innocent group of men as the scapegoats for it. This is exactly the abuse and wrongdoing the Weaponization Committee is supposed to investigate. https://nicecrew.tv/static/streaming-playlists/hls/94babd26-e272-4e51-a289-24c92a7b04b5/fe03e545-14d8-42e9-8b4d-a58626b0f2ae-master.m3u8https://nicecrew.tv/videos/embed/jndnvCRveBieDNNSwygfat2055132024-09-10T01:01:18.889ZFBI misconductWhitmer FednappingFake Terror PlotFBI corruptionGovernment overreachYESKidnap and Kill: an FBI Terror PlotNOhttps://nicecrew.tv/w/as4xPdomLUqDWPmfGEBVk3https://nicecrew.tv/lazy-static/thumbnails/589e0114-44ca-4539-9c05-147ea010fb40.jpgPresidential Debate - 09/10/2024Tonight (8 PM CST/ 9 PM EST) on NCTV, we cover the presidential candidate debate between Kamala (Brat) Harris and Donald (Convict) Trump. Will you be #KummingForKamala or will you vote for the RACIST BIGOT SEXIST RAPIST BIGOT Trump? (lower quality version of livestream was published to save space)https://nicecrew.tv/static/streaming-playlists/hls/4c85c5d6-fba9-4a52-acb3-b6537eccea1c/d0a2fead-8d56-430c-b780-d52fc3328661-master.m3u8https://nicecrew.tv/videos/embed/as4xPdomLUqDWPmfGEBVk3672455532024-09-11T03:32:46.460ZpresidentelectiondebatekamalatrumpYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/qvPhgc6nbg5hQaA67q31kfhttps://nicecrew.tv/lazy-static/thumbnails/61570a2f-965f-401a-a757-e2541bc4eacf.jpgTarget of FBI Entrapment Scheme Urges Weaponization Committee to InvestigateJeremy Deeter, an "unindicted co-conspirator" in the FBI's Gov. Whitmer "kidnap plot" case, urges the Weaponization Committee and Rep. Jim Jordan to investigate the FBI's corrupt actions in this case, especially that of the lead handling agents. HELP SUPPORT AND FUND THE FILM! https://kandkfilm.com https://nicecrew.tv/static/streaming-playlists/hls/c68508e4-9521-4c2a-a521-7c9a06cf312c/ec12fb5d-62c7-43d0-ad0e-61033f876a12-master.m3u8https://nicecrew.tv/videos/embed/qvPhgc6nbg5hQaA67q31kf2735162024-09-11T19:37:06.833Zdocumentaryfilmindie filmFBI corruptionWhitmer Fednapping HoaxYESKidnap and Kill: an FBI Terror PlotNOhttps://nicecrew.tv/w/nVkmZNxWzzucfDaCjSRd94https://nicecrew.tv/lazy-static/thumbnails/ec36189b-14e3-4309-a170-edb9eeee7143.jpgShapeshiftersWe love our lizards don't we folks?https://nicecrew.tv/static/streaming-playlists/hls/b1824391-159e-44ba-b984-3ba048d7800b/978b387d-2119-478e-b678-4df7ebab1ecb-master.m3u8https://nicecrew.tv/videos/embed/nVkmZNxWzzucfDaCjSRd945345102024-09-11T19:41:15.850ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/fhJafKsr3ikL3MKS4RzQMrhttps://nicecrew.tv/lazy-static/thumbnails/6f1d7f45-dfb2-4331-9210-226e9876b38a.jpgThomas Massie - Political TheaterThomas Massie - Political Theaterhttps://nicecrew.tv/static/streaming-playlists/hls/73b5d2c4-7011-42e4-ae73-87360ce69623/4107a0c7-ac38-4277-ba64-40da01f2e8a6-master.m3u8https://nicecrew.tv/videos/embed/fhJafKsr3ikL3MKS4RzQMr416062024-09-11T19:41:30.072ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/ff6LH88DiyvFWszzzPGq8Vhttps://nicecrew.tv/lazy-static/thumbnails/f5eb4ab5-839f-4071-a9e7-facc9c6d3034.jpgOh ! So CuteTill he grows up and kills ya !https://nicecrew.tv/static/streaming-playlists/hls/7357e911-e887-4bb5-a3fb-d6c68549e5bb/f57933da-1fa8-488d-9407-2b01b0a7d326-master.m3u8https://nicecrew.tv/videos/embed/ff6LH88DiyvFWszzzPGq8V34562024-09-12T17:56:47.827ZYESMain teknoskillz channelNOhttps://nicecrew.tv/w/7hxf1WfNHJdNkfAvhyf63Chttps://nicecrew.tv/lazy-static/thumbnails/8a63e1a7-63a9-4162-beb8-e92bc948d6a7.jpgBritish PeopleBritish Peoplehttps://nicecrew.tv/static/streaming-playlists/hls/32e5fc52-99a6-431c-97cd-8846dc7edabc/c2afc3bb-a4b1-43bd-bb88-08be25962251-master.m3u8https://nicecrew.tv/videos/embed/7hxf1WfNHJdNkfAvhyf63C51092024-09-15T02:19:53.399ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/dcAATia379x9ng3SPm3ER1https://nicecrew.tv/lazy-static/thumbnails/b056ee80-9362-4b2a-a35d-7dde8094311b.jpgJJR - 266 - It's Not Happening But It's Good That It IsThe controversy surrounding Haitians and unchecked immigration invasion rages. OFFICIAL Friend of the Show and host of Night Nation Review, Nick joins me and we go over the many benefits of endless diversity, the booming dirt cookie industry, and many other refinements. https://nicecrew.tv/static/streaming-playlists/hls/62cc2b56-e05d-42c2-8b1f-a23cf88dc6e2/302ce47d-8bb1-49a4-bd81-fd57ba816129-master.m3u8https://nicecrew.tv/videos/embed/dcAATia379x9ng3SPm3ER1105165992024-09-15T05:49:36.470ZYESJust Joe Radio NOhttps://nicecrew.tv/w/wEPHxfE7TADYP15t2t41UHhttps://nicecrew.tv/lazy-static/thumbnails/d5c7e4e9-efd1-4274-90a9-5b9f6ddee131.jpgHelldivers 2 Post buff updateHelldivers 2 Post buff updatehttps://nicecrew.tv/static/streaming-playlists/hls/f85dd446-c1bb-4244-b173-9cd3eb81b179/b600da5b-fadd-4ea2-9766-47850bd35039-master.m3u8https://nicecrew.tv/videos/embed/wEPHxfE7TADYP15t2t41UH1676032024-09-18T01:32:16.780ZYESMain omega_variant channelNOhttps://nicecrew.tv/w/jn6mVFYqhDR89B84bkS9Hkhttps://nicecrew.tv/lazy-static/thumbnails/009c7c15-d544-4f43-b1b0-0f89ba910da7.jpgJJR - 267 - Enough About The RhetoricSecond assassination attempt on Trump in 2 months and it's FINALLY time to get down to the root of the problem...whose "rhetoric" is blame. Also all out campaign to restore Haitians' reputation in Ohio, zero accountability for the cuhmoonity, 1000's of exploding pagers and a demented pervert pretending to be a roaring beast. https://nicecrew.tv/static/streaming-playlists/hls/94b66b33-5cf1-47bc-84a0-56751fafa1fd/b805b16d-dd1e-440b-8b01-3d6fec6ae64c-master.m3u8https://nicecrew.tv/videos/embed/jn6mVFYqhDR89B84bkS9Hk874751562024-09-18T04:09:27.773ZYESJust Joe Radio NOhttps://nicecrew.tv/w/dJ5r2Fbhzyuno7MMhrJDrPhttps://nicecrew.tv/lazy-static/thumbnails/d38cb5fb-43ef-4d51-b1c4-a7588b0a39a3.jpgThe communist Directive 1943Same old playbook, just before WW2 took off.https://nicecrew.tv/static/streaming-playlists/hls/670da21f-3771-447d-89fa-6eaa6f4a9eed/28265ac2-56f5-4ace-9ad2-369ce57bcb39-master.m3u8https://nicecrew.tv/videos/embed/dJ5r2Fbhzyuno7MMhrJDrP38582024-09-19T13:41:02.327ZYESMain teknoskillz channelNOhttps://nicecrew.tv/w/6zZph7o3xaCTuzhUpZ1eE9https://nicecrew.tv/lazy-static/thumbnails/8f76a106-d8b4-4ac2-a4f6-482f1000080c.jpgMike Null Speaks Live 9.19.24Mike Null, framed in the Whitmer Fednapping hoax and later acquitted, speaks about his experience and addresses Gov. Whitmer. https://nicecrew.tv/static/streaming-playlists/hls/2d3c9ccf-9e80-47d2-9185-989bd7b64f68/6dfb06d0-c984-4554-80c5-337358ba73e0-master.m3u8https://nicecrew.tv/videos/embed/6zZph7o3xaCTuzhUpZ1eE9435372024-09-19T22:05:14.469ZYESKidnap and Kill: an FBI Terror PlotNOhttps://nicecrew.tv/w/m5dtZw7NCuZxaSbrFaqBA6https://nicecrew.tv/lazy-static/thumbnails/8617f716-a6a4-4cf5-a82d-7249383a81e8.jpgBill Null Announces Run for Governor of Michigan in 2026!Bill Null, acquitted in the FBI's Gov. Whitmer Fednapping hoax talks about how the feds tried to kill his niece who was home alone and how they almost killed his father who is hard of hearing when they did a pre-dawn tactical raid on the house AFTER they already had both Null brothers in custody. https://nicecrew.tv/static/streaming-playlists/hls/a28d70e3-15ca-4fe4-be13-72452fa02d95/ccb862e7-e701-454b-8974-4fa5456925e8-master.m3u8https://nicecrew.tv/videos/embed/m5dtZw7NCuZxaSbrFaqBA610054162024-09-20T16:02:03.450ZYESKidnap and Kill: an FBI Terror PlotNOhttps://nicecrew.tv/w/hsWe95JBanbcVk1W5C2HrDhttps://nicecrew.tv/lazy-static/thumbnails/9050f56e-83a6-48c4-bb8c-7e151e0d3750.jpgJJR - 268 - All Make And Manner Of Perverts And FreaksIs it just me or are they ALL in on it?! From P.Diddler's previsions to molly poppin' Covid czars, This Week In Sex Pestry. Also Love Goddess to OH MY GOD! Why's the panda panting, wound infused coins, and so much more. (Warning: The wheels come completely off the last half hour)https://nicecrew.tv/static/streaming-playlists/hls/8554f991-4152-48cd-97ff-e3aaf38bd9fb/5c5d9cb7-b1d0-41df-ae66-8363a672a79c-master.m3u8https://nicecrew.tv/videos/embed/hsWe95JBanbcVk1W5C2HrD5583062024-09-22T03:24:31.252ZYESJust Joe Radio NOhttps://nicecrew.tv/w/1VVWHXFNA19m1PFQ5RDKufhttps://nicecrew.tv/lazy-static/thumbnails/b2edff69-9882-465d-9603-1c52925b3230.jpgHandyman SimulatorHandyman Simulatorhttps://nicecrew.tv/static/streaming-playlists/hls/0787a9e6-ca37-4523-9218-9dedb8525e4a/4d6ba903-ed83-4eb7-9e6c-a83909a46d08-master.m3u8https://nicecrew.tv/videos/embed/1VVWHXFNA19m1PFQ5RDKuf227572024-09-26T01:14:53.962ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/x62QmaubaGraHX4XFbquQAhttps://nicecrew.tv/lazy-static/thumbnails/889f43fa-3a5e-4e58-940e-369a0ca2cf2e.jpgGreen Citadels. Sustainability pioneers captain eco-friendly earthshipsMichael Reynolds had a dream. The architect wanted to build completely self-sufficient houses that are part of the environment, rather than a burden on it. Watch full documentary: https://odysee.com/@RTDocumentary:4/green-citadels.-explore-eco-friendly:c An ideal home would be made from recycled materials, maintain a comfortable climate, generate sustainable power from renewable sources, treat its sewage, and provide clean potable water, as well as food, for its inhabitants. He built his first ‘Earthship’ in 1972 almost entirely from empty soda and beer cans and rammed earth. Now he is the prophet of a movement that advocates “radical sustainability.” Today, a 634-acre subdivision near Taos, New Mexico, dubbed the ‘Greater World Community,’ is dotted with off-grid homes based on his designs. Meanwhile, an Earthship Academy has opened to teach people from all over the world how to build homes and other buildings based on ‘biotecture’ principles. Earthships are not without controversy. Their designs have fallen foul of the authorities for violating building codes, and some owners have complained their homes have not performed as advertised. Meanwhile, some places have banned off-grid living altogether. Follow RTD filmmaker Alexey Brazhnikov as he meets Michael Reynolds and visits some of these amazing structures and their owners in the documentary Earthships.https://nicecrew.tv/static/streaming-playlists/hls/fbbf25b5-07fe-4793-b1ab-81e53ee380f2/c870c789-31a1-472f-8705-6add609ce582-master.m3u8https://nicecrew.tv/videos/embed/x62QmaubaGraHX4XFbquQA665172024-09-26T06:27:28.711ZEarthshipYESMain ChannelNOhttps://nicecrew.tv/w/cSZCAE8ztQmKJE8hcETYCQhttps://nicecrew.tv/lazy-static/thumbnails/8317fdf8-bc33-4ee2-b2c5-b2235de13f3e.jpgKIDNAP and KILL: An FBI Terror Plot | OFFICIAL TRAILER 2Please help us finish the film! http://kandkfilm.com/donate I am proud to present the second trailer for “Kidnap and Kill: an FBI Terror Plot!” Last year, after conducting just one interview, we released our first trailer, created our fundraiser, and began gathering the resources we would need to tell this important story! One year later, we are proud to show you all the work we have done and how much we have improved. Since we started this journey, 3 additional men were acquitted, bringing the total number of acquittals to five. Five men are currently appealing, with the Sixth Circuit Court of Appeals about to decide on whether Adam Fox and Barry Croft will get a new trial. We have done the legwork, filmed our interviews, improved our skills and now we need your help again to get this film finished. This film has been crowdfunded the entire way and we could not have done any of this without your support. We need your help to get the film finished in the highest quality and distributed to as many people as possible. Please help us meet our fundraising goal so we can hire the people we need to get this done! We know how hard times are right now, any amount you can give will help go a long way. We are in a race against the clock, these men do not have 3 years to wait, and we have no one funding us except you, the viewers, and the supporters.https://nicecrew.tv/static/streaming-playlists/hls/60333ae9-303f-4b15-b1d2-9885ae2afff0/131d7dbe-8623-46ea-b7db-89db5d464f27-master.m3u8https://nicecrew.tv/videos/embed/cSZCAE8ztQmKJE8hcETYCQ3235862024-09-27T01:12:51.674ZfilmtrailerFBI corruptionWhitmerFednappingYESKidnap and Kill: an FBI Terror PlotNOhttps://nicecrew.tv/w/dcU6G6VCYc8Ut7mPw4pLGjhttps://nicecrew.tv/lazy-static/thumbnails/b9a6bbd0-150e-470c-abb5-fef327a051b7.jpgHitler on the BOERSHitlers perspective on South Africa's BOERS and how England routed them which convinced him something was very very wrong with England. This video describes their bonds and connections with jews and masonry.https://nicecrew.tv/static/streaming-playlists/hls/62d6f3b6-6621-45ae-aa1b-f1157a3ea89a/88fe7cb1-e6df-46d7-9b8f-093135311440-master.m3u8https://nicecrew.tv/videos/embed/dcU6G6VCYc8Ut7mPw4pLGj8560282024-09-28T14:53:42.412ZYESMain teknoskillz channelNOhttps://nicecrew.tv/w/23i8wwAX9rgipjRdh3xepNhttps://nicecrew.tv/lazy-static/thumbnails/a3384c82-d5c9-4d9b-84fa-d286f2961a4f.jpgJJR - Reeeeeee'ing with RadixRadix Verum joins me to discuss her explosive upcoming documentary, Kidnap and Kill, detailing the disgusting Whitmer "Kidnapping" plot fabricated by our Federal governmenthttps://nicecrew.tv/static/streaming-playlists/hls/086b2ecb-7be0-41b7-a0ce-8bd1ab77f0b0/a66afd69-342d-4da8-a26d-da3fa6db998b-master.m3u8https://nicecrew.tv/videos/embed/23i8wwAX9rgipjRdh3xepN807453882024-10-11T05:05:42.519ZYESJust Joe Radio NOhttps://nicecrew.tv/w/n6EbZ4wGeuUngzvAvWaYG3https://nicecrew.tv/lazy-static/thumbnails/510f58ca-bbbd-4341-9369-6f0ee2b79f14.jpgPatriot Front in Horseshoe BeachMembers of Patriot Front provide disaster relief in Horseshoe Beach, Florida after Hurricane Helen.https://nicecrew.tv/static/streaming-playlists/hls/aada2a6e-85db-4441-ad5d-1f4071eb08da/801f9f3d-7521-4e30-b90a-24e4ac1fc7d5-master.m3u8https://nicecrew.tv/videos/embed/n6EbZ4wGeuUngzvAvWaYG31195122024-09-29T21:18:47.082Zpatriot frontnationalismdisaster relieffloridaYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/1NADzJDbG6cpjKwVbrHZsBhttps://nicecrew.tv/lazy-static/thumbnails/efd332b2-f0d1-49b8-b1bc-02f3cc2538c2.jpgJerry Springer - The Jewish agendaHow Jerry Springer wrecked the Westhttps://nicecrew.tv/static/streaming-playlists/hls/068190e4-4d1d-40fd-964c-81d3f9bb4b83/040b0e06-3d4c-4e43-85ce-ef20b39321ab-master.m3u8https://nicecrew.tv/videos/embed/1NADzJDbG6cpjKwVbrHZsB10640282024-09-30T23:17:55.727ZYESMain teknoskillz channelNOhttps://nicecrew.tv/w/tC6VqWgNgbPeRSTPGoNyEqhttps://nicecrew.tv/lazy-static/thumbnails/1dff016f-0be8-4d34-9902-c0af8787cc69.jpgVice Presidential Debate - October 1, 2024Tim "Horse Cum" Walz vs JD "Jeet" Vancehttps://nicecrew.tv/static/streaming-playlists/hls/dfb12b2a-2d61-4dc9-8082-bc4579f15604/054705c2-8945-4d82-9a5f-f971d720bc8e-master.m3u8https://nicecrew.tv/videos/embed/tC6VqWgNgbPeRSTPGoNyEq730253672024-10-02T12:58:54.785Zvice presidentdebatewalzvancepoliticsYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/eWYtZ8mvJt16bPxf6Wj5bQhttps://nicecrew.tv/lazy-static/thumbnails/f5c45d2a-9d58-4a42-8572-d1fd33433027.jpgIran's Attack on Israel (Supercut)Iran's Attack on Israel (Supercut)https://nicecrew.tv/static/streaming-playlists/hls/70f3c655-2441-41ec-952e-d1c050f2cf54/73ac5127-db90-4943-83cb-db30884c69b3-master.m3u8https://nicecrew.tv/videos/embed/eWYtZ8mvJt16bPxf6Wj5bQ8865172024-10-01T23:42:34.528ZIsraeliransupercutextendedYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/nNh8vJ2btCfd3DSEq1uooAhttps://nicecrew.tv/lazy-static/thumbnails/a2cc6fe8-0b7f-4a79-9c1c-ad1809f8d6b9.jpgJJR - 270 - You Got A Mouse In Your Pocket?Desert feud between Iran and Israel heats up and suddenly in unison every single member of Congress is demanding "we' (you and me) "take a stand". Also, total devastation in North Carolina, sundown town hysteria, the puppet masters behind P.Diddler, and oh so much morehttps://nicecrew.tv/static/streaming-playlists/hls/b08610c1-89e2-45b5-97d1-1f67e6c5bd16/c5584292-342d-401b-a6d5-9f9b541d6118-master.m3u8https://nicecrew.tv/videos/embed/nNh8vJ2btCfd3DSEq1uooA953252152024-10-03T04:21:24.859ZYESJust Joe Radio NOhttps://nicecrew.tv/w/wACza4mRWw2y7dEhwQzcHkhttps://nicecrew.tv/lazy-static/thumbnails/cbeee077-fe24-4f28-85cb-f8c72f591550.jpgI Am Nobody's MasterI Am Nobody's Masterhttps://nicecrew.tv/static/streaming-playlists/hls/f7c7fc6e-bdd4-4035-be92-7c5a49b237d1/7e8a075f-9380-4b4a-a2a2-8591b602f311-master.m3u8https://nicecrew.tv/videos/embed/wACza4mRWw2y7dEhwQzcHk6042024-10-04T21:44:36.002ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/aog5K1hGovo4ZsY4LA39Z4https://nicecrew.tv/lazy-static/thumbnails/19d7b975-0aaa-4122-8f50-8dcfd7e1b4db.jpgDays of Our LivesLatest work from Bigdaddycork , USMC.https://nicecrew.tv/static/streaming-playlists/hls/4bfde7c4-3e8f-46eb-ab45-9b5a6d66ccbd/5e8af964-8df7-4ab2-8913-68a934d350f2-master.m3u8https://nicecrew.tv/videos/embed/aog5K1hGovo4ZsY4LA39Z4163062024-10-05T20:36:20.195ZYESMain teknoskillz channelNOhttps://nicecrew.tv/w/86co4hsEpdwaZPbgbcCtrahttps://nicecrew.tv/lazy-static/thumbnails/16fe8ba1-097b-4df0-8771-d4d4ba41ad24.jpgQRD on changing driver/passenger door handle on 2002 s10Couple things I missed in the video as this was impromptu. 1: the door handle has 2 bolts holding it in. Once you get the door stripped down the two access holes directly behind the handle allow you access to the bolts. They are 10mm and very tiny be careful not to drop them. 2. The door latch itself on the lower part of the door has 3 bolts holding it in, if you remove those 3 bolts it will allow you more wiggle room up top and make your life much easier to get the handle in and out. 3. While your in there I'd highly recommend you lubricate the lock and all the friction points of the bars that actuate your internal door handle and lock.https://nicecrew.tv/static/streaming-playlists/hls/3969b3ec-0e2a-4c78-b28d-bbbfea4fd1cf/460f67cd-2fa0-4afb-a4a5-9039b85a1fbd-master.m3u8https://nicecrew.tv/videos/embed/86co4hsEpdwaZPbgbcCtra275002024-10-06T16:43:57.378ZYESMain omega_variant channelNOhttps://nicecrew.tv/w/kaQb1APueyBRBqLSLNfxREhttps://nicecrew.tv/lazy-static/thumbnails/5643c600-f649-4a61-bdc4-6d0f9bd6aadc.jpgLvl 10 helldive. Heavy armor.Lvl 10 helldive. Heavy armor.https://nicecrew.tv/static/streaming-playlists/hls/9b3d0411-0307-454d-9d18-81c711f6a9ac/533f5a2f-8a9d-4984-9de6-f52f2ddf52c4-master.m3u8https://nicecrew.tv/videos/embed/kaQb1APueyBRBqLSLNfxRE19320102024-10-06T17:45:17.711ZYESMain omega_variant channelNOhttps://nicecrew.tv/w/qufpcsVB2K3yBUXccrwDYBhttps://nicecrew.tv/lazy-static/thumbnails/d8bb9362-872f-4dbb-bcdd-b4cca75d707f.jpgJJR - 270 - Stop The SpreadTwo historic hurricanes in one week has the mis and dis-information flowing like a runaway river. From Trump's onslaught of lie to unfounded tropes about FEMA, it's time to STOP THE SPREAD! Also Super Mayor saga continues, jail time for spooky arm gestures, and so so so much more.https://nicecrew.tv/static/streaming-playlists/hls/c64d0716-b3f7-4a10-bc85-b22e06608067/08d1a284-87b2-48ec-8d58-d83b0318dad4-master.m3u8https://nicecrew.tv/videos/embed/qufpcsVB2K3yBUXccrwDYB824651172024-10-11T05:01:22.593ZYESJust Joe Radio NOhttps://nicecrew.tv/w/jeTSd85ceCvc13RPzwxUhkhttps://nicecrew.tv/lazy-static/thumbnails/60f08a32-3a0d-4fd3-b5ba-abdcf6ea8698.jpgVisual Fidelity Test - Warframeit be lookin pretty fuckin bussinhttps://nicecrew.tv/static/streaming-playlists/hls/93b520d4-bc74-43b1-8499-3a6a841cc99b/2bddd4b1-4225-433d-8382-cb4ee4ed6209-master.m3u8https://nicecrew.tv/videos/embed/jeTSd85ceCvc13RPzwxUhk13400142024-10-13T22:42:57.518ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/9zxyDBumpixhGKHfWcm9LShttps://nicecrew.tv/lazy-static/thumbnails/12b19a72-aafc-4a23-a832-4c2e0fed103b.jpgChris Brunet vs Chris Rufo: My ThoughtsMy thoughts on the Chris Brunet vs Chris Rufo debacle and on the controlled "right wing" and "conservative" organizations/influencers. https://nicecrew.tv/static/streaming-playlists/hls/45781ae2-aa3b-457d-b018-9be91b8bc6da/1071cb6c-345b-4eb6-bc15-faedd639978d-master.m3u8https://nicecrew.tv/videos/embed/9zxyDBumpixhGKHfWcm9LS14195552024-10-21T17:27:04.508Zcontrolled oppositionisrael firstpaul singermanhattan institutechris brunetYESRadix Verum ☦NOhttps://nicecrew.tv/w/fmK97qDbg7XGzqZNoMRgqqhttps://nicecrew.tv/lazy-static/thumbnails/41cea189-e681-432c-a43b-9e24638f9319.jpgSend Them BackSave The Cats Send Back the Hordes of Savage Blackshttps://nicecrew.tv/static/streaming-playlists/hls/7445670a-fd1a-45c5-8828-5e4da39853dc/5cde1da8-ddcf-4523-ad2d-502fde809fae-master.m3u8https://nicecrew.tv/videos/embed/fmK97qDbg7XGzqZNoMRgqq1545122024-10-23T23:21:34.781ZNOMain killyourtv channelNOhttps://nicecrew.tv/w/qNg5p9RSQcS3sUTczjFoA4https://nicecrew.tv/lazy-static/thumbnails/388e9f32-1eb7-4e8a-8b22-32fda165bddf.jpgJJR - 272 - The Case Of The CottoningBaby permanently disfigured with hot coffee?! Ho hum. High schooler handed a bag of cotton?! SEND IN THE CALVARY! But why the disparity in reaction by authorities?! We get into it. Also Yellow Grubs called out, Saga of the Super Mayor continues, cyclist strangled by sacred wire, the fuck is a Little Durk?! The one where Ross becomes a Zionist and so so much more. https://nicecrew.tv/static/streaming-playlists/hls/c8d0d503-45cf-4f4f-a153-b6814e83d5e7/7a442148-40ed-499f-90f1-78e42fc23ec7-master.m3u8https://nicecrew.tv/videos/embed/qNg5p9RSQcS3sUTczjFoA466175752024-10-30T02:57:25.020ZYESJust Joe Radio NOhttps://nicecrew.tv/w/eJjsX21fq6DuG5ruDcmiL1https://nicecrew.tv/lazy-static/thumbnails/594d09a5-0bdc-44ca-8029-c5f684dccefc.jpgAren't you Lonely?We are going to talk today about the loneliness epidemic, especially among Gen Z. Link to article: https://www.afterbabel.com/p/arent-you-lonelyhttps://nicecrew.tv/static/streaming-playlists/hls/6f2f6b8f-21b8-4afc-a040-6775eaac95cc/7a191cc0-908e-4280-9d52-4c6274775525-master.m3u8https://nicecrew.tv/videos/embed/eJjsX21fq6DuG5ruDcmiL1116551102024-10-29T16:56:30.248Zgen zlonelyloneliness friendshipsocial mediaYESRadix Verum ☦NOhttps://nicecrew.tv/w/obPdHY6UUvDCdr4NTUMh5ahttps://nicecrew.tv/lazy-static/thumbnails/83241f84-5c39-40ae-9389-facf3863e5db.jpgHappy Halloween 🎃 from Violet EvergardenHappy Halloween 🎃 from Violet Evergardenhttps://nicecrew.tv/static/streaming-playlists/hls/b3ab9693-babe-487d-b12e-f49f4eca9a59/88c1d461-0247-448f-b665-1cbf335e1897-master.m3u8https://nicecrew.tv/videos/embed/obPdHY6UUvDCdr4NTUMh5a65122024-10-31T22:15:33.421ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/mQ2kAroDViEkPrkLdw8xunhttps://nicecrew.tv/lazy-static/thumbnails/48791ce4-0812-4dae-a7f8-a2b86da0d796.jpgI Thlam My PeanitsI Thlam My Peanitshttps://nicecrew.tv/static/streaming-playlists/hls/a8ab4c72-89be-4298-b994-22ee413f25c1/c548095b-fc70-4954-9316-9856a8cc094b-master.m3u8https://nicecrew.tv/videos/embed/mQ2kAroDViEkPrkLdw8xun155142024-11-04T02:54:03.226ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/hXE5b8tX147GvwuQdaHnKihttps://nicecrew.tv/lazy-static/thumbnails/8630045f-f96c-4a7a-8e9c-b2e2f7e158c4.jpgJust Joe Radio - Election Night Extravaganza!!Just Joe Radio's Live Election Coverage featuring myself and Mattis Boombalattishttps://nicecrew.tv/static/streaming-playlists/hls/895796ae-6c63-4ca7-8f51-3abd87a2493b/cb7f2524-2f08-4b76-b9fc-3d6a936408c9-master.m3u8https://nicecrew.tv/videos/embed/hXE5b8tX147GvwuQdaHnKi13000222024-11-08T03:04:51.880ZYESJust Joe Radio NOhttps://nicecrew.tv/w/sqbFvRiozwYsLLUJoAQFWohttps://nicecrew.tv/lazy-static/thumbnails/efa13216-b5a8-403b-bcd7-2e9fc13bc1fb.jpgDank Brandon Comments on 2024 Election ResultsA message from the president to the Democratic Party. https://nicecrew.tv/static/streaming-playlists/hls/d5ee09c8-93a9-4e91-a0b5-9acac4e000ae/69908fd7-ab27-4957-83cd-12ee733cd206-master.m3u8https://nicecrew.tv/videos/embed/sqbFvRiozwYsLLUJoAQFWo4401362024-11-06T13:40:36.140ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/91dogxTUqig94jw4TFZRbthttps://nicecrew.tv/lazy-static/thumbnails/7e16775e-63ad-47b2-a34a-bff80844acc9.jpgLiberals React to Trump 2024 VictoryCompletely sane people acting as reasonably as possible.https://nicecrew.tv/static/streaming-playlists/hls/40d0bdbb-fbf8-446c-a8f6-bff4b4a27b3b/6190b2ca-977e-4ff4-9225-64ffada33d2b-master.m3u8https://nicecrew.tv/videos/embed/91dogxTUqig94jw4TFZRbt24751512024-11-06T18:11:38.714ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/k5RUUgDk8zwoKwiyCFEAdZhttps://nicecrew.tv/lazy-static/thumbnails/51273eb1-5829-4dba-bcad-957a24fb4f21.jpgKamala Harris Concedes to Donald TrumpAfter the Democrats dropped the ball on widespread election fraud, Kamala Harris has had no choice but to concede to Donald Trump. Original video [here](https://www.youtube.com/watch?v=1Ih_Z2Cf64I)https://nicecrew.tv/static/streaming-playlists/hls/9a8b5e79-45b5-41e0-af6d-b8e1ca69ba19/20746d54-f9ac-44dd-9435-acccebce14ae-master.m3u8https://nicecrew.tv/videos/embed/k5RUUgDk8zwoKwiyCFEAdZ78701002024-11-06T22:31:51.667ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/i25AprsVbUXQKHi6kSEHvjhttps://nicecrew.tv/lazy-static/thumbnails/1817e868-996a-43c9-84df-e16f2a58e5c5.jpgDonald Trump's 2024 Victory SpeechAfter several assassination attempts and constant media bullshit, Donald Trump delivers his second victory speech to a crowd of adoring fans. Original video [here](https://www.youtube.com/watch?v=dnXrsSHGvcQ)https://nicecrew.tv/static/streaming-playlists/hls/89d1ee7f-93df-4b61-86e4-aeb936037c18/2fe40560-7265-4363-b5be-e0096d11bdb1-master.m3u8https://nicecrew.tv/videos/embed/i25AprsVbUXQKHi6kSEHvj164351082024-11-06T22:36:45.846ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/7NuKLEVghcYoe1KZ7b8VqRhttps://nicecrew.tv/lazy-static/thumbnails/ee1d11af-db8f-456d-9fcd-25c92cf03b9f.jpgThe Future, According to Liberalslmao https://nicecrew.tv/static/streaming-playlists/hls/3714c41d-054c-4705-8d88-229da047bb4d/454afe47-29c7-4645-9d9a-b33063c50701-master.m3u8https://nicecrew.tv/videos/embed/7NuKLEVghcYoe1KZ7b8VqR1590962024-11-07T01:48:02.321ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/9JrXAjLVBLzuttgvy9GmoUhttps://nicecrew.tv/lazy-static/thumbnails/4501b194-a26a-4b08-91aa-e1a4dfbfa192.jpg11 Minutes of Shitlib Meltdowns11 Minutes of Shitlib Meltdownshttps://nicecrew.tv/static/streaming-playlists/hls/46b65858-8aeb-4814-82db-458683896280/b5b1b180-aa68-4103-b2ac-59a5caa4e126-master.m3u8https://nicecrew.tv/videos/embed/9JrXAjLVBLzuttgvy9GmoU66852502024-11-07T17:50:47.118ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/ij3FsJeJNC3t5prpF1UxRUhttps://nicecrew.tv/lazy-static/thumbnails/111b34ef-1f07-4a9f-bf80-2b5c421b879d.jpgTrump on Child Genital MutilationAre we so back? Transcript [here](https://www.donaldjtrump.com/agenda47/president-trumps-plan-to-protect-children-from-left-wing-gender-insanity)https://nicecrew.tv/static/streaming-playlists/hls/8c30659b-e214-4917-b4be-a355f780af6a/79c773c9-d5ad-4c2d-bb0d-9d7737fc6cc8-master.m3u8https://nicecrew.tv/videos/embed/ij3FsJeJNC3t5prpF1UxRU972.58492024-11-07T17:51:01.224ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/o7QTDN9XwD91J5AP3f7u2Vhttps://nicecrew.tv/lazy-static/thumbnails/04023b28-0398-4cd3-acb2-e869ab7b45d8.jpgLauren Chen and Tenet Media: My ThoughtsI wanted to give my thoughts on the allegations about Tenet media being a Russian influence operation and Lauren Chen and her husband Liam Donovon being aware of this. Was this a simple case of influence peddling, or was this an entrapment scheme designed to lay the groundwork for further censorship and persecution of dissidents? Sources: https://x.com/P_Kallioniemi/status/1831613044746580260 https://x.com/AricToler/status/1831409715349455335 https://pressprogress.ca/far-right-media-outlet-linked-to-secret-russian-influence-campaign-produced-50-videos-focused-on-canada/ https://www.dailymail.co.uk/news/article-14049209/canadian-influencer-lauren-chen-russia-propaganda-campaign-questions.htmlhttps://nicecrew.tv/static/streaming-playlists/hls/b31da49c-3e61-42b8-b7ba-9ff71064722f/6edd4bb9-758e-4ace-a3f7-2ce1f5e1975e-master.m3u8https://nicecrew.tv/videos/embed/o7QTDN9XwD91J5AP3f7u2V27005542024-11-07T20:58:40.500Zlauren chentenet mediatim ppollauren southernrussiaYESRadix Verum ☦NOhttps://nicecrew.tv/w/pyqfmLQV1pJc9PRCz7mETuhttps://nicecrew.tv/lazy-static/thumbnails/7da71531-793f-4c34-bfd7-0ef08ce30158.jpgPresident Biden Addresses the Nation After Trump VictoryIn some incredibly strange turn of events, Joe Biden speaks coherently to the press, promising a peaceful transfer of power to the incoming Trump administration on January 20, 2025. What the hell is going on? Original video [here](https://www.youtube.com/watch?v=HZR3ff7vl9s)https://nicecrew.tv/static/streaming-playlists/hls/bec8eed2-ef59-49ae-a1a3-b91a311b30a2/16f70a6b-0e90-43e4-a881-39ee4a30d449-master.m3u8https://nicecrew.tv/videos/embed/pyqfmLQV1pJc9PRCz7mETu45001062024-11-07T22:34:37.777ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/pcTizxVc4ASb6pbuxWhh5vhttps://nicecrew.tv/lazy-static/thumbnails/cfa41d41-7e34-412e-8a48-d00c42030725.jpgIs That Kenny Rogers?Is That Kenny Rogers?https://nicecrew.tv/static/streaming-playlists/hls/bbeafcbf-4faa-4c5d-a0da-692fdbff9e85/8acfdc79-ac92-4890-9502-0a2564e82d8d-master.m3u8https://nicecrew.tv/videos/embed/pcTizxVc4ASb6pbuxWhh5v155122024-11-08T12:45:15.844ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/dsbvxDETmcd2ha77oGw1xxhttps://nicecrew.tv/lazy-static/thumbnails/f910b7ca-e3d9-4ddc-8158-d953b88e838d.jpgCheap Therapy Live 11/7/24Last week on Cheap Therapy: Call off the emergency services. We're fine. I couldn't find a bottle opener. Did you use your teeth? Queebie, are you a beer virgin? Patrick says if you pour it just right you'll get a nice head. I've never heard someone take a first drink of beer and make that sound before. Why is Slampig screaming? Who knows what will happen this week? https://nicecrew.tv/static/streaming-playlists/hls/64d57a85-0f88-47c3-a13d-103283cb9f95/49e61700-6ce9-4fae-bc36-2b46d6615781-master.m3u8https://nicecrew.tv/videos/embed/dsbvxDETmcd2ha77oGw1xx76650122024-11-09T15:45:15.688ZNOCheap TherapyNOhttps://nicecrew.tv/w/5JtdmzyBXQwC33vwTreve4https://nicecrew.tv/lazy-static/thumbnails/f5883da1-b4c4-49a3-a4e6-348e1ce111ef.jpgThe Daniel Penny Show Trial: My ThoughtsI wanted to give my thoughts on the unfolding Daniel Penny Show Trial. https://nicecrew.tv/static/streaming-playlists/hls/26529047-cd6c-4c50-9bf6-d78cebe4ab81/761fe686-3851-4bf3-851c-533fd5e43e75-master.m3u8https://nicecrew.tv/videos/embed/5JtdmzyBXQwC33vwTreve49265462024-11-09T22:32:01.805ZDaniel PennyNYAlvin Braggshow trialpolitical persecutionYESRadix Verum ☦NOhttps://nicecrew.tv/w/26Vr1VScRms1dLVMg4DcM4https://nicecrew.tv/lazy-static/thumbnails/ac58b692-b442-4d68-8c7d-5b0bbd68918a.jpgEcclesiastesEcclesiasteshttps://nicecrew.tv/static/streaming-playlists/hls/08ecc925-4766-44d8-ada2-8825b81407d9/42e74566-4cd3-42b6-b15e-651852f0a05f-master.m3u8https://nicecrew.tv/videos/embed/26Vr1VScRms1dLVMg4DcM421125272024-11-10T01:16:33.532ZbiblekjvreadingYESAudio BibleNOhttps://nicecrew.tv/w/6J9Feeap2xzS5WJeUNfNpUhttps://nicecrew.tv/lazy-static/thumbnails/2afdabfa-1fac-48c1-b19a-8aed3ca90b3c.jpgJJR - 274 - And So It BeginsIt's official! Donald Trump scores a V in his 3rd bid for President, signalling the dawn of a new era. I go over exactly how it went down while laughing hysterically at the veritable endless roiling river of Leftist pissbaby assrage that's been flowing every since. Also you say pogrom I say pigrim, this week in activism, extra sauce in the sky and oh SO SO much more.https://nicecrew.tv/static/streaming-playlists/hls/2e604754-296c-4ee5-a3b1-4bc274e5d5b2/7c2c65db-e2be-414e-b73d-e89d94dbb53c-master.m3u8https://nicecrew.tv/videos/embed/6J9Feeap2xzS5WJeUNfNpU926653732024-11-11T02:27:34.093ZYESJust Joe Radio NOhttps://nicecrew.tv/w/b45TXScE6bw4ZzYai9ZhWvhttps://nicecrew.tv/lazy-static/thumbnails/a27d9f79-c618-4eed-b688-e9b2ca9aac0e.jpg1 Corinthians 1 and the lesson to my son while walkingDidn't include the whole video (the gopro splits it up and I don't care to merge them, as the rest is mostly just walking in silence), I was going to be talking to him about this stuff on our walk anyway, just felt like sharing it with you guyshttps://nicecrew.tv/static/streaming-playlists/hls/5169a297-9f7c-49ca-bc86-9547190674e1/eed45fab-2e87-4e97-851b-ac45d618bc36-master.m3u8https://nicecrew.tv/videos/embed/b45TXScE6bw4ZzYai9ZhWv6145192024-11-11T01:21:39.066ZYESBrother TylerNOhttps://nicecrew.tv/w/nXJM8Unywbjf7ZUEEfjAxuhttps://nicecrew.tv/lazy-static/thumbnails/1af850a3-2554-4852-acd2-14769ed91ec2.jpgSentencing of Alleged Pentagon Leaker Jack Teixeira Happing Now! Government Seeks 17 Years!Friends, Jack Teixeira is having the book thrown at him. Jack Teixeira, the Massachusetts Air National Guardsman who prosecutors hysterically claimed, "perpetrated one of the most significant and consequential violations of the Espionage Act in American history," is being sentenced today in Boston federal court. Prosecutors are seeking 17 years, almost half his life and he still faces a court martial later for an obstruction charge. Before his arrest, Teixeira had been an airman 1st class at Otis Air National Guard Base on Cape Cod in Massachusetts, where he worked as a cyber defense operations journeyman or information technology support specialist. Sources: https://www.reuters.com/world/us/pentagon-leaker-teixeira-faces-sentencing-us-seeks-17-year-prison-term-2024-11-12/https://nicecrew.tv/static/streaming-playlists/hls/b1d82ea5-eadd-41f3-af5b-ea83ccd975da/18f7aaf3-415b-4eeb-8e50-816edbd05278-master.m3u8https://nicecrew.tv/videos/embed/nXJM8Unywbjf7ZUEEfjAxu10595472024-11-12T20:56:04.368Zpentagonleakerdiscordjack teixeirapolitical persecutionYESRadix Verum ☦NOhttps://nicecrew.tv/w/wJGNa8MM3FXmjKvN9RjrPuhttps://nicecrew.tv/lazy-static/thumbnails/24ccf2ad-d57e-4bc6-8dc3-549c8ee5ec1c.jpgJack Teixeira Sentenced to 15 Years!!This is tragic. https://nicecrew.tv/static/streaming-playlists/hls/f8e88a19-ce48-4c22-bfaf-140d124d5e26/d9d8f972-5507-4758-bdef-1acc98362682-master.m3u8https://nicecrew.tv/videos/embed/wJGNa8MM3FXmjKvN9RjrPu3502392024-11-12T21:29:57.902ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/8CUsaBmV2ZPe5MtfKtLhZGhttps://nicecrew.tv/lazy-static/thumbnails/a29fd42f-2645-492e-9d34-c6d473f25ac2.jpgThe Strawman"Tom D'Ambra discusses how USA Inc. uses YOU (and your kids and your grand-kids and their kids) as collateral. Tom tells you how to look up your bond value on Wall Street. Note: The video Tom is referring to in the beginning of the show is NWO & Secret Societies in Biblical Prophecy. It is already posted on YouTube. Even if you are not a religious person it historically presents a wealth of background information that explains where we are today (at least in part). I'd be willing to bet this is history we never heard in school."https://nicecrew.tv/static/streaming-playlists/hls/3dd7120c-35ba-40a4-996c-2d8e8c7284c2/1fcd95c7-157a-4175-a04b-23cfed64679b-master.m3u8https://nicecrew.tv/videos/embed/8CUsaBmV2ZPe5MtfKtLhZG3638042024-11-13T18:37:09.377ZeconomicsfinancingbankingmoneytaxesYESMain teknoskillz channelNOhttps://nicecrew.tv/w/sWmySVUzh72dk2xbL4Sq5khttps://nicecrew.tv/lazy-static/thumbnails/d532f131-1559-4c00-8968-668530805480.jpgMy advice to young womenThis is the advice I wish someone had given me when I was young. https://nicecrew.tv/static/streaming-playlists/hls/da24718a-836b-43db-8b04-674e67b3a1db/b64f463c-260a-4343-a600-1bf0a60f4477-master.m3u8https://nicecrew.tv/videos/embed/sWmySVUzh72dk2xbL4Sq5k187051572024-11-14T22:45:28.782Zadviceyoung womenlifelifestylewomenYESRadix Verum ☦NOhttps://nicecrew.tv/w/hurXbPFCyqG7Z7FCR4hATmhttps://nicecrew.tv/lazy-static/thumbnails/7850c6e5-4b48-4485-878f-2c8ff029b1c6.jpgThe Amazing Story of Saint Justin the MartyrSaint Justin, Pray for us! https://nicecrew.tv/static/streaming-playlists/hls/858b098c-33dd-4b8a-9843-360a59a21a3a/cddb288b-4692-40b0-82ac-e42e4c228a09-master.m3u8https://nicecrew.tv/videos/embed/hurXbPFCyqG7Z7FCR4hATm264552024-11-15T22:15:45.970Zsaintssaint justinchristchristianityorthodoxYESRadix Verum ☦NOhttps://nicecrew.tv/w/ugLZtjiRsZtByQxwEHaiJhhttps://nicecrew.tv/lazy-static/thumbnails/b269eb79-76ee-4a88-b2eb-f0ed5fabfe16.jpgThe Pentagon has FAILED another audit!It is happening again... The pentagon has failed its 7th audit. https://nicecrew.tv/static/streaming-playlists/hls/e4f3c401-3b29-4ad2-bbff-bc0c5e4626b0/f860e203-63bb-4966-a960-3691037ac695-master.m3u8https://nicecrew.tv/videos/embed/ugLZtjiRsZtByQxwEHaiJh1880152024-11-16T21:48:34.368Zpentagonmoney launderblack opsauditDoDYESRadix Verum ☦NOhttps://nicecrew.tv/w/ouzniY3VYcdnBrQfjurw6Hhttps://nicecrew.tv/lazy-static/thumbnails/33d18b06-a2a3-4258-8a2b-5443c8b9c4fd.jpgA Brief DisagreementA Brief Disagreementhttps://nicecrew.tv/static/streaming-playlists/hls/b6267081-8a9a-4e66-b646-8dd66b9666eb/dd1369fd-7ff6-41f5-a15b-a5e885dd3531-master.m3u8https://nicecrew.tv/videos/embed/ouzniY3VYcdnBrQfjurw6H1360162024-11-17T19:07:06.034ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/r9evPPXkwTCPRKtLPUbiv4https://nicecrew.tv/lazy-static/thumbnails/b7f2dc73-c048-44fd-bf29-cf79f8491ab8.jpgMatt Gaetz and Enrique Tarrio Targeted by the Same Intel Asset?!We have a fascinating video for you today about the potential incoming AG and a strange connection he might have to Enrique Tarrio - it looks like they may have both been set up by the same FBI and CIA linked intelligence asset. A man who may have connections for foreign intelligence as well. Join me as we look at the story! https://nicecrew.tv/static/streaming-playlists/hls/cb9abebe-59b8-4381-a4eb-7a04e3ec8aa9/d1b2a499-f18f-451f-9f9b-c18b6f3a71cc-master.m3u8https://nicecrew.tv/videos/embed/r9evPPXkwTCPRKtLPUbiv46835462024-11-18T21:24:07.661Zmossadmatt gaetzenrique tarrioproud boysjanuary 6YESRadix Verum ☦NOhttps://nicecrew.tv/w/ewSwXj7LrJrALDmWcq7nK9https://nicecrew.tv/lazy-static/thumbnails/9184e15d-31ec-4cb8-9a1e-aaaacc2f4b29.jpgThyme & Place - I Wrote Your Name In The StarsNew song out today. Hope you enjoy. < 3 Free download here: https://thymeandplace.bandcamp.com/track/i-wrote-your-name-in-the-starshttps://nicecrew.tv/static/streaming-playlists/hls/6d964217-5d65-4343-9cbd-a23d6854128a/974e1457-03e6-47a2-bba1-67aa5484134b-master.m3u8https://nicecrew.tv/videos/embed/ewSwXj7LrJrALDmWcq7nK9125562024-11-19T03:24:51.029ZYESThyme & PlaceNOhttps://nicecrew.tv/w/idhb757j5rvk5e4RetExdPhttps://nicecrew.tv/lazy-static/thumbnails/1254b333-e5d5-4ae5-b85f-ba2382747c2b.jpgWe've Been ProgrammedThanks to TheOfficial1984 and Dan Bilzerian on X for the inspiration.https://nicecrew.tv/static/streaming-playlists/hls/8b62400b-8a4a-4a6e-a594-3888d51560c3/1a56cfa4-b7c4-40be-9072-18b8decce6b7-master.m3u8https://nicecrew.tv/videos/embed/idhb757j5rvk5e4RetExdP2295122024-11-20T02:00:13.282ZYESMain killyourtv channelNOhttps://nicecrew.tv/w/4kTd7DQ6kkMPFuSAEYhycAhttps://nicecrew.tv/lazy-static/thumbnails/d9576680-aa8c-4e17-904a-677b35b7dc54.jpgJewish BlessingsSouthern pastor outlines the effects of cultural enrichment via the jewish revolutionary spirit.https://nicecrew.tv/static/streaming-playlists/hls/1b121b2f-ea57-4e2a-a584-6ed189ee2260/19caf0df-179d-49ca-aac4-c3ae47283924-master.m3u8https://nicecrew.tv/videos/embed/4kTd7DQ6kkMPFuSAEYhycA228072024-11-20T16:01:42.152ZreligionpoliticsdiversitysocialismYESMain teknoskillz channelNOhttps://nicecrew.tv/w/jryZj7aTY4VNKU79LjQZ2Ahttps://nicecrew.tv/lazy-static/thumbnails/7b2fb2ca-a304-4067-b17a-21aba398599a.jpgOn Haters and Spiteful PeopleOn haters and spiteful people. https://nicecrew.tv/static/streaming-playlists/hls/95566b77-9f22-4c61-ae34-7304071fca80/636eebbd-b6ea-4684-97bd-4155d5414c65-master.m3u8https://nicecrew.tv/videos/embed/jryZj7aTY4VNKU79LjQZ2A8895732024-11-21T23:18:26.546Zhatersspiteful peoplevindictive peopleangerbitternessYESRadix Verum ☦NOhttps://nicecrew.tv/w/wYwmLm5AByw56zbbKrs6yhhttps://nicecrew.tv/lazy-static/thumbnails/22fdc958-0754-4374-b9a0-e689742364d5.jpgSam Hyde on Jewish Antinatalism, White Replacement, Virtue Signaling, Burt Ted & Fishtank Season 3!Sam Hyde on Perfect Guy Life PGL with Nick Rochefort are talking antinatalism being pushed, white replacement, genetics, virtue signaling, Burt's med, Ted, Simbal and Fishtank Season 3. Sam and Nick talk about Fisthank Season 3 characters. Reupload of : https://www.youtube.com/watch?v=rJghnJUfBfQ https://nicecrew.tv/static/streaming-playlists/hls/fad6850b-9827-40ab-9a8f-5a2e3c6c8404/7a2dee69-2513-4025-9164-8c203ed5ceea-master.m3u8https://nicecrew.tv/videos/embed/wYwmLm5AByw56zbbKrs6yh9005362024-11-27T00:42:05.848ZYESBrother TylerNOhttps://nicecrew.tv/w/hJKzv4KM8MJYsfC75bv75phttps://nicecrew.tv/lazy-static/thumbnails/0ca46e2a-ed26-484d-af73-0398b13b0346.jpgYour Racist Uncle Talks With You About Your Life After ‘Ruining’ Last Year’s Thanksgiving ASMR [M...Hey, yeah remember me? I think last time we saw each other was this time last year, thanksgiving. No haha, I won’t be making a big deal this time. My wife? She’s home sick, the fourth pregnancy has been rough. Say, you remember what I brought up last year at the table was, right? Yeah, your OTHER uncle is a pedophile. It doesn’t make sense why he keeps getting invited. It seems like the rest of the family thinks that being a ‘racist’ is worse than abusing someone like you. Yeah, haha, it is weird. So, you’re right. It is weird. Why do so many family members defend someone who did that to their daughter? Any ideas? Yeah, they will tell you not to judge, but you know that we’re supposed to judge? Yeah the Bible actually says: 1 Corinthians 6:2-3: “Do ye not know that the saints shall judge the world? and if the world shall be judged by you, are ye unworthy to judge the smallest matters? Know ye not that we shall judge angels? how much more things that pertain to this life?” Sort of wild isn’t it? Seems like cherry picking to me. Oh you agree? Have you been reading your Bible? Good. Oh the one I got you? That’s great. I gave your faggot uncle one like it, well, before what happened. Stay away from him, okay? Good. I am really glad you are reading your Bible. Really keeping to Proverbs 1:7 “The fear of the LORD is the beginning of knowledge: but fools despise wisdom and instruction.” I’m also sorry your dad isn’t teaching you this stuff. Too busy watching football?? Hah! Yeah that’s about right. No, you can use the nigger word around me, but be careful, you’re still young and can get into trouble. Soon, Lord willing, you won’t have to be careful. I’m proud of you though. How was your school year? You did what?? You even gave him his tooth back? Wow! I wouldn’t have. Someone who abuses someone else in such a disgusting manner, deserves a lot more than a busted out tooth. Again, I’m proud of you for standing up for those who can’t stand up for themselves...https://nicecrew.tv/static/streaming-playlists/hls/878a5003-7f89-436e-a657-54adbf97b0ff/b1f1caf6-2775-43d2-bd69-b16f73702b3b-master.m3u8https://nicecrew.tv/videos/embed/hJKzv4KM8MJYsfC75bv75p3445292024-11-29T00:27:02.498ZasmrthanksgivingjokeYESBrother TylerNOhttps://nicecrew.tv/w/vZHDeHfHhThs5ur3xB6EvVhttps://nicecrew.tv/lazy-static/thumbnails/29561d6d-77f3-4422-a366-e637290a8d15.jpgfirewire 05/12/23Will muhdiksquarious get banana? Is there any escape from mexican white supremacy?https://nicecrew.tv/static/streaming-playlists/hls/f2e8142e-16ac-48fc-aeac-e50adef61377/1eec6cc0-cf7e-479c-b6f8-0ad65d5d253e-master.m3u8https://nicecrew.tv/videos/embed/vZHDeHfHhThs5ur3xB6EvV5155262024-11-29T07:58:01.598ZYESThe FirewireNOhttps://nicecrew.tv/w/kALoTCqEM2JtYqaeLcsAPYhttps://nicecrew.tv/lazy-static/thumbnails/bdc754af-78e3-4efd-b30a-743bdfe6592b.jpgfirewire 07/14/23Just how bad was corn pop? Why won't the Nazis let Potassium achieve his true potential?https://nicecrew.tv/static/streaming-playlists/hls/9eb8482a-9273-4139-85be-5333df6a1ca6/17c798ae-e086-41e6-9e63-bad5e084fbaa-master.m3u8https://nicecrew.tv/videos/embed/kALoTCqEM2JtYqaeLcsAPY4255342024-11-29T08:05:18.310ZYESThe FirewireNOhttps://nicecrew.tv/w/6WsyK6uBhyfcVrYpLoWRGShttps://nicecrew.tv/lazy-static/thumbnails/0e295e90-c4d7-470d-8ad5-196f0fcbf836.jpgfirewire042823Mattel debuts the best thing to hit taco fry cooks since spiderman. Indians shit everywhere. E V E R Y W H E R Ehttps://nicecrew.tv/static/streaming-playlists/hls/30183a54-c739-4a9a-86e7-fc553b891b36/06fb1c42-c6b5-4bbe-9e7c-638db190acd8-master.m3u8https://nicecrew.tv/videos/embed/6WsyK6uBhyfcVrYpLoWRGS2955262024-11-29T08:10:06.833ZYESThe FirewireNOhttps://nicecrew.tv/w/4ugDivGQnjFwUydVhMMGUPhttps://nicecrew.tv/lazy-static/thumbnails/3599b944-8ce7-4161-9571-4d4a9e68d52c.jpgAnalyzing Daniel Penny's InterrogationI wanted to provide my analysis of the Daniel Penny interrogation and reiterate to everyone to NEVER speak to law enforcement of any kind without an attorney present. https://nicecrew.tv/static/streaming-playlists/hls/1c3de1c8-7e4c-4b3e-8e94-6c3e082139af/a15bc85f-cce4-4e8a-b46c-554ffaf1056f-master.m3u8https://nicecrew.tv/videos/embed/4ugDivGQnjFwUydVhMMGUP173159852024-11-29T21:06:35.888Zdaniel pennyalvin braggnew yorkpolitical persecutiondeception detectionYESRadix Verum ☦NOhttps://nicecrew.tv/w/sP3cweGTZ8MnoYLEA8jihphttps://nicecrew.tv/lazy-static/thumbnails/e517be52-fc97-41f5-a42b-e7c90f6923fb.jpgJJR - 275 - Eli And The BonehuffersBack from an unexpected and lengthy absence, I do my best to dispel recent subversive misdirection regarding marriage and masculinity being propagated by effeminate, closet case, degenerate, self described influencers of modern men. Also, how much more evidence do you need, Eli believes in Bonehuffer, Jeff abandons his son to be castrated, Saga of the Super Mayor continues and so so much more.https://nicecrew.tv/static/streaming-playlists/hls/d91eead4-f2b6-469e-a7b1-6cc88079501b/be1e1bb8-ede3-4897-9a3f-64373af9808a-master.m3u8https://nicecrew.tv/videos/embed/sP3cweGTZ8MnoYLEA8jihp813254392024-12-02T05:25:37.733ZYESJust Joe Radio NOhttps://nicecrew.tv/w/jM7uVWeQVVLKeMfDeP3Edohttps://nicecrew.tv/lazy-static/thumbnails/6578eee3-0c58-4ccb-9232-b06372eba825.jpgClosing Arguments Begin in Daniel Penny Show TrialClosing arguments began Monday in the Daniel Penny "Chokehold" trial over the May 2023 death of Jordan Neely, a deranged man who threatened subway passengers. Defense attorney Steven Raiser asked jurors in closing arguments to imagine they were on the train that day, setting the scene with sound effects of closing doors, a train pulling out of a station, and police body camera footage of passengers saying Neely "scared the living daylights out of everybody." Sources: https://abc7ny.com/post/closing-arguments-begin-trial-veteran-daniel-penny-charged-nyc-subway-chokehold-death-jordan-neely https://chroniclesmagazine.org/web/daniel-penny-is-guilty-of-being-white/ https://www.fox5ny.com/news/nyc-subway-chokehold-daniel-penny-trial-closing-arguments-jordan-neelyhttps://nicecrew.tv/static/streaming-playlists/hls/9810f876-2043-4020-90af-a15b746b1ec6/52452696-fe39-4518-8c07-20b45e953331-master.m3u8https://nicecrew.tv/videos/embed/jM7uVWeQVVLKeMfDeP3Edo9515682024-12-02T21:14:00.750Zdaniel pennyalvin braggpolitical persecutionnew yorktrialYESRadix Verum ☦NOhttps://nicecrew.tv/w/1KDPNKy3zAG1teySNgjV4Hhttps://nicecrew.tv/lazy-static/thumbnails/01780755-fba2-47d6-8e71-ae6f28b312f4.jpgShe should lose her medical license. Free Daniel Penny!She should lose her medical license. Free Daniel Penny!https://nicecrew.tv/static/streaming-playlists/hls/06184ac8-de13-444f-8717-dc337d716a4b/dd878dfc-cbb4-4ba6-91db-37a6f54e31d3-master.m3u8https://nicecrew.tv/videos/embed/1KDPNKy3zAG1teySNgjV4H525912024-12-03T18:49:36.286ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/wCfsJCS81SUyddgVrA1oTChttps://nicecrew.tv/lazy-static/thumbnails/44606daf-e209-4c18-9826-7adfc2df46c4.jpgI Hate the Anti-Christ: Lily Phillips Edition (Young women are NOT okay!)I wanted to talk about the British "adult entertainer" aka prostitute Lily Phillips who is currently trying to break the world record for sleeping with 1000 men in just 24 hours. https://nicecrew.tv/static/streaming-playlists/hls/f801d8ee-fdb3-4df4-a135-3390c64c124a/90cc94ff-c05a-41de-951e-ee3775345c4c-master.m3u8https://nicecrew.tv/videos/embed/wCfsJCS81SUyddgVrA1oTC46051492024-12-03T19:59:00.953Zlily phillipsdemonic influencemodern womenmental illnessbpdYESRadix Verum ☦NOhttps://nicecrew.tv/w/aTvX46BfJimXMyA441stcRhttps://nicecrew.tv/lazy-static/thumbnails/12a8d7e2-ba38-49df-864b-930e576c6cc6.jpgBook Review: Think for Yourself Series: Apology to Germany by Beth MareeWtf is this lmao You can get a copy here: https://www.amazon.com/gp/aw/d/B0CYTJ6GLHhttps://nicecrew.tv/static/streaming-playlists/hls/5013a316-3af9-40ca-aa11-5a973244c42b/a4b4e3c3-64d7-4f36-829c-fde3becceaa3-master.m3u8https://nicecrew.tv/videos/embed/aTvX46BfJimXMyA441stcR3185192024-12-05T23:19:30.957ZYESBrother TylerNOhttps://nicecrew.tv/w/387gds3vKnRjxhNDJCCzt1https://nicecrew.tv/lazy-static/thumbnails/6523a429-3a9c-4f80-9307-4d2b318ec717.jpgJJR - 276 - The Persecution Of PennyMany thought since the battle of getting Trump re-elected was won the war was over. But the public persecution of Daniel Penny proves otherwise. Also off the charts entitlement and delusion, it isn't "assistance" it's sinister subversion, be part of something greater, period ah period uh the remix and oh so much morehttps://nicecrew.tv/static/streaming-playlists/hls/113057cf-0541-491b-a21c-726ac041a822/910ed90a-cace-4486-b2ef-7cec43562402-master.m3u8https://nicecrew.tv/videos/embed/387gds3vKnRjxhNDJCCzt1872954892024-12-06T05:08:33.637ZYESJust Joe Radio NOhttps://nicecrew.tv/w/uzAcE656gczQknnmSccmithttps://nicecrew.tv/lazy-static/thumbnails/bcee083d-ced8-49cf-b2bc-5c4d0fc69c73.jpgDaniel Penny is FREE! Found NOT GUILTY!Daniel Penny has been found NOT GUILTY of criminally negligent homicide, but now I think prosecutor Dafna Yoran should be investigated for prosecutorial misconduct and malicious prosecution. https://nicecrew.tv/static/streaming-playlists/hls/e7708105-8a77-48b6-8a6f-e5fd097a27ed/f6c6fdc6-d2a2-4acd-8924-89460c5c9ae2-master.m3u8https://nicecrew.tv/videos/embed/uzAcE656gczQknnmSccmit29553252024-12-09T19:44:50.190Zdaniel pennyalvin braggdafna yorannew yorkjordan neelyYESRadix Verum ☦NOhttps://nicecrew.tv/w/iMwBcfNJ9Kus8xscGdST2Dhttps://nicecrew.tv/lazy-static/thumbnails/a811aa35-dce8-4177-8b30-1b2cf640d7ca.jpgThis is Horrifying and Sad!Unfortunately, I have an update to the Lily Phillips story. Lily is clearly under demonic oppression. This is what regret and spiritual illness looks like. https://nicecrew.tv/static/streaming-playlists/hls/9006b060-c945-470e-8347-51c0ff4efadb/e8843d65-0aba-453c-b640-4ea656864c1f-master.m3u8https://nicecrew.tv/videos/embed/iMwBcfNJ9Kus8xscGdST2D751014252024-12-10T21:16:00.572Zlily phillipsonlyfanspornstardemonic oppressionregretYESRadix Verum ☦NOhttps://nicecrew.tv/w/3xKwoqStpsmLnvBCeKfDi3https://nicecrew.tv/lazy-static/thumbnails/53c98938-14ce-4068-96e6-aa9f5cafea9c.jpgIs Luigi Mangione a Patsy? It's Getting Weird.I think we all know they are not going to just tell us the real story, we have to uncover the truth ourselves. https://nicecrew.tv/static/streaming-playlists/hls/14a12820-e175-48c8-aa4a-243797b36290/5dd26790-a5d5-4328-bff1-308c0e943641-master.m3u8https://nicecrew.tv/videos/embed/3xKwoqStpsmLnvBCeKfDi36151922024-12-10T22:55:07.219ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/5DyRvZ5aPL1SY3BP9CXGiahttps://nicecrew.tv/lazy-static/thumbnails/463c294f-8982-4f6e-acce-695a13c2eefd.jpgJJR - 277 - Are You Syri-ass?!The Penny verdict is IN, starkly highlighting an unbridgeable gap in civilized society. Also Israel's great expansion begins, Luigi on the lamb and many other refinements. I don't feel like laboring over a lengthy description this time, just click the link and check it out. It's good stuff, promise.https://nicecrew.tv/static/streaming-playlists/hls/25a3522a-e63a-453a-81b8-fbc82cda829b/42505a0a-0c70-4e6e-a9c4-18d92152687f-master.m3u8https://nicecrew.tv/videos/embed/5DyRvZ5aPL1SY3BP9CXGia966555812024-12-13T04:11:54.408ZYESJust Joe Radio NOhttps://nicecrew.tv/w/euJFYsc3ZVxR9XSoRoCNZShttps://nicecrew.tv/lazy-static/thumbnails/3b6ee777-cc1e-497c-86f2-be9e087ea3a2.jpgBobo is backBobo is backhttps://nicecrew.tv/static/streaming-playlists/hls/6d49efb0-c362-4141-b773-c2a9467be3b4/99c67a24-fcb1-43c0-ae70-5f384efc60a4-master.m3u8https://nicecrew.tv/videos/embed/euJFYsc3ZVxR9XSoRoCNZS18032024-12-14T15:10:02.850ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/7p1fQmP28Q1urQnHctrbo3https://nicecrew.tv/lazy-static/thumbnails/44c7cd4c-f220-456e-993c-9b68226a37a0.jpgJack Teixeira, Pentagon Leaker & Hero Sentenced to 15 years!! #jackteixeira #leaker #pentagonJack Teixeira, Pentagon Leaker & Hero Sentenced to 15 years!! #jackteixeira #leaker #pentagonhttps://nicecrew.tv/static/streaming-playlists/hls/33cd18a6-1792-4f30-a6c9-32b044a8cb9e/d101a246-23e6-463d-82f4-8aa27579ec1b-master.m3u8https://nicecrew.tv/videos/embed/7p1fQmP28Q1urQnHctrbo335532024-12-14T15:10:23.806ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/spBcTPaJ6BXgUNjscyyHtAhttps://nicecrew.tv/lazy-static/thumbnails/799b59ba-e1dc-41ce-ad6b-66dfff5c2d38.jpgDrawing: LemonboyA boy who eats so many lemons his head turns into a bright yellow lemon! I hope you guys enjoyed this video! :Dhttps://nicecrew.tv/static/streaming-playlists/hls/d5d96862-c72e-4f6e-b733-05f18dad6f64/04b1bf14-7c65-4434-8f55-d94ab95a4067-master.m3u8https://nicecrew.tv/videos/embed/spBcTPaJ6BXgUNjscyyHtA144002024-12-14T20:17:12.414ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/oCBTyTLh9ezpZqfvUz4cSAhttps://nicecrew.tv/lazy-static/thumbnails/6cbe06f1-4bc1-43fb-a600-6cf46e790f2d.jpgDrawing: Curious catAnother little cartoon I drew for fun, sorry about the coughing at the end, my throat was a bit itchy and still recovering from it so yeah...https://nicecrew.tv/static/streaming-playlists/hls/b745f194-c2d6-458c-bdb1-b01e09525c4a/80e35da9-9c73-4b5a-ac36-92c4e138184c-master.m3u8https://nicecrew.tv/videos/embed/oCBTyTLh9ezpZqfvUz4cSA164002024-12-14T20:17:20.364ZCuteCatsAnimalsCartoonsYESDreamy's LoungeNOhttps://nicecrew.tv/w/fHY2nWrUNogjfTRTLfFC1Lhttps://nicecrew.tv/lazy-static/thumbnails/009d7eb7-7939-4b98-91c9-1e35afec81e0.jpgTime lapse: laughing girlAnother dark drawing I made because.....stuff! Like, comment and subscribe to my channel! :)https://nicecrew.tv/static/streaming-playlists/hls/773bf630-b1c6-4f75-bbac-c826037e23f4/86b4330f-5e41-4636-8d46-63f507bdc9c6-master.m3u8https://nicecrew.tv/videos/embed/fHY2nWrUNogjfTRTLfFC1L23012024-12-14T20:16:55.945ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/eygzDR8AUxo59DJ2yZxVC6https://nicecrew.tv/lazy-static/thumbnails/108cee86-fde6-4811-a1a9-af165a799ce7.jpgSpeed paint: Virus-chanAnother speed paint drawing, check it out on DeviantART! :) Like, comment and subscribe to my channel!https://nicecrew.tv/static/streaming-playlists/hls/6dc83472-4ed9-479f-a0e0-08a6264fec49/d07e08b4-2a79-465c-b134-015256e4d4e4-master.m3u8https://nicecrew.tv/videos/embed/eygzDR8AUxo59DJ2yZxVC622012024-12-14T20:17:32.994ZAnimeCuteBlackRedVirusYESDreamy's LoungeNOhttps://nicecrew.tv/w/dhef27jLZp2guZHKLRDrj7https://nicecrew.tv/lazy-static/thumbnails/dfde869c-bd96-43c6-bdeb-d1e597c8748a.jpgDrawing time lapse: Little wandererAnother anime drawing I made for you guys to see, the music belongs to me and I give credit to the Beatles who made this song. Song: Dear prudence by The Beatleshttps://nicecrew.tv/static/streaming-playlists/hls/6371b988-19b7-49bc-a31e-f9626f958c36/3f3cb1c1-e86c-45e6-9354-4792f4b2f8ae-master.m3u8https://nicecrew.tv/videos/embed/dhef27jLZp2guZHKLRDrj722002024-12-14T20:17:05.885ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/bvSLXUG2p74bGAacYyWhkghttps://nicecrew.tv/lazy-static/thumbnails/5218690c-cdba-418c-9c92-3cf2de41f259.jpgDrawing time laspe: Bad hair dayHatsune Miku's hair is messy and puts extra burettes on her pig tails so they would'nt go all over the place! Music: Audio track 2 by The Beatleshttps://nicecrew.tv/static/streaming-playlists/hls/55273f4d-f958-4bae-9aa6-68cd9c3aed4d/2e39ee5e-7771-4992-9389-c425e046cb72-master.m3u8https://nicecrew.tv/videos/embed/bvSLXUG2p74bGAacYyWhkg31002024-12-14T20:17:15.785ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/55T4JVqjvQVS9US1wp1icxhttps://nicecrew.tv/lazy-static/thumbnails/34c3555c-21ae-41f6-9afa-82c1e3a1a569.jpgDrawing time laspe: Ytp'sA drawing of Ytp's I would watch on YouTube! :) Like, comment, and subscribe to my channel! DeviantART.com/Rainbowdoodler209 Tumblr.com/LucyannaXX3 Wattpad.com/Booklandip2 Music: Antiquism Deuxhttps://nicecrew.tv/static/streaming-playlists/hls/2112ffd3-d074-4fe2-9c83-1672d9837831/bf0fb491-7fde-49b0-b471-96b286fe3232-master.m3u8https://nicecrew.tv/videos/embed/55T4JVqjvQVS9US1wp1icx33002024-12-14T20:17:34.770ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/1YcChVR6d5j4tjWq8hrTYdhttps://nicecrew.tv/lazy-static/thumbnails/daa80c58-2229-4d0c-a6f1-20cbe9b552db.jpgI talk about: Companies using robotsI would rather talk to a live human being than a robot! :/https://nicecrew.tv/static/streaming-playlists/hls/07d8d0d3-658f-4de9-9c80-37ddc0485a30/692bbd60-6978-4905-93aa-27af875605f4-master.m3u8https://nicecrew.tv/videos/embed/1YcChVR6d5j4tjWq8hrTYd304002024-12-14T20:18:38.383ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/4eceJ4AL1WVh4PCxfgB3FLhttps://nicecrew.tv/lazy-static/thumbnails/68c56bdf-cecb-409c-b7d6-ce644fd279af.jpgDrawing time lapse: Teto in a suitAnother Vocaliod/Utauloid drawing of Kasune Teto wearing a suit looking quite spiffy! Like, comment and subscribe to my channelhttps://nicecrew.tv/static/streaming-playlists/hls/1a230283-52e6-4e93-b25e-96eb6f80ea32/09e0ccaf-4b22-49d4-a582-e35582dc4979-master.m3u8https://nicecrew.tv/videos/embed/4eceJ4AL1WVh4PCxfgB3FL21002024-12-14T20:17:42.102ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/v5vghp1h45oi9zvQPdEBUHhttps://nicecrew.tv/lazy-static/thumbnails/e071bbe6-ec2c-47a1-8e59-55330db1cf1a.jpgDrawing time lapse: Rainy nightA drawing about Hatsune Miku and her monster friends forgot to bring umbrellas and got soaked by the cold rain above... Music: Rain By the Beatleshttps://nicecrew.tv/static/streaming-playlists/hls/eb7a07ce-230d-46fb-8791-270c4a66706d/6f48c742-e72d-4dcf-bff1-83fd24c4310f-master.m3u8https://nicecrew.tv/videos/embed/v5vghp1h45oi9zvQPdEBUH29002024-12-14T20:17:50.178ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/fgj22kpdNLmPrKXyiAtyKkhttps://nicecrew.tv/lazy-static/thumbnails/7f0222c6-42e2-4cc4-b9bf-b51dc60139d7.jpgDrawing time lapse: Raggy Moncha and the virus manA drawing base off of me being unable to post stuff in DA since yesterday night on Friday, it's like my computer is mad at me or something...8( Music: Fn Pig by Deadmau5https://nicecrew.tv/static/streaming-playlists/hls/73833399-0839-4635-9244-51fc902336c9/a8b7cb96-ffa5-4ceb-ae2d-5755d03633b3-master.m3u8https://nicecrew.tv/videos/embed/fgj22kpdNLmPrKXyiAtyKk24002024-12-14T20:18:02.232ZYouTube CaptureDrawingPen drawingFantasyYESDreamy's LoungeNOhttps://nicecrew.tv/w/hqTFFKf5x7k2TcgtuzXVwLhttps://nicecrew.tv/lazy-static/thumbnails/8efaec79-ac31-4745-b936-6aac72cfdb1d.jpgDrawing time laspe: Lucyanna and the T-Rex and dragonA drawing of Lucyanna walking in a field of dinosaurs and dragons and came across Alphy and her cat riding on a Trex...! Like, comment, and subscribe to my channel. Music: Dunch wagon by Deadmau5https://nicecrew.tv/static/streaming-playlists/hls/850bebaa-f7a7-4c63-a1ec-a9a61b6145d4/96e7a1fd-3eaf-4c02-a2f5-c989c0e3c8ad-master.m3u8https://nicecrew.tv/videos/embed/hqTFFKf5x7k2TcgtuzXVwL22002024-12-14T20:17:55.294ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/ntArUF42J247VhECt5AZ59https://nicecrew.tv/lazy-static/thumbnails/651a74ee-5e0a-4d71-89aa-2e9146b3964e.jpgDrawing time lapse: Shy AngelAnother angel drawing for fun, I had fun making this drawing! ^^ Music: Channel 42 by Deadmau5https://nicecrew.tv/static/streaming-playlists/hls/adea38e0-ac4c-45af-9675-ce11a8d2e564/306062d1-7e07-4183-9045-604a9f3c0684-master.m3u8https://nicecrew.tv/videos/embed/ntArUF42J247VhECt5AZ5929002024-12-14T20:18:20.210ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/388mDf4xz8pYmor1s8XNZVhttps://nicecrew.tv/lazy-static/thumbnails/774a9b60-fe06-43a7-afcd-856b42f7cf9d.jpgClarinet: TetrisAnother clarinet video I made to make you guys happy, I hope you enjoy this video!https://nicecrew.tv/static/streaming-playlists/hls/11310456-6854-4526-bee8-96b0e9f7225f/c7fee4ed-3182-4704-b587-109a4211eb86-master.m3u8https://nicecrew.tv/videos/embed/388mDf4xz8pYmor1s8XNZV101002024-12-14T20:18:19.291ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/mcJL12ZjgqmbKMADk8ySZEhttps://nicecrew.tv/lazy-static/thumbnails/6c8ad079-fd41-487a-8311-bcc43bb7fc50.jpgSpeedpaint: The beautiful viewAnother Speedpaint drawing, I loved the results. Music: And you're bird can sing by the Beatleshttps://nicecrew.tv/static/streaming-playlists/hls/a39a4e3c-9c0b-4eb3-b931-79847a55f8a8/4974203d-6d61-41d0-9d52-c599e9c16d3e-master.m3u8https://nicecrew.tv/videos/embed/mcJL12ZjgqmbKMADk8ySZE59002024-12-14T20:18:37.207ZYouTube CaptureCuteDrawingSpeedpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/ftA5J9bwJ9UhXMqLwoagbzhttps://nicecrew.tv/lazy-static/thumbnails/65aacd21-13fc-4d06-a953-e50e517627e5.jpgDrawing time laspe: Flower petals to the headvia YouTube Capturehttps://nicecrew.tv/static/streaming-playlists/hls/753a06c8-6fbb-47d0-bdee-c339cb716d09/5c520d60-26da-4368-a2c8-4ced0fc57c04-master.m3u8https://nicecrew.tv/videos/embed/ftA5J9bwJ9UhXMqLwoagbz27002024-12-14T20:18:41.416ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/tNmnt1jA6jDf89R9nDxADchttps://nicecrew.tv/lazy-static/thumbnails/6aa64463-4c55-4707-972f-389f6ffa7c26.jpgDrawing time laspe: Arnold and the pigsA pig named Arnold doesn't like being a normal pig like every other pig out there in the farm.... Music: Audio file 8 By the Beatleshttps://nicecrew.tv/static/streaming-playlists/hls/e11f82c1-0713-49e9-b2de-2f1934a32dfd/7b58bf45-a0fa-4acd-8593-4346e59cdf34-master.m3u8https://nicecrew.tv/videos/embed/tNmnt1jA6jDf89R9nDxADc23002024-12-14T20:18:34.905ZYouTube CapturePigsYESDreamy's LoungeNOhttps://nicecrew.tv/w/sKeq2V6GNAdwsX9paMcZhYhttps://nicecrew.tv/lazy-static/thumbnails/37496afa-1b08-4ad4-8fd4-3de0c6241631.jpgDrawing time lapse: Angel Flower manA man that has a flower for a head and protects everyone in Planet Tarreon! Music: Oblistique by Deadmau5https://nicecrew.tv/static/streaming-playlists/hls/d896daaa-8397-4022-9643-3b1c30f235c4/7d3359db-2655-44f8-b99e-d762b6f9fa9c-master.m3u8https://nicecrew.tv/videos/embed/sKeq2V6GNAdwsX9paMcZhY29002024-12-14T20:18:56.374ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/jQz3Bnn67VPWMXazchySk5https://nicecrew.tv/lazy-static/thumbnails/43400565-ef36-4fdf-83cf-2b129a11bce3.jpgDrawing time laspe: Jim the PirateA drawing of a pirate named Jim who owns a crappy pirate ship that he made himself with his pet raven for extra help! Music: Closer by Deadmau5https://nicecrew.tv/static/streaming-playlists/hls/988c8fc1-3f83-44d2-bb1e-9eedf986aefa/5ac93799-8bf9-40f9-9d35-70f12bed1d97-master.m3u8https://nicecrew.tv/videos/embed/jQz3Bnn67VPWMXazchySk528002024-12-14T20:18:48.686ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/akjq9voBwards6ynBiZKMvhttps://nicecrew.tv/lazy-static/thumbnails/1e2ae324-b366-45e2-be1f-34ad2eab06ba.jpgDrawing time laspe: The weird and the cuteAnother Speedpaint on my computer, sorry if the shot of the screen was bad, I was trying to adjust the camera. Anyways I hope you guys enjoy the video and have a great Friday! :P Music: Beacuse by the Beatleshttps://nicecrew.tv/static/streaming-playlists/hls/4b94baa1-cee4-4bfb-8b41-6c2fb4516973/c793f7a0-691b-4deb-b4f4-c113d3977263-master.m3u8https://nicecrew.tv/videos/embed/akjq9voBwards6ynBiZKMv44002024-12-14T20:19:13.490ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/gqnGfCi1EZCk8Pn14wTrvQhttps://nicecrew.tv/lazy-static/thumbnails/c3ee26c4-71e2-4be4-9684-86d0a1e262e6.jpgDrawing time lapse: Internet Explorer is not working properlyA Speedpaint about a boy named Joey Datakit tries to got to internet explorer but the internet locked him out of his home, which is the city of code. Then Joey sat down on his holographic couch and waited until Internet Explorer worked again... Music: Closer by Deadmau5https://nicecrew.tv/static/streaming-playlists/hls/7ce04cbe-a752-4457-ac5c-fb0f8f898b7e/142ae46c-7255-405f-94a8-8300d7b25d97-master.m3u8https://nicecrew.tv/videos/embed/gqnGfCi1EZCk8Pn14wTrvQ30002024-12-14T20:19:08.827ZYouTube CaptureComputerSpeedpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/oShxQDU18Lc78r33gB3z1Thttps://nicecrew.tv/lazy-static/thumbnails/096094da-0b08-45c1-9b8a-22c9e2fdc8a2.jpgDrawing time laspe: Project 12: LeecherMusic: Blackbird by the Beatles Another dark and bloody drawing, I like making these. Anyways this project monster is called Leecher, others claim that this little leech like monster will eat the hosts tongue and control the host to infect others, now he's locked up in a cage for all the trouble Leecher has done!https://nicecrew.tv/static/streaming-playlists/hls/b92e700b-22b7-45ce-9298-e64911bbd437/7054f4a8-4d2c-464d-a936-2968d609cfe8-master.m3u8https://nicecrew.tv/videos/embed/oShxQDU18Lc78r33gB3z1T34002024-12-14T20:19:16.920ZProjectMonstersHorrorBloodySpeedpaintYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/nKvQELk6Pd8uC6jMuPimLUhttps://nicecrew.tv/lazy-static/thumbnails/9481e823-79be-4ab2-86d5-89ee4d449e6f.jpgDrawing time laspe: Lefty monsters & Abbey roadAnother Beatles reference drawing, I love this drawing I made, this was the first time drawing with my left hand to everyone. I hope you guys have a great day and...stuff! :P Music: getting better but the Beatles Here's the link to the drawing! http://rainbowdoodler209.deviantart.com/art/The-Lefty-monsters-in-Abbey-road-539837176https://nicecrew.tv/static/streaming-playlists/hls/b0234871-01eb-4073-af17-ca6225543c54/c3217297-e4e0-48c4-a658-886110821db0-master.m3u8https://nicecrew.tv/videos/embed/nKvQELk6Pd8uC6jMuPimLU28002024-12-14T20:19:26.960ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/4WXeRq2E4eYkUqMfKLAmS6https://nicecrew.tv/lazy-static/thumbnails/0aec09bb-4feb-4d77-a6f9-c186fa757b50.jpgDrawing: The ghost of Lavender townAnother drawing video, I'll make another reaction video if you want me too, you guys seem to enjoy those videos...https://nicecrew.tv/static/streaming-playlists/hls/1ff79f27-838a-4286-b74d-be9473de9819/9d0fbb56-1075-45ef-bb38-3f73c6cb6884-master.m3u8https://nicecrew.tv/videos/embed/4WXeRq2E4eYkUqMfKLAmS6519002024-12-14T20:21:31.111ZLavender townCreepyPokemonAnimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/49gdppMgW2dNBu7yTbHEEihttps://nicecrew.tv/lazy-static/thumbnails/8d2dc133-597a-4cee-92ee-0e9c04d71f92.jpgDrawing time laspe: Girls of colorsUgh I'm tired, anyways here's a speed drawing of girls with different colored hair because why not. I hope you guys enjoy this video, criticisms are open! :) Music: Long Long Long by Beatles and Georgehttps://nicecrew.tv/static/streaming-playlists/hls/1972bdf4-785d-44ad-ac5f-ce997facf6ed/70f7ae9b-67d8-46e1-ae71-c5cf3bb474a2-master.m3u8https://nicecrew.tv/videos/embed/49gdppMgW2dNBu7yTbHEEi57002024-12-14T20:19:42.227ZYouTube CaptureAnimeCuteGirlsDrawingsYESDreamy's LoungeNOhttps://nicecrew.tv/w/4Q5MRPoieU9XxJZE7GemtBhttps://nicecrew.tv/lazy-static/thumbnails/307d2e51-333c-4ce7-a96c-569e2db3a2fa.jpgI talk about: Ghosts👻Some people see ghosts, some people can't see ghosts, anyways I hope you have a great day everyone! :Dhttps://nicecrew.tv/static/streaming-playlists/hls/1f0211bd-5ece-425b-bb29-72698772fd59/582e8352-dbe1-4b21-972b-9776f40f4552-master.m3u8https://nicecrew.tv/videos/embed/4Q5MRPoieU9XxJZE7GemtB179002024-12-14T20:20:08.835ZGhostsTalkingYESDreamy's LoungeNOhttps://nicecrew.tv/w/aZAbFD3jbD22M5fQMzHJQdhttps://nicecrew.tv/lazy-static/thumbnails/ac512cf1-3e84-43da-b70b-8c81f91d1d81.jpgSpeed drawing: The HeadlessAnother speed drawing but with headless creatures and other animals! I hope you guys enjoy the video. I'll be gone in five days, for an animation came in Green Bay! Music: Carry that weight by the Beatleshttps://nicecrew.tv/static/streaming-playlists/hls/50ecb5a7-ad3b-4a5c-b60e-13fa6480506c/a3283ae0-5186-4148-8a7e-151346cccc33-master.m3u8https://nicecrew.tv/videos/embed/aZAbFD3jbD22M5fQMzHJQd22002024-12-14T20:19:57.487ZYouTube CaptureSurrealismDrawingPencilYESDreamy's LoungeNOhttps://nicecrew.tv/w/ndF45LysE8VP2hcVQntrcghttps://nicecrew.tv/lazy-static/thumbnails/9616ff49-911e-4ed5-b8c5-8b2f6a66d055.jpgSpeed drawing: Lonely monsterA drawing but with a lonely monster, it's kind hides in the shadows showing their red eyes as they growl at you, some lonely monsters become friends with other monsters as well! Music: Cry baby cry by the Beatles the rights belong their rightful owners!https://nicecrew.tv/static/streaming-playlists/hls/abd4e78a-4205-48fa-ac18-eea82c11ca59/9ce9bd22-7aa4-49a0-acba-3ec90a1a8399-master.m3u8https://nicecrew.tv/videos/embed/ndF45LysE8VP2hcVQntrcg40002024-12-14T20:20:25.631ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/eekYn1D4WaYRF2vd2R2KQNhttps://nicecrew.tv/lazy-static/thumbnails/375c19b4-bf8a-4c71-b30c-f5e0f779be61.jpgDrawing: Angel girlSorry for lagging on videos but I'll make another reaction video once this is uploaded, but I hope you guys like this video....https://nicecrew.tv/static/streaming-playlists/hls/6b23c795-94ad-438e-9b1a-c16527c79672/570787bb-352e-4714-996c-ce96caa7396d-master.m3u8https://nicecrew.tv/videos/embed/eekYn1D4WaYRF2vd2R2KQN196002024-12-14T20:20:55.312ZDrawingAngelYESDreamy's LoungeNOhttps://nicecrew.tv/w/woX8APpZLQysCfmJkQw3bphttps://nicecrew.tv/lazy-static/thumbnails/f2bcb0f2-46a4-4315-8034-46568c849d19.jpgSpeedpaint: Strawberry girl and grape girlAnyways I hope you enjoy this Speedpaint and subscribe if you want more speedpaints! :) Music: All Together Now by The Beatles, the music dose not belong to me and the rights belong their rightful owners and I give credit to the songs I use in my videos!https://nicecrew.tv/static/streaming-playlists/hls/f6267f9a-6c37-466d-8e35-ed82857351b3/c204943a-66a8-4c57-affd-f3fa530d2171-master.m3u8https://nicecrew.tv/videos/embed/woX8APpZLQysCfmJkQw3bp36002024-12-14T20:20:28.232ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/eLajTu3woRQ2drRwVLHcg2https://nicecrew.tv/lazy-static/thumbnails/97f9d0d9-8895-4114-9a07-9cd96e1219fb.jpgPiano, Clarinet: My clarinet RosieAnother piano song, it's about my clarinet Rosie crawls out of it case to see who's in the other old clarinet case, then he sees an angry gold and pink clarinet that tooted at him to go away. Then Rosie would visit the other clarinet sometimes when I'm gone!https://nicecrew.tv/static/streaming-playlists/hls/6f71468d-69d5-4f61-875c-aa5f8b0a803b/a02c46bc-98a6-45a1-8ef9-a9bad3c5f759-master.m3u8https://nicecrew.tv/videos/embed/eLajTu3woRQ2drRwVLHcg2375002024-12-14T20:23:28.950ZClarinetCreepyPianoElectric pianoHappyYESDreamy's LoungeNOhttps://nicecrew.tv/w/uVQBJ9gLHbnJ4aaYFDeKMKhttps://nicecrew.tv/lazy-static/thumbnails/557f1487-c184-474e-9c65-d2fe3c13d5cf.jpgSpeed drawing: Imagination deerA drawing based off of my other drawing on the right of the screen for a book cover for my new Wattpad story called Tiny world 《小さな世界》so I hope you guy like it, I've just started making the first chapter so please be patient once I'm done! :) Music: YouTube's soundtrackshttps://nicecrew.tv/static/streaming-playlists/hls/ea444350-a53d-44b2-9fd4-e7f5173385a1/aa662e2c-6675-4ad5-bb3c-c0141679f45a-master.m3u8https://nicecrew.tv/videos/embed/uVQBJ9gLHbnJ4aaYFDeKMK21002024-12-14T20:20:43.133ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/1XgyPLPoHEAPWTvoVjoM9fhttps://nicecrew.tv/lazy-static/thumbnails/78773104-691b-4472-9a24-ef1798c74d4f.jpgSpeed drawing: Cartoon frenzyI couldn't think,of what to draw so I wanted to draw the entire page, I hope you guys like the video and like, comment and subscribe to my channel for more videos! :)https://nicecrew.tv/static/streaming-playlists/hls/07b7800c-9a30-48d1-b6d2-fb8ce9f6eae2/8470655b-1e27-480c-9ef9-2add1726dab0-master.m3u8https://nicecrew.tv/videos/embed/1XgyPLPoHEAPWTvoVjoM9f29002024-12-14T20:20:52.801ZYouTube CaptureCartoonsRandomnessDoodlesPen and inkYESDreamy's LoungeNOhttps://nicecrew.tv/w/gzCcqsn7qtUXbALMvns4Kohttps://nicecrew.tv/lazy-static/thumbnails/45a70818-bb64-4b68-a4ec-741a52175efb.jpgI talk about: people exploiting deathes, criticism unwanted, and moreI'll be talking to you guy's about people harming others over criticism, people exploiting deaths, fame and people using 0% effort on their work...https://nicecrew.tv/static/streaming-playlists/hls/7e2aee73-fb52-40bc-9a69-4d84b5071800/adc06098-8bb6-4132-9a70-64a283fe2ba1-master.m3u8https://nicecrew.tv/videos/embed/gzCcqsn7qtUXbALMvns4Ko729002024-12-14T20:24:52.215ZTalkingFame is fakeCriticism helps youYESDreamy's LoungeNOhttps://nicecrew.tv/w/wEnvW2ZcUbqULr5RqF8Pp1https://nicecrew.tv/lazy-static/thumbnails/395d31e0-8763-40d0-b261-753a18227fd0.jpgDrawing :Niko-San and JetfreezeAnother drawing video because why not! I love drawing, do you? :3https://nicecrew.tv/static/streaming-playlists/hls/f84daecc-436d-43c4-8d68-d5585551c79a/cd6c46cc-e07e-41f9-bb8d-1addf159e907-master.m3u8https://nicecrew.tv/videos/embed/wEnvW2ZcUbqULr5RqF8Pp1320002024-12-14T20:23:57.926ZDrawingRandomNiko-SanUTAULIODJetfreezeYESDreamy's LoungeNOhttps://nicecrew.tv/w/kLwiTG1ymnxt9ywhbHC4hghttps://nicecrew.tv/lazy-static/thumbnails/014914f2-372a-41aa-a244-7253c2170552.jpgSpeed drawing: Beacked big eared monsterI dunno what to name this cute monster, I enjoyed making this pencil drawing though! :Dhttps://nicecrew.tv/static/streaming-playlists/hls/a01509e6-c468-4cd8-b360-fd0410446b8b/4061f3de-6d00-49e7-b6c7-43f6d7764d1c-master.m3u8https://nicecrew.tv/videos/embed/kLwiTG1ymnxt9ywhbHC4hg33002024-12-14T20:22:04.907ZMonsterDrawingPencilsYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/rAdgoEUjSHc33o8YnKJ56Bhttps://nicecrew.tv/lazy-static/thumbnails/4608dc9e-6050-4576-9912-29c37655dc6e.jpgI talk about: YouTube's futureI hope YouTube will fix their copyright issues like the other people but maybe they won't fix it. But I think YouTube will go nicely in the future!https://nicecrew.tv/static/streaming-playlists/hls/cf3b503f-fc32-4c48-8c47-6e69b67ed9b5/a0544906-829c-4675-9abd-32b459b428a9-master.m3u8https://nicecrew.tv/videos/embed/rAdgoEUjSHc33o8YnKJ56B381002024-12-14T20:24:33.468ZYouTubeFutureHopeYESDreamy's LoungeNOhttps://nicecrew.tv/w/5snJzthWjsoxctBCGG4ZTBhttps://nicecrew.tv/lazy-static/thumbnails/38d08522-d387-46d7-a693-d91fc7b7eb68.jpgI sing: ScissoriodI may have struggled a little in this song, but I tried my best to sing this song! I had a lot of fun doing it too! I love singing songs! ♪( ´▽｀)https://nicecrew.tv/static/streaming-playlists/hls/24134969-9524-4978-b74e-70ea5f01e82d/5d0a4153-1291-4431-a09e-1bf32d9109cf-master.m3u8https://nicecrew.tv/videos/embed/5snJzthWjsoxctBCGG4ZTB244002024-12-14T20:23:40.898ZSingingVocaliodYESDreamy's LoungeNOhttps://nicecrew.tv/w/8xYV7bEZABPDiRvTSG1NCjhttps://nicecrew.tv/lazy-static/thumbnails/47b7d41a-0f32-47ba-bb03-177646d66fbd.jpgSpeed drawing: Ghost friendsA drawing about two ghost girls named Misa and April aka Fly girl, hovering near the cities of Heaven, Sometimes Misa is a little concerned about April who is obsessed over flies. Music: Plus by Deadmau5https://nicecrew.tv/static/streaming-playlists/hls/3d271a5d-d0ed-4573-80b7-d3dafbce7eb2/07958742-aff7-438b-b3f5-50913a3ee691-master.m3u8https://nicecrew.tv/videos/embed/8xYV7bEZABPDiRvTSG1NCj57002024-12-14T20:22:48.101ZDrawingGhostCuteHeavenYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/fatN4ZhnUHzCZkvuTDDRvDhttps://nicecrew.tv/lazy-static/thumbnails/12a0cc86-dd14-4ef2-aa98-60a0f8bf44e1.jpgI have daily motionI'll put the link in the description here after this video is uploaded! V http://www.dailymotion.com/arlayna-sykes Music: Audiofile 12 by the Beatleshttps://nicecrew.tv/static/streaming-playlists/hls/72b2c396-16fc-433d-b58f-8563ce558913/61fb5fb3-acea-4f15-a8f4-5da8eeb493c6-master.m3u8https://nicecrew.tv/videos/embed/fatN4ZhnUHzCZkvuTDDRvD7002024-12-14T20:22:29.142ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/4ER3mwYjofwBKuKPc66G6hhttps://nicecrew.tv/lazy-static/thumbnails/f23d2778-283d-4c57-81db-e32d827f1a16.jpgSpeed drawing: Life of DadA drawing of my dad's life cycle ever since! I love drawing this! ^^ Music: YouTube's soundtracks I will also send this to Dailymotion after its uploaded! :)https://nicecrew.tv/static/streaming-playlists/hls/1db7e6cd-a51d-42f1-829a-df3cf0caa00a/7a36a699-8714-4003-ae2b-395431da4d3a-master.m3u8https://nicecrew.tv/videos/embed/4ER3mwYjofwBKuKPc66G6h30002024-12-14T20:22:48.144ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/dXvh8qX5MnviMTuXfMqsvShttps://nicecrew.tv/lazy-static/thumbnails/9d7020f1-595f-45d4-878f-dcec32d134d2.jpgSpeed drawing: TransgendersA speed drawing video I had fun making, and I hope you guys do too! ^^ Music: Edit your friends by Deadmau5https://nicecrew.tv/static/streaming-playlists/hls/68ed9d51-51a7-47a6-898d-2e8115c7e97c/953d21fd-e4ed-4ffe-ac96-9a57fe796274-master.m3u8https://nicecrew.tv/videos/embed/dXvh8qX5MnviMTuXfMqsvS39002024-12-14T20:22:51.455ZYouTube CaptureDrawingPhotoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/hpvXrbqWhL5qvU9GfpLX7Shttps://nicecrew.tv/lazy-static/thumbnails/aec50570-c78c-4317-8ff2-1a2e1ed69b20.jpgSpeed drawing: The clarinet twinsI hope you enjoyed this anime + instruments drawing! Please enjoy! ^^ Music: Act naturally by the Beatleshttps://nicecrew.tv/static/streaming-playlists/hls/84dac942-01c1-412c-ba61-a6aad8ca625a/4ccde0d2-c1d3-47fa-92f6-d7bcfe4f1a86-master.m3u8https://nicecrew.tv/videos/embed/hpvXrbqWhL5qvU9GfpLX7S35002024-12-14T20:22:58.451ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/vAcEiLmhxDUKaeZFHA3pZ1https://nicecrew.tv/lazy-static/thumbnails/a2aef262-50cd-4993-a2f5-358320c6b6cc.jpgSpeed drawing: Dove BoyI wanted to make another black and white painting for you guys! Sorry this is short but I hope you guys like it......wait... Music: Locally Sourcedhttps://nicecrew.tv/static/streaming-playlists/hls/ef9f7ecd-e6bd-444c-810d-ad3449225f76/2384856e-5df6-4619-8fea-ccd1588c9848-master.m3u8https://nicecrew.tv/videos/embed/vAcEiLmhxDUKaeZFHA3pZ127002024-12-14T20:23:10.985ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/uPT489Pn8Urc4VqC75WHQohttps://nicecrew.tv/lazy-static/thumbnails/3a2ef2f2-0869-4b4b-b8c6-a16a7f696684.jpgSpeed drawing: Pexy as a school girlAnother drawing of Pexy because why not, I hope you liked it! ^^ Music: Don't let me down by The Beatleshttps://nicecrew.tv/static/streaming-playlists/hls/e96f4d7f-3d3f-4b63-b3bf-ec36d693542a/30a14e23-e6ef-45c9-95a1-3507f78d072c-master.m3u8https://nicecrew.tv/videos/embed/uPT489Pn8Urc4VqC75WHQo35002024-12-14T20:23:19.056ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/6oR38LuimmsGk3P1MbtEZphttps://nicecrew.tv/lazy-static/thumbnails/f2b00afd-6991-4a6d-843a-d2418695f206.jpgSpeed drawing: Pink FlareAnother one color painting made with photoshop! ^^ I hope you guys like it! Music: I remember(vocal mix) by Dead mau5https://nicecrew.tv/static/streaming-playlists/hls/2bae46b7-6fbd-4807-a8c0-2482aee2dfd1/189a8176-2dce-4a47-b01f-374ec6789ff8-master.m3u8https://nicecrew.tv/videos/embed/6oR38LuimmsGk3P1MbtEZp31002024-12-14T20:23:19.010ZYouTube CaptureCutePaintingYESDreamy's LoungeNOhttps://nicecrew.tv/w/i93zeTHKSyJpzeb4ckqBrdhttps://nicecrew.tv/lazy-static/thumbnails/25c4de79-80e1-4c83-a26b-25651d30f1db.jpgSpeed Drawing: Electric Guitar BoyAnother speed drawing band off of another musical instrument and stuff, I hope you enjoy this video! Like comment and subscribe to my channel for more! Music: She said she said by The Bealteshttps://nicecrew.tv/static/streaming-playlists/hls/8acae4a2-97e3-4f94-ba1a-3bbef8743a32/815615ae-ab0f-4958-acbe-bbc90e873f75-master.m3u8https://nicecrew.tv/videos/embed/i93zeTHKSyJpzeb4ckqBrd28002024-12-14T20:23:33.076ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/ia4gDFqqd1rp1jiLJfpHk7https://nicecrew.tv/lazy-static/thumbnails/25b47f38-193e-4731-a00c-b79c766647c5.jpgI talk about: The view glitch and moreAnother I talk about video, if you're wondering about the reaction that I'll be posting! I'm having issues trying to find a video to react to and stuff but anyways I hope you enjoy this video! ^^https://nicecrew.tv/static/streaming-playlists/hls/8aef10f5-b0c2-4cd3-a88b-f159e5c13750/7f071304-6d28-4d41-b3f4-e0218d7d5b91-master.m3u8https://nicecrew.tv/videos/embed/ia4gDFqqd1rp1jiLJfpHk7390002024-12-14T20:26:04.487ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/vbu5RaHer6MxyL1eEBfKcWhttps://nicecrew.tv/lazy-static/thumbnails/63e50ff3-8421-4264-85c8-f33d1bf8444d.jpgSpeed drawing: Cloudy moodAnother black and white speed drawing, I like making black and white paintings! I wonder why I do? Music: Baby's in Black by The Beatleshttps://nicecrew.tv/static/streaming-playlists/hls/ec4fc416-0eee-4fdb-85e2-bc2acecdf620/b159de6e-3939-41c3-9931-98c5c5ebac35-master.m3u8https://nicecrew.tv/videos/embed/vbu5RaHer6MxyL1eEBfKcW27002024-12-14T20:23:37.743ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/beqCPnpJ77zvEtRwg5SoRShttps://nicecrew.tv/lazy-static/thumbnails/d52416b2-c72c-4e58-9c2c-2780648cf900.jpgSpeed Darwing: Ghost GirlAnother black and white painting with a little ghost girl floating around! I hope you guys enjoy this video! ^^https://nicecrew.tv/static/streaming-playlists/hls/52db3cc1-73a5-4691-b926-cdc8c747f1d4/a6d74e7c-a6a1-4ae9-a6d3-0b0643e5e335-master.m3u8https://nicecrew.tv/videos/embed/beqCPnpJ77zvEtRwg5SoRS21002024-12-14T20:23:43.038ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/kpmTDvt6ZpFfjcJB1kkvByhttps://nicecrew.tv/lazy-static/thumbnails/c8d5c015-045b-4980-af2a-7111e4042598.jpgSpeed drawing: Niko-Saniki-shoAnother painting with my Utauliod, I hope you guys like it everyone! Music: Blackbirdhttps://nicecrew.tv/static/streaming-playlists/hls/9d209d8e-5915-494d-bc46-1b3455a6810a/e7d99db5-1908-40b0-9ad2-c06b7730bffd-master.m3u8https://nicecrew.tv/videos/embed/kpmTDvt6ZpFfjcJB1kkvBy26002024-12-14T20:23:49.986ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/mDZ9FCtXG6Fgt5sz7U5s4thttps://nicecrew.tv/lazy-static/thumbnails/925c11c8-cdb6-46aa-baf2-c78011887232.jpg3ds drawing: Monochrome FlakesA drawing of my transgender anime bunny boy in black and white and one color! (No offense on Transgenders) like, comment and subscribe to my channel! ^_^https://nicecrew.tv/static/streaming-playlists/hls/a744832f-f975-4d20-b855-fbf39b8e8d51/a75a4d55-23c7-4cf5-94a6-bedc6bddca89-master.m3u8https://nicecrew.tv/videos/embed/mDZ9FCtXG6Fgt5sz7U5s4t169002024-12-14T20:25:16.193Z3DsCuteMonochromeRedColors 3DYESDreamy's LoungeNOhttps://nicecrew.tv/w/9QKvbrxPb9WbSAquzKwzNJhttps://nicecrew.tv/lazy-static/thumbnails/6ed94415-c789-4a6d-8ce1-88b9107a6651.jpgSpeed Drawing: Robot rabbit 2.0I wanted to draw a robot animal since I drew them on 3Ds! I hope you guys enjoyed and subscribe and like to my channel for more! ^^ Music: I forget by Deadmau5https://nicecrew.tv/static/streaming-playlists/hls/47979eb7-036d-4ecd-b385-b4ce40eb413a/9aaab983-1592-42fa-b308-9ea36fea5ed1-master.m3u8https://nicecrew.tv/videos/embed/9QKvbrxPb9WbSAquzKwzNJ32002024-12-14T20:24:22.847ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/wiXiMRq72veqpe5BYZEWMShttps://nicecrew.tv/lazy-static/thumbnails/1af8fdd9-7c15-4217-838b-88b6ec80568e.jpgSpeed drawing: Ragman and red stringA character I would draw for fun and stuff, I dunno was else to say see! Have a great day! ^^ Music: FML by Deadmau5https://nicecrew.tv/static/streaming-playlists/hls/f573e34b-cbde-416e-9db9-e14a43a8953c/6f5dc9f3-c455-4ef2-8112-c36f3af0cf0a-master.m3u8https://nicecrew.tv/videos/embed/wiXiMRq72veqpe5BYZEWMS22002024-12-14T20:24:29.430ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/oQvzmun67kBztzxsttoqdXhttps://nicecrew.tv/lazy-static/thumbnails/743e6e11-d204-4a1a-a681-3f0b0eccd64a.jpgSpeed Drawing: Three BlobsA little random painting to keep you entertained as usual! I hope you guys like this painting and that is all! ^_^ Music: Any time at all by the Beatles The music rights belong to their rightful owners!https://nicecrew.tv/static/streaming-playlists/hls/b8eefa4e-32f7-47d8-aeec-37d76076194f/cb51d4e6-d5aa-4dfe-9236-c767e383cc58-master.m3u8https://nicecrew.tv/videos/embed/oQvzmun67kBztzxsttoqdX21002024-12-14T20:24:34.110ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/mHWQqhfwxytPrMfz1gR45Xhttps://nicecrew.tv/lazy-static/thumbnails/035e9786-0ce5-4f28-9a62-2c2738d9f1f2.jpgColors 3D: Left handed doodleA 3ds drawing with my left hand who really hates me when I use it for drawing! ^_^ Like, comment and subscribe to my channel for more!https://nicecrew.tv/static/streaming-playlists/hls/a7d20f98-5846-4cde-93f9-75962cd9da63/85843e35-28d0-4019-a120-85a65675369e-master.m3u8https://nicecrew.tv/videos/embed/mHWQqhfwxytPrMfz1gR45X96002024-12-14T20:25:05.021ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/fg4QebUa7ZcDSSy27DzQFXhttps://nicecrew.tv/lazy-static/thumbnails/80f304ac-7345-4fe0-8d2e-5b354e5cce0a.jpgSpeed drawing: Angry SkylarkA little painting of one of my dark angel twins Skylark Nonnel and Silent Piano Nonnel! I hope you guys like the painting! Music: Misery by The Beatles. Edited: I dunno why the comments section is still disabled! I really don't know guys! :(https://nicecrew.tv/static/streaming-playlists/hls/737a7583-9f14-423a-9889-018125d3bc45/2920e94a-707e-4247-8625-07367c45cbf0-master.m3u8https://nicecrew.tv/videos/embed/fg4QebUa7ZcDSSy27DzQFX29002024-12-14T20:24:46.167ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/1ZkTfuNLcvQL53EeQ9h12qhttps://nicecrew.tv/lazy-static/thumbnails/e8b68953-df6c-46ed-9705-0edcb2bd38ae.jpgSpeed Drawing: Piano girlAnother anime character based off of the beautiful instrument, the piano! Music: Paperback writer by the Beatleshttps://nicecrew.tv/static/streaming-playlists/hls/0801a60b-0b21-4086-a7b1-31cd851be392/96678865-de64-45b6-b8fb-04b5475297fe-master.m3u8https://nicecrew.tv/videos/embed/1ZkTfuNLcvQL53EeQ9h12q29002024-12-14T20:24:54.305ZYouTube CaptureYESDreamy's LoungeNOhttps://nicecrew.tv/w/nYduegVTYXzkjeZVM7C4Jkhttps://nicecrew.tv/lazy-static/thumbnails/c133d3af-63e7-4d5c-9ef7-7b66be7f7107.jpg(Reupload) Drawing: The boy and the seaweed monsterSomething was wrong with the uploading of this video, I hope this glitch gets fixed soon! (-_-)https://nicecrew.tv/static/streaming-playlists/hls/b1e94218-68c6-4f75-bb7e-d64cf31780e3/81f8192f-e9ca-4391-88c8-e421a325ce1d-master.m3u8https://nicecrew.tv/videos/embed/nYduegVTYXzkjeZVM7C4Jk185002024-12-14T20:27:42.251ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/e2Sf9JwttuzfhsjhzA3sLVhttps://nicecrew.tv/lazy-static/thumbnails/5c86b02c-a807-4179-8bd5-eefa1eb27243.jpgDrawing: Hatsune MikuAnother hatsune Miku drawing! ^_^ I love drawing vocaliods!https://nicecrew.tv/static/streaming-playlists/hls/698982a3-02fc-490f-9b12-349c875914e5/654b7ea4-f434-43a3-bae4-caaffcb8be71-master.m3u8https://nicecrew.tv/videos/embed/e2Sf9JwttuzfhsjhzA3sLV167002024-12-14T20:26:17.906ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/ire42YqLFZmf8nEC21vJUvhttps://nicecrew.tv/lazy-static/thumbnails/bc130a8f-51d9-48df-a302-b7ee3c33f2cb.jpgSpeed Drawing Aaronosi and the breezeMy first screen captured video, sorry if I didn't add any music to the video but yeah, I may be able to add some after the video is uploaded! ^^https://nicecrew.tv/static/streaming-playlists/hls/8d30fec8-2e68-4f63-a401-9729374e02f5/39c96fff-2116-4eaf-8878-77ecfdb2a741-master.m3u8https://nicecrew.tv/videos/embed/ire42YqLFZmf8nEC21vJUv204002024-12-14T20:32:30.424ZDrawing (Interest)Hair (Quotation Subject)cuteanimeAnime (TV Genre)YESDreamy's LoungeNOhttps://nicecrew.tv/w/2ENKdhDhxyyTV9yBca9dbUhttps://nicecrew.tv/lazy-static/thumbnails/a8bc7fef-853b-42d8-bd86-7e8cd94e9438.jpgAnimating Flying CrowAnother screen recorded video, I was making a little animation because why not, I haven't animated in a while! ^^https://nicecrew.tv/static/streaming-playlists/hls/0d8435a6-56ba-40be-a31d-668763903598/79b3828d-63dc-455c-aeaf-def7241686ff-master.m3u8https://nicecrew.tv/videos/embed/2ENKdhDhxyyTV9yBca9dbU243002024-12-14T20:34:10.949ZAnimation (TV Genre)birdscrowYESDreamy's LoungeNOhttps://nicecrew.tv/w/4c4zMPp1rtdv9YkPf3HkxDhttps://nicecrew.tv/lazy-static/thumbnails/f908d1ed-850c-49f4-b4f4-13e779c8440a.jpgDrawing Virus Chan Error 50+ subs specialAnother drawing video because why not, I want to be more colorful with my paintings this time! ^^https://nicecrew.tv/static/streaming-playlists/hls/19d6ce27-ebc6-4654-a434-9568999b535f/6880b154-d79b-4600-a2ef-0d5a5ae4b29e-master.m3u8https://nicecrew.tv/videos/embed/4c4zMPp1rtdv9YkPf3HkxD353002024-12-14T20:41:05.092ZDrawing (Interest)Virus_ChanAnimal (Film Genre)PaintingComputerYESDreamy's LoungeNOhttps://nicecrew.tv/w/taHjBDVsDLzVZ6tT3joPzQhttps://nicecrew.tv/lazy-static/thumbnails/5647ccf6-ee5d-48fe-af07-8b93d52a8bb9.jpgDrawing DovemanAnother drawing video, sorry that this one is long! But I hope you guys like it! And you can send requests if you like! ^^https://nicecrew.tv/static/streaming-playlists/hls/dc01e716-6c67-4074-8ebd-5d7d1f5c6c56/3f931451-5118-43a5-9709-b8cad059391e-master.m3u8https://nicecrew.tv/videos/embed/taHjBDVsDLzVZ6tT3joPzQ810002024-12-14T21:01:34.152ZDrawing (Interest)YESDreamy's LoungeNOhttps://nicecrew.tv/w/xw1Za7q1qhGLq8zonUQHAchttps://nicecrew.tv/lazy-static/thumbnails/e7dbfdc1-8320-4fea-9fad-857f1fc2917a.jpgDrawing Hatsune Miku CherryAnother painting of Hatsune Miku because why not! I hope you guys enjoy this speed drawing video and that is all! ^^https://nicecrew.tv/static/streaming-playlists/hls/ff3c3808-3490-4684-964a-f8550edd2263/f310540e-e023-45c3-9f16-1fac3ddd412c-master.m3u8https://nicecrew.tv/videos/embed/xw1Za7q1qhGLq8zonUQHAc241002024-12-14T20:34:44.630ZHatsune Miku (Software)Drawing (Interest)VocaliodanimeblackandwhiteYESDreamy's LoungeNOhttps://nicecrew.tv/w/9rm5uufpodhmb7pLQC6JfJhttps://nicecrew.tv/lazy-static/thumbnails/ccff71f9-c0c5-4a5f-84fd-8063fb348ca4.jpgDrawing Don the DonkeyAnother drawing video on my computer, I enjoy making these and stuff! ^^https://nicecrew.tv/static/streaming-playlists/hls/445313a1-d442-44f1-8896-82fdba5470c6/aec842ea-6bcf-4a1c-b254-540f01783c0a-master.m3u8https://nicecrew.tv/videos/embed/9rm5uufpodhmb7pLQC6JfJ922002024-12-14T21:06:52.496ZDrawing (Interest)Donkey (Domesticated Animal)YESDreamy's LoungeNOhttps://nicecrew.tv/w/rdXGDM3jgUdbVa9a5fVX8ohttps://nicecrew.tv/lazy-static/thumbnails/f793f5e1-7155-4dbd-94be-8aebe6008d7d.jpgDrawing insane AngelAnother drawing with blood! I 'll have this as my profile pic until Halloween goes by! ^^https://nicecrew.tv/static/streaming-playlists/hls/cc43b7f8-1d01-4ec4-9937-a2f3d2baeb50/a9de86f0-86ea-42bc-9e65-87e54c734928-master.m3u8https://nicecrew.tv/videos/embed/rdXGDM3jgUdbVa9a5fVX8o351002024-12-14T20:43:44.545ZHorror (Film Genre)angelinsaneyandereYESDreamy's LoungeNOhttps://nicecrew.tv/w/eaf6KUbfybwg9M8v7eiuu1https://nicecrew.tv/lazy-static/thumbnails/9d573f55-c360-4f4e-aa36-a3d3a8bfb852.jpgDrawing Many MesAnother speed drawing but about clones! ^^ I hope you enjoy it!https://nicecrew.tv/static/streaming-playlists/hls/6a912f7b-fae5-47da-9454-1774bfdfa640/71089a12-322c-402c-8000-b7543a6cedde-master.m3u8https://nicecrew.tv/videos/embed/eaf6KUbfybwg9M8v7eiuu1224002024-12-14T20:41:33.836ZDrawing (Interest)YESDreamy's LoungeNOhttps://nicecrew.tv/w/i6cPXYjy8Sfobj74hErKj2https://nicecrew.tv/lazy-static/thumbnails/8838fbf7-fd8f-4dce-9526-192d51132594.jpgDrawing Insane Niko SanAnother painting of my Utaulfiod Niko-Saniki-Sho! I hope you guys enjoy it and give me some requests for more videos! ^^https://nicecrew.tv/static/streaming-playlists/hls/8a655d5d-71cb-4f41-babc-08da42c80129/e77a47b5-798b-4733-b365-a4bfee2615be-master.m3u8https://nicecrew.tv/videos/embed/i6cPXYjy8Sfobj74hErKj2928002024-12-14T21:11:24.920ZDrawing (Interest)yandereanimeutauloidbloodyYESDreamy's LoungeNOhttps://nicecrew.tv/w/ihGZyzGZZTPjHsEfrJULUihttps://nicecrew.tv/lazy-static/thumbnails/6d19f40a-cd53-4155-a79b-4f30d8384eda.jpgDrawing Youtube's insane futureAnother speed drawing video because why not, sorry for the lagging of videos I promise I'll make more faster videos this time though! ^_^https://nicecrew.tv/static/streaming-playlists/hls/8c008520-bf5b-4e80-93ec-6695aa84f9e9/eaee20d6-0689-4c91-833b-4a5ae3c88d58-master.m3u8https://nicecrew.tv/videos/embed/ihGZyzGZZTPjHsEfrJULUi175002024-12-14T20:40:00.906ZDrawing (Interest)YESDreamy's LoungeNOhttps://nicecrew.tv/w/aWA41tAUmGgM3wiu2MKdjGhttps://nicecrew.tv/lazy-static/thumbnails/2a3c7fa6-be17-4124-8682-df10ddad05cf.jpgColors 3D: Sweet school girlAnother 3ds painting, I enjoyed making this and I hope you guys enjoy the video! ^_^https://nicecrew.tv/static/streaming-playlists/hls/5081658f-f225-45cd-a1ad-ebf938dcc794/fe80a2e0-e462-4c48-aa04-248a7c37f2b9-master.m3u8https://nicecrew.tv/videos/embed/aWA41tAUmGgM3wiu2MKdjG205002024-12-14T20:39:08.451ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/qDNH8rkF652P3mHze2cp8fhttps://nicecrew.tv/lazy-static/thumbnails/c57df88a-69e2-4f8f-b897-940d719b1b21.jpgDrawing: Smooth ghostAnother airbrush painting because I love making these I'll have to admit....^^https://nicecrew.tv/static/streaming-playlists/hls/c7a2a201-cb11-4b82-afb5-36f65bc0fe88/b9b09dbe-d5d8-4b54-88c2-ac4f37725cde-master.m3u8https://nicecrew.tv/videos/embed/qDNH8rkF652P3mHze2cp8f417002024-12-14T20:54:26.109ZGhost (Character Species)Kyūdō (Martial Art)Drawing (Interest)YESDreamy's LoungeNOhttps://nicecrew.tv/w/xbh2k1dD6DxC2BjvVWQjBChttps://nicecrew.tv/lazy-static/thumbnails/261d9f22-57cd-4ca0-bba7-1dd016825811.jpgDrawing Skylark in Darknesshttp://rainbowdoodler209.deviantart.com/art/Skylark-in-Darkness-566412578?ga_submit_new=10%253A1444953767 the finished drawing here!https://nicecrew.tv/static/streaming-playlists/hls/fc7a9c51-61f9-4832-9270-4b6ec7dededa/9c68b8a2-41bb-45c5-bcae-ad4d04d5da7a-master.m3u8https://nicecrew.tv/videos/embed/xbh2k1dD6DxC2BjvVWQjBC308002024-12-14T20:51:46.243ZDrawing (Interest)YESDreamy's LoungeNOhttps://nicecrew.tv/w/mYLkmzaadZN1RXjoTBT8uDhttps://nicecrew.tv/lazy-static/thumbnails/510eb584-6ac7-4628-a200-7fd4b9d713ca.jpgDrawing Ghostie's heartA little drawing of a ghost character beacaue why not, I'm a huge fan of ghosts! ^^https://nicecrew.tv/static/streaming-playlists/hls/a9e3bef5-88ab-458a-826d-24e79885c801/9b9ca030-5270-4574-bff0-09ffc98f3817-master.m3u8https://nicecrew.tv/videos/embed/mYLkmzaadZN1RXjoTBT8uD492002024-12-14T21:01:23.577ZDrawing (Interest)ghostsanimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/tGcLmNvqsyKfP2x2Xnm4wxhttps://nicecrew.tv/lazy-static/thumbnails/1d8fb39b-ca76-4f71-8768-9a0b35bc43de.jpgDrawing: Cute deadly hedgehogAnother cute but dark drawing of an animal because why not! EDIT: sorry I uploaded the video with no description.....I'm so sorry... :(https://nicecrew.tv/static/streaming-playlists/hls/e043beb4-41a0-4d0a-85fd-7a3a1a85b3e7/bf26b2ad-ae11-4336-893c-20e357f30c60-master.m3u8https://nicecrew.tv/videos/embed/tGcLmNvqsyKfP2x2Xnm4wx417002024-12-14T21:00:00.456ZCuteHedgehogsBloodYESDreamy's LoungeNOhttps://nicecrew.tv/w/cMhrvWs7c56AFvgqborBiWhttps://nicecrew.tv/lazy-static/thumbnails/ff604854-a814-4b59-97f3-cfb74cc2aee2.jpgDrawing Max, the mind broken cat boyA little painting of Max who was mind broken because of his enemy Chris Leafill tourturing him to clear out Sam's sanity, now he works for him for the rest of his nine lives.....https://nicecrew.tv/static/streaming-playlists/hls/5f67205a-654a-4ecf-a084-5aa9324bcc04/9231c98e-c8d5-403c-849b-0f715d37676f-master.m3u8https://nicecrew.tv/videos/embed/cMhrvWs7c56AFvgqborBiW425002024-12-14T20:59:08.934ZDrawing (Interest)Cat (Animal)MindControlBrainYESDreamy's LoungeNOhttps://nicecrew.tv/w/jgbbQSQt1itd9e8YPmy97Whttps://nicecrew.tv/lazy-static/thumbnails/526182aa-17a3-4da3-a82a-0ab47527c6fe.jpgDrawing: Violet girlAnother anime painting on photoshop.....I dunno what else to draw for this video! I wanted to make anime girl painting because why not!https://nicecrew.tv/static/streaming-playlists/hls/93e2ee2b-d868-40d2-8d9e-a7c6cf46c9d2/a6de0235-bb5d-4711-878c-2498f42f3468-master.m3u8https://nicecrew.tv/videos/embed/jgbbQSQt1itd9e8YPmy97W487002024-12-14T21:04:37.845ZDrawing (Interest)animePaintingGraffitiArtistYESDreamy's LoungeNOhttps://nicecrew.tv/w/cv9ifcpPzdeZFVQniQBcKchttps://nicecrew.tv/lazy-static/thumbnails/64e6ee2e-ce51-4e97-b298-2988b9db7079.jpgDrawing: Unknownie's wingsAnother painting of Unknownie because why not, I haven't drawn her much here! I wanted to draw her again! ^^https://nicecrew.tv/static/streaming-playlists/hls/5d26353f-4edb-49a9-a205-bbf65af002ad/3b137d53-e3da-466b-b1f2-af919f7efb9b-master.m3u8https://nicecrew.tv/videos/embed/cv9ifcpPzdeZFVQniQBcKc311002024-12-14T20:54:40.946ZDrawing (Interest)childanimegirlcutesketchYESDreamy's LoungeNOhttps://nicecrew.tv/w/83Nj8mwdr2c8iMcK9nmUsphttps://nicecrew.tv/lazy-static/thumbnails/1152c2ef-2b96-4fbb-91dc-349aa6962e43.jpgSpeed Drawing: Pastel GirlAnother anime painting, I was in love with pastel colors when I first saw bright colors and cute but gothic anime art work! I liked bright colors now! I'm gonna speed this video up as as well since it's kinda long, origenally 15:00 minutes! ^^https://nicecrew.tv/static/streaming-playlists/hls/3913ffd0-3bef-4159-94c7-20af482826fb/fb14e5e0-b893-4b13-a6e6-daf2b1675db9-master.m3u8https://nicecrew.tv/videos/embed/83Nj8mwdr2c8iMcK9nmUsp900002024-12-14T21:20:15.233ZPastel (Visual Art Medium)Drawing (Interest)YESDreamy's LoungeNOhttps://nicecrew.tv/w/suR76CZ58uDWn5zjYg3qY7https://nicecrew.tv/lazy-static/thumbnails/381959eb-9d6f-4708-9776-38b050d5bce2.jpgDrawing: Colorful mAdnessI dunno, I was little bored and goofed around with brushes.... Just went crazy and made this painting! ^^https://nicecrew.tv/static/streaming-playlists/hls/d694b15d-2818-488e-adf2-2a8791ce4c56/51ab4202-d62a-4b9f-86a2-efb7d9f84fd2-master.m3u8https://nicecrew.tv/videos/embed/suR76CZ58uDWn5zjYg3qY71077002024-12-14T21:30:17.801ZDrawing (Interest)colorfulFine Art (Industry)YESDreamy's LoungeNOhttps://nicecrew.tv/w/quRfJ2eunficncrHyFoqFbhttps://nicecrew.tv/lazy-static/thumbnails/50d682d7-1e95-4ee2-9546-99adb1d87e1a.jpgDrawing: Self PaintingAnother pastel painting because why not, a new profile picture maybe, I dunno! :Thttps://nicecrew.tv/static/streaming-playlists/hls/c66281d6-4ab7-4ef2-98f0-8d8e8fc6bce0/3be1d6dc-3f1b-4a5d-a3b6-a13483fcf553-master.m3u8https://nicecrew.tv/videos/embed/quRfJ2eunficncrHyFoqFb952002024-12-14T21:36:21.808ZPainting (Visual Art Form)Drawing (Interest)Art (Quotation Subject)YESDreamy's LoungeNOhttps://nicecrew.tv/w/mdQn9HaiMZXwMQ9v7afdqfhttps://nicecrew.tv/lazy-static/thumbnails/84a38a86-04c8-4cbf-91df-87b7d82c7b6d.jpgDrawing: Worn Girly DollA little painting of a doll that's torn and old, from an abandoned home before it falls apart piece by piece!https://nicecrew.tv/static/streaming-playlists/hls/a3c18114-8477-49d7-a9d3-2a11af6b33ee/a2db16a6-b69b-4da4-9554-2c09eb21495e-master.m3u8https://nicecrew.tv/videos/embed/mdQn9HaiMZXwMQ9v7afdqf501002024-12-14T21:17:23.204ZDoll (Collection Category)Drawing (Interest)PhotoshopArtistPaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/mqoP1yUwVKx3ntTs9TqeXkhttps://nicecrew.tv/lazy-static/thumbnails/cfa5ee4a-9233-4860-8e77-4727ff04cf36.jpgDrawing: Concerned girlAnother drawing of a girl because why not, I just wanted to draw another anime girl because why not! Like, comment and subscribe to my channel! ^^https://nicecrew.tv/static/streaming-playlists/hls/a55eae60-61f4-4f7c-b07e-a41dd20b994d/096435ec-1add-4a0e-b57f-9f595c33e941-master.m3u8https://nicecrew.tv/videos/embed/mqoP1yUwVKx3ntTs9TqeXk579002024-12-14T21:25:10.514ZDrawing (Interest)animegirlcolorfulartYESDreamy's LoungeNOhttps://nicecrew.tv/w/hBv1Sb6vRqH1itiRWdELvjhttps://nicecrew.tv/lazy-static/thumbnails/59764fdb-f8c7-41cf-8d17-e5b238692469.jpgDrawing: Piano AngelAnother colorful abstract painting, sorry if it's sloppy but I hope you guys enjoy the video! ^_^https://nicecrew.tv/static/streaming-playlists/hls/868721af-a762-452a-a820-a82fba5ed904/d1c62709-9ca4-402c-8819-069f636d58ce-master.m3u8https://nicecrew.tv/videos/embed/hBv1Sb6vRqH1itiRWdELvj1060002024-12-14T21:42:30.793ZPiano (Musical Instrument)YESDreamy's LoungeNOhttps://nicecrew.tv/w/aRHeL3xRZoutNhfEcT7PRvhttps://nicecrew.tv/lazy-static/thumbnails/cf5cbca5-e953-4ad4-85a7-650239c80112.jpgDrawing:Pink and BlueA painting I created with just two colors, it was so fun to make to be honest! ^^https://nicecrew.tv/static/streaming-playlists/hls/4fd31b23-e16b-48d2-a4ac-78378b1d8253/b53e5f68-a111-4648-a54b-13a4cfcfccd9-master.m3u8https://nicecrew.tv/videos/embed/aRHeL3xRZoutNhfEcT7PRv792002024-12-14T21:37:30.210ZPink (Color)Blue (Color)Drawing (Interest)Color (Musical Group)animeYESDreamy's LoungeNOhttps://nicecrew.tv/w/3gf2sQarwxeuoiTkZM96mshttps://nicecrew.tv/lazy-static/thumbnails/4e34febe-8a13-4449-8cd6-4c91f86bd53a.jpgDrawing:FiriaAnother anime painting, I'll post a nicer version of the same character since I kinda forgot to save the last version...... -_- Here's the finished results: http://rainbowdoodler209.deviantart.com/art/Firia-572026580?ga_submit_new=10%253A1447457788https://nicecrew.tv/static/streaming-playlists/hls/125313c4-8077-4d18-a07d-8d134aacd746/407e8a60-ec41-49a6-b880-46778425bf54-master.m3u8https://nicecrew.tv/videos/embed/3gf2sQarwxeuoiTkZM96ms588002024-12-14T21:29:14.219ZDrawing (Interest)YESDreamy's LoungeNOhttps://nicecrew.tv/w/bN4ZhxKWzY25mRorx47C43https://nicecrew.tv/lazy-static/thumbnails/a4dcec59-b71d-4b46-8694-aa5765f07ec5.jpgDrawing:AqualinaI thought I wanted to finish this painting for a video because why the heck not, and also R.I.P for the people from Paris who died from an attack by a shooting..... -_-https://nicecrew.tv/static/streaming-playlists/hls/576a0eb9-3511-4048-ae51-d546adbed080/4e770192-1877-4a63-bb0b-468c1e0e54ee-master.m3u8https://nicecrew.tv/videos/embed/bN4ZhxKWzY25mRorx47C43489002024-12-14T21:27:00.728ZDrawing (Interest)YESDreamy's LoungeNOhttps://nicecrew.tv/w/i8q7H9YigiKxA4YqZVKTbbhttps://nicecrew.tv/lazy-static/thumbnails/61a1e926-90ed-4e32-ab08-0d6c408b0fa3.jpgDrawing : Yandere ChanA painting based off of the infamous character from the game called Yandere Simulator! Enjoy the video! "I must have Senpai": http://rainbowdoodler209.deviantart.com/art/Yandere-Chan-572475518https://nicecrew.tv/static/streaming-playlists/hls/8ab46ce8-c83f-4765-8063-a6bcad1ba722/ae011077-ea1d-4d9a-b360-1b1297e0271a-master.m3u8https://nicecrew.tv/videos/embed/i8q7H9YigiKxA4YqZVKTbb762002024-12-14T21:42:01.338Z얀데레Drawing (Interest)Anime (TV Genre)yandereYESDreamy's LoungeNOhttps://nicecrew.tv/w/qHTUN7Kd8UQG1kxbSB6TfFhttps://nicecrew.tv/lazy-static/thumbnails/a50dda8f-7248-4a52-95e5-db92b3d24984.jpgdrawing :Colorful LandsAnother colorful abstract painting because I like being messy with colors...! ^^ I hope you guys enjoy the video! Finished results: http://rainbowdoodler209.deviantart.com/art/Colorful-Lands-573157361https://nicecrew.tv/static/streaming-playlists/hls/c834d030-c93e-4185-ac9a-735b880dfdb7/74876e65-0e02-4a4b-9077-1b768d04f665-master.m3u8https://nicecrew.tv/videos/embed/qHTUN7Kd8UQG1kxbSB6TfF1024002024-12-14T21:50:53.911ZDrawing (Interest)artcutePaintingArtistYESDreamy's LoungeNOhttps://nicecrew.tv/w/8jNTqyHfBdHnyqLPTc9ix1https://nicecrew.tv/lazy-static/thumbnails/f16e3f85-318d-439b-8ad9-02d81bdcdf47.jpgDrawing: Green Virus ChanAnother digital painting of Virus-chan, She is a virus that is super intenligent and was created by a man who make viruses for a living and passed away by the age of 200, his name was Danny the virus maker. Virus-Chan will always be evil....https://nicecrew.tv/static/streaming-playlists/hls/3b5040dd-9b39-45ad-88f9-a72690d9fdfa/971d1f0c-a456-43f9-b6cd-973928d4bc5d-master.m3u8https://nicecrew.tv/videos/embed/8jNTqyHfBdHnyqLPTc9ix1686002024-12-14T21:40:00.909ZDrawing (Interest)Health (Industry)animePaintingDayYESDreamy's LoungeNOhttps://nicecrew.tv/w/kU4gSpA6LDKaeHrnVmE7L6https://nicecrew.tv/lazy-static/thumbnails/79404bd6-0109-4af3-931e-3ea8ad50f9f8.jpgDrawing: Lucyanna and the DoodlesAnother painting of Lucyanna, I haven't drawn Lucyanna a lot so I hope you guys enjoy the video and like, comment and sub to my channel! ^^https://nicecrew.tv/static/streaming-playlists/hls/a12253f8-7e2b-4291-a1a3-d3a410156ae5/8f9cd4eb-6c18-486a-869b-c39241f82099-master.m3u8https://nicecrew.tv/videos/embed/kU4gSpA6LDKaeHrnVmE7L6738002024-12-14T21:56:42.559ZDoodle (Hobby)Drawing (Interest)YESDreamy's LoungeNOhttps://nicecrew.tv/w/skxoTXMRiWLcC8yyvzqxuGhttps://nicecrew.tv/lazy-static/thumbnails/664c1864-d6dc-40b9-ae1c-bce622c421d9.jpgDrawing: MeikoA drawing of Meiko because why not, I hope you enjoy! ^^https://nicecrew.tv/static/streaming-playlists/hls/d54815a1-8841-4667-9830-220a7629c6cc/6d8d549f-6006-4dac-a795-d40ba79bcb59-master.m3u8https://nicecrew.tv/videos/embed/skxoTXMRiWLcC8yyvzqxuG805002024-12-14T21:54:08.101ZDrawing (Interest)YESDreamy's LoungeNOhttps://nicecrew.tv/w/tsSE53JQCBdB4WdbxM8YBxhttps://nicecrew.tv/lazy-static/thumbnails/fd718c4e-233b-49a4-bbbf-1dc80e70080f.jpgDrawing: Clarie the clarinetAnother drawing of one of the clarinet twins, I hope you guys enjoy this little video and yeah! ^^https://nicecrew.tv/static/streaming-playlists/hls/de674cc8-e367-4519-bda2-465ea61485b5/2fb67c1b-46e1-4040-9bbe-eb80e72186b6-master.m3u8https://nicecrew.tv/videos/embed/tsSE53JQCBdB4WdbxM8YBx545002024-12-14T21:48:15.395ZDrawing (Interest)Clarinet (Musical Instrument)Opera (Composition Type)YESDreamy's LoungeNOhttps://nicecrew.tv/w/5UCm41bdjA7GEcyZgG2Joihttps://nicecrew.tv/lazy-static/thumbnails/c9772117-eb7d-410d-88f4-f8996bc024c2.jpgDrawing: Yandere catgirlAnother yandere painting, there's a lot of blood in this drawing so I'll be a little messy here! I love yanderes! ^^ The finish results: http://rainbowdoodler209.deviantart.com/art/Yandere-catgirl-575399322https://nicecrew.tv/static/streaming-playlists/hls/27bda128-9c4e-4d80-a5e5-37a7f9ab213d/78a999ca-8bc1-41b5-a580-fa2954c120ae-master.m3u8https://nicecrew.tv/videos/embed/5UCm41bdjA7GEcyZgG2Joi844002024-12-14T22:00:27.971ZDrawing (Interest)CatgirlYESDreamy's LoungeNOhttps://nicecrew.tv/w/jZ47gaVyS4cJXQEHUtGKVrhttps://nicecrew.tv/lazy-static/thumbnails/8ac0fec9-8b15-4d55-a326-97f21cbd5bdf.jpgDrawing: Dream MonsterA creature I drew based off of a dream which was a little mean-spirited, and yeah! I hope you guys like this bloody painting! ^^ The finished painting: http://rainbowdoodler209.deviantart.com/art/Dream-Monster-575663755https://nicecrew.tv/static/streaming-playlists/hls/99bbce5d-afa5-4da2-8e36-d371765de1d7/ac835a98-437a-49f6-acef-b30594f20d68-master.m3u8https://nicecrew.tv/videos/embed/jZ47gaVyS4cJXQEHUtGKVr565002024-12-14T21:57:59.580ZDrawing (Interest)Dream (Quotation Subject)YESDreamy's LoungeNOhttps://nicecrew.tv/w/asjDabFweV7Usn2sKjgpVShttps://nicecrew.tv/lazy-static/thumbnails/14fcac09-9eee-4428-b71c-69d92bb15189.jpgDrawing: Pastel monsterI wanted to make another pastel painting since you guys really liked my other pastel paintings! I like that! ^^https://nicecrew.tv/static/streaming-playlists/hls/4c8f12dc-65e8-4ca3-812d-d82a9404e5c8/d1ab6e12-0e4b-4e95-aeb4-3d7e5f0d3cd5-master.m3u8https://nicecrew.tv/videos/embed/asjDabFweV7Usn2sKjgpVS700002024-12-14T22:03:10.213ZDrawing (Interest)Pastel (Visual Art Medium)YESDreamy's LoungeNOhttps://nicecrew.tv/w/iAe5tmB3svwYfy9GhaxpAxhttps://nicecrew.tv/lazy-static/thumbnails/be65fbc8-09ad-4f03-9a99-b91f37bbaace.jpgDrawing: Girl of darknessAnother airbrush painting because I like goofing around with because I wanna make something new!https://nicecrew.tv/static/streaming-playlists/hls/8e72b456-a960-4198-bc0e-7f582040aa77/a687bea2-eb5f-4dd8-bda7-5a495c065b2a-master.m3u8https://nicecrew.tv/videos/embed/iAe5tmB3svwYfy9GhaxpAx703002024-12-14T22:04:52.075ZGirl (Quotation Subject)Drawing (Interest)YESDreamy's LoungeNOhttps://nicecrew.tv/w/6b73CRxG9w63MtsnEJFaKyhttps://nicecrew.tv/lazy-static/thumbnails/62300e11-eb57-442e-b599-616dc5059e4c.jpgDrawing: Oka RutoI wanted to draw Oka Ruto, even though she's a shy girl who is the leader of the occult Club in the unfinished game called Yandere simulator! Hehehe! ^^https://nicecrew.tv/static/streaming-playlists/hls/29e6db4c-5789-4f32-be23-5526d65a47da/fa4f751c-9748-4687-8391-ac46b04dd1f8-master.m3u8https://nicecrew.tv/videos/embed/6b73CRxG9w63MtsnEJFaKy437002024-12-14T21:54:41.838ZDrawing (Interest)William Ruto (Politician)Politics (TV Genre)YESDreamy's LoungeNOhttps://nicecrew.tv/w/aMbuCQbrVq2ZMp6AuUCpKyhttps://nicecrew.tv/lazy-static/thumbnails/39ec1fae-10ca-4d42-a683-b01363f2c0d6.jpgDrawing: Saki & KokonaAnother drawing of the characters from Yandere simulator! ^^ Please enjoy! ^^https://nicecrew.tv/static/streaming-playlists/hls/4f312f3f-c2ed-4e00-a4e8-383a971f487a/6adc7f46-8a4d-4ea6-958c-608ab4e1c835-master.m3u8https://nicecrew.tv/videos/embed/aMbuCQbrVq2ZMp6AuUCpKy963002024-12-14T22:17:25.091ZDrawing (Interest)animecolorfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/2nWC5zwHH634JBnDifs8p5https://nicecrew.tv/lazy-static/thumbnails/88c756ed-e8a8-4eaa-bf59-aa1bbbded4c9.jpgDrawing: Moon GirlAnother anime painting, with a touch of airbrushing colors, I will make another airbrush painting because you guys want to see more! Sorry.... Like,comment and subscribe to my channel for more artwork!https://nicecrew.tv/static/streaming-playlists/hls/0b296b7c-406c-425f-9c7c-26b0cf72c686/08bd4b56-bc70-4c39-8f2b-dff8527dcc3e-master.m3u8https://nicecrew.tv/videos/embed/2nWC5zwHH634JBnDifs8p5568002024-12-14T22:03:30.561ZAnimecolorfulSailorDrawing (Interest)MoonYESDreamy's LoungeNOhttps://nicecrew.tv/w/k8tsU7rMrXVFq7s66ttWJQhttps://nicecrew.tv/lazy-static/thumbnails/18844ef7-0a3b-4f90-b65f-709e49187444.jpgDrawing: Rabbit monsterI wanted to draw another monster, inspired by Austen Menglar, who makes really awesome paintings! ^^https://nicecrew.tv/static/streaming-playlists/hls/9ae8c41d-a58c-411b-ad7d-c5386454d894/2ee91c35-fe57-497a-964f-302e29d2f358-master.m3u8https://nicecrew.tv/videos/embed/k8tsU7rMrXVFq7s66ttWJQ379002024-12-14T21:54:58.391ZDrawing (Interest)Rabbit (Domesticated Animal)YESDreamy's LoungeNOhttps://nicecrew.tv/w/m69gTQwYPeBLmV1G8Gtrj1https://nicecrew.tv/lazy-static/thumbnails/437136c3-7266-4aed-8ed7-516f0b6cf812.jpgDrawing: Shadow beingAnother creepy airbrush painting, and thanks for 60+ subs guys! ^^ Please enjoy this video!https://nicecrew.tv/static/streaming-playlists/hls/a2ae9752-749a-4b6f-b5b0-13fde1afdfb0/d07f501d-cbef-4a79-a804-75b648262f5b-master.m3u8https://nicecrew.tv/videos/embed/m69gTQwYPeBLmV1G8Gtrj1356012024-12-14T22:03:03.342ZcreepyDrawing (Interest)ShadowYESDreamy's LoungeNOhttps://nicecrew.tv/w/kmGX9zpLqXWa4trnpX8EoUhttps://nicecrew.tv/lazy-static/thumbnails/aa9e6bb0-c825-46b0-a5c2-98821c947ba9.jpgDrawing: Little dollyAnother painting of a doll, I hate them with a passion but I like to draw them....is that ironic? :)https://nicecrew.tv/static/streaming-playlists/hls/9cc1bf2d-2387-47cb-9f0b-5805a3f42630/964a5192-defc-429e-b61e-f5e6c54a19ff-master.m3u8https://nicecrew.tv/videos/embed/kmGX9zpLqXWa4trnpX8EoU531002024-12-14T22:06:21.611ZDollsdrawingcuteLittlePaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/2Fw4sHHqfQJo7FFyBAZUSehttps://nicecrew.tv/lazy-static/thumbnails/76f94c00-69cc-4316-b296-b257008b3e40.jpgDrawing: Pastel LadyI'll be making drawings more faster at some point though! Hehe, anyways this is for my subscriber "TSMB2" who makes really great Black MIDI's in the Black MIDI community! I hope you like it! ^^ Finished drawing: http://rainbowdoodler209.deviantart.com/art/Pastel-Lady-578055819https://nicecrew.tv/static/streaming-playlists/hls/0d9dabad-9cd1-429b-876f-80a1753bc719/fa118a4c-6a4b-439c-bd97-d604c2217692-master.m3u8https://nicecrew.tv/videos/embed/2Fw4sHHqfQJo7FFyBAZUSe857002024-12-14T22:18:42.887ZDrawing (Interest)Pastel (Visual Art Medium)animecutecolorfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/mouZA16fHnmAYyKgNpGwrnhttps://nicecrew.tv/lazy-static/thumbnails/8ea3d61b-6f65-4bcb-a6f2-696d88113377.jpgDrawing: Silverfish girlsA character a draw sometimes because why not! ^^ Finished painting: http://rainbowdoodler209.deviantart.com/art/Silverfish-girls-578591935?ga_submit_new=10%253A1450397495https://nicecrew.tv/static/streaming-playlists/hls/a51b00ed-c9c0-4844-9329-249231f55ea7/db7e9e00-ff51-4b66-ac33-99220b2f5e05-master.m3u8https://nicecrew.tv/videos/embed/mouZA16fHnmAYyKgNpGwrn485002024-12-14T22:09:12.672ZAnimecolorfuladobe photoshopsurrealYESDreamy's LoungeNOhttps://nicecrew.tv/w/vuMgJmzBhUjtzeQD7zMAWohttps://nicecrew.tv/lazy-static/thumbnails/343ed27f-402e-4c3f-bedc-bf50f193ee3b.jpgDrawing: Creepy StegosaurusAnother creepy airbrush painting and heres the finished results! ^^ Finished painting: http://rainbowdoodler209.deviantart.com/art/Creepy-Stegosaurus-578770220?ga_submit_new=10%253A1450482640https://nicecrew.tv/static/streaming-playlists/hls/eeddbefe-c440-42a1-ad39-26b6ebd85732/2c774a6e-553d-4d76-8f7f-5ea60740ca1f-master.m3u8https://nicecrew.tv/videos/embed/vuMgJmzBhUjtzeQD7zMAWo379002024-12-14T22:06:46.789ZCreepydinosaursadobe photoshophorrordarkYESDreamy's LoungeNOhttps://nicecrew.tv/w/7t2tQTCrzAie4ARJzGDHgbhttps://nicecrew.tv/lazy-static/thumbnails/b0a6656f-3453-4c7c-a1cc-8e74f6f2e21e.jpgFlash doodle #1I may end updating this to my other account, I wanted to make another flash drawing! ^^ Drawing based off of this flash drawing: http://rainbowdoodler209.deviantart.com/art/The-dark-lands-578943913https://nicecrew.tv/static/streaming-playlists/hls/345cd36b-ca70-4cc8-b04d-33b6601aef1c/39cb2317-577b-49e6-93ac-54d32ac81069-master.m3u8https://nicecrew.tv/videos/embed/7t2tQTCrzAie4ARJzGDHgb363002024-12-14T22:06:07.733ZdoodleYESDreamy's LoungeNOhttps://nicecrew.tv/w/2JADmgTjcoYrGnjhpojpy8https://nicecrew.tv/lazy-static/thumbnails/d492a4d0-3d53-4396-a4e3-5c7c51dc128d.jpgDrawing: SpiritI wanted to make this painting since I starting drawing this Coal lady spirit, I like making these paintings! ^^ Like, comment, and subscribe and give me suggestions for future videos! Finished painting: http://rainbowdoodler209.deviantart.com/art/Spirits-579139003https://nicecrew.tv/static/streaming-playlists/hls/0e0bba23-104a-44fc-b148-3db047f42713/b700aeb1-3e33-455a-96fe-8b314557cac6-master.m3u8https://nicecrew.tv/videos/embed/2JADmgTjcoYrGnjhpojpy8543002024-12-14T22:12:20.178Zhorrorcreepydarkwomanadobe photoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/bW4eLd9YPvtHPL6yQNxyg6https://nicecrew.tv/lazy-static/thumbnails/8531ffd3-40f7-4b92-8003-eb3cc13f9bba.jpgDrawing: 70+ Subs,TSMB2A painting to my Midi Subscriber, TSMB2! I hope you like it good sir!https://nicecrew.tv/static/streaming-playlists/hls/58878b93-d53f-44ea-aaf2-4b5f36d2f423/8bb53cb0-43b3-4849-a741-25f5e995e783-master.m3u8https://nicecrew.tv/videos/embed/bW4eLd9YPvtHPL6yQNxyg6512002024-12-14T22:07:23.842ZPianoBlack midiYESDreamy's LoungeNOhttps://nicecrew.tv/w/5dKAhst7REo5Rt5NEEwcwyhttps://nicecrew.tv/lazy-static/thumbnails/f761d365-b8a8-42fe-8e46-03f60f7fe4ac.jpgDrawing: Binary AngelAnother angel painting because their fun to draw honestly! ^^ Please enjoy! ^^https://nicecrew.tv/static/streaming-playlists/hls/222c5806-7e49-40a4-bea3-e358f5986cc8/e22ce24e-fc00-4bda-839d-38a3bd1ee53f-master.m3u8https://nicecrew.tv/videos/embed/5dKAhst7REo5Rt5NEEwcwy278002024-12-14T22:03:51.812ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/wU45veHGNrwkAVzN8MJ9RXhttps://nicecrew.tv/lazy-static/thumbnails/cd388871-abb9-4c01-9110-ba574128fafc.jpgFlash doodle #2Another flash doodle for fun! I'll also add this to my Back up channel! ArlaynaSykes2! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Chuna-the-cat-580403371?ga_submit_new=10%253A1451163113https://nicecrew.tv/static/streaming-playlists/hls/fa36bb85-f6f0-4adf-bf78-a67bd1157131/7c5939d2-4f05-45a9-8668-d61b9865c3bc-master.m3u8https://nicecrew.tv/videos/embed/wU45veHGNrwkAVzN8MJ9RX294002024-12-14T22:07:30.712Zadobe flashYESDreamy's LoungeNOhttps://nicecrew.tv/w/38dk4XFxNLt1u6WqC66T48https://nicecrew.tv/lazy-static/thumbnails/2711fa30-40f7-4594-8136-b861859aa4ae.jpgDrawing: New profile pictureA new profile picture for my other channel, I may end up making a new Lucyanna drawing for my main channel too! ^^https://nicecrew.tv/static/streaming-playlists/hls/113414e2-7383-4e15-9603-8eb4bf856f79/3f1b2507-6d97-41fa-85f0-8edc327d8150-master.m3u8https://nicecrew.tv/videos/embed/38dk4XFxNLt1u6WqC66T48407002024-12-14T22:07:25.845ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/o2urmDcxvnC9AcLwZeiAEahttps://nicecrew.tv/lazy-static/thumbnails/f2525a90-0788-493e-8b09-b5c90b18fd4b.jpgDrawing: Pastel AngelAnother pastel painting but with an anime angel, I like making these paintings! ^^ Finished painting: http://rainbowdoodler209.deviantart.com/art/Pastel-Angel-580614654https://nicecrew.tv/static/streaming-playlists/hls/b25e51be-df2e-4182-bcba-c47217537705/65a685df-a5e3-4835-a598-c69a3a8d8eae-master.m3u8https://nicecrew.tv/videos/embed/o2urmDcxvnC9AcLwZeiAEa397002024-12-14T22:15:01.862ZAngelsanimecutepasteladobe photoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/iMQ9AAaYDWdVEh386APMtthttps://nicecrew.tv/lazy-static/thumbnails/da559f5a-e927-4d92-bab5-9aeaabe3dd1f.jpgDrawing: XiaA little black eyed girl I ince drew on my 3ds, no color seen but a clock floor she would sometimes carry in her pale hands.....Xia Finished drawing: http://rainbowdoodler209.deviantart.com/art/Xia-580847914?ga_submit_new=10%253A1451343382https://nicecrew.tv/static/streaming-playlists/hls/90117fcf-88b0-4940-9544-50acf3f0abe5/25eab6bb-a9c4-4ecd-8d34-6ef847cb32ba-master.m3u8https://nicecrew.tv/videos/embed/iMQ9AAaYDWdVEh386APMtt575002024-12-14T22:23:05.738ZXiacutechildYESDreamy's LoungeNOhttps://nicecrew.tv/w/qBGWv5nkJqTA63TXzwtwrKhttps://nicecrew.tv/lazy-static/thumbnails/18a500d3-7902-4c9c-a4ca-04b94b215872.jpgDrawing: ChickensBok bok bok, bok bok bok bok! I dunno, I wanted to draw chickens! I think chickens are cute! Bok Bok painting: http://rainbowdoodler209.deviantart.com/art/Chickens-581002197?ga_submit_new=10%253A1451408029https://nicecrew.tv/static/streaming-playlists/hls/c75796fa-ac51-4fc5-b6b8-5d073b43b705/d3cea259-a4dd-4160-987d-7a25413a217c-master.m3u8https://nicecrew.tv/videos/embed/qBGWv5nkJqTA63TXzwtwrK719002024-12-14T22:28:47.809Zcutechickensanimeadobe PhotoshoppaintingsYESDreamy's LoungeNOhttps://nicecrew.tv/w/2zxNQyq8yRnfQ8A65G9hEdhttps://nicecrew.tv/lazy-static/thumbnails/16342f17-8f38-491f-82f4-912bedbbeea2.jpgDrawing: SheepgirlBaaa, I wanted to turn a sheep into a person! I think sheep are kind of cute, so are lambs! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Sheepgirl-581327594?ga_submit_new=10%253A1451526349 Like, comment ans sub for more drawings! ^^https://nicecrew.tv/static/streaming-playlists/hls/0cc84900-5f90-4995-99f1-d22e49ea4868/dccb31d2-3de5-4750-bf62-89a44e0421ac-master.m3u8https://nicecrew.tv/videos/embed/2zxNQyq8yRnfQ8A65G9hEd504002024-12-14T22:20:02.840ZSheepanimepaintingdrawingspastelYESDreamy's LoungeNOhttps://nicecrew.tv/w/8CeWv6JxjsytvARDuedM8Phttps://nicecrew.tv/lazy-static/thumbnails/eab3d0f8-aeac-4d93-a55c-69c99f143034.jpgDrawing: Monster dogAnother monster drawing, people seem to really like my monster cartoons... I don't blame them! ^^ Happy new years! ^^ Finished drawing: http://rainbowdoodler209.deviantart.com/art/Monster-Dog-581520824?ga_submit_new=10%253A1451601784https://nicecrew.tv/static/streaming-playlists/hls/3dbf5644-0b12-4ae5-9604-044fedbdfc09/471a9bbc-9517-4cdd-808e-7bea8d90d054-master.m3u8https://nicecrew.tv/videos/embed/8CeWv6JxjsytvARDuedM8P546002024-12-14T22:24:54.516Zmonstersdoodleadobe photoshopcuterainbowsYESDreamy's LoungeNOhttps://nicecrew.tv/w/hQiWtErycrnRZombJBJAADhttps://nicecrew.tv/lazy-static/thumbnails/24f3fd57-c548-4a55-8e01-9d8fe58889e2.jpgDrawing: The assassinA drawing based off of a Chinese movie of the same name, I kind of thought there's gonna be blood in the movie after I watched it! Finished painting: http://rainbowdoodler209.deviantart.com/art/The-Assassin-581814389?ga_submit_new=10%253A1451706064https://nicecrew.tv/static/streaming-playlists/hls/8850f998-4cbb-452e-b9c1-c51c88e2b321/8982a86f-780e-42e4-baa6-b3ac3292dfb1-master.m3u8https://nicecrew.tv/videos/embed/hQiWtErycrnRZombJBJAAD610002024-12-14T22:24:27.202ZChinesemoviesanimeShipayinYESDreamy's LoungeNOhttps://nicecrew.tv/w/vV9daXvFXTkgFeH5qh7y2Jhttps://nicecrew.tv/lazy-static/thumbnails/5e8d34b9-d09b-4003-b0f6-93ff706a9763.jpgI talk about: Animation errors and moreI talk about Vocaliod, Animation errors and video game glitches! :) This Drawing: http://rainbowdoodler209.deviantart.com/art/Angel-monster-581936361?ga_submit_new=10%253A1451760241https://nicecrew.tv/static/streaming-playlists/hls/f244801d-b82e-4a50-bfe1-35b6abbd6854/1ebec660-cbab-4d4a-ab78-10d4c01925c8-master.m3u8https://nicecrew.tv/videos/embed/vV9daXvFXTkgFeH5qh7y2J402002024-12-14T22:19:05.235Ztalkinganimeanime girlssurreal creaturesYESDreamy's LoungeNOhttps://nicecrew.tv/w/7JQv6scZuAk97sp1dCgG3rhttps://nicecrew.tv/lazy-static/thumbnails/0548e71f-7c79-4671-b896-576c97372414.jpgDrawing: Pig girlother animal based drawing because.....Piggies are cute little creatures! Oink oink painting: http://rainbowdoodler209.deviantart.com/art/Piggirl-582211077?ga_submit_new=10%253A1451858417https://nicecrew.tv/static/streaming-playlists/hls/3691f5e2-637d-41fc-81d4-2cfbcf968fc5/506b8ffd-be13-49c0-b3b3-e1fdb1aca8e9-master.m3u8https://nicecrew.tv/videos/embed/7JQv6scZuAk97sp1dCgG3r346002024-12-14T22:20:31.106Zdrawingdigtal paintingcuteanime girlshappyYESDreamy's LoungeNOhttps://nicecrew.tv/w/gp6po7LpGBuioVwUBBou5Ehttps://nicecrew.tv/lazy-static/thumbnails/76024ba3-bdbd-431a-9c14-d2cd937f5c75.jpgDrawing: New profile picture!A new profile picture, I wanted to show you the profile and I had fun making this drawing! I hope you enjoy it everyone and newcomers! ^^ Lucyanna profile painting: http://rainbowdoodler209.deviantart.com/art/Lucyanna-2016-582441685https://nicecrew.tv/static/streaming-playlists/hls/7cb28433-18f2-4c4a-9256-5fdf71d2b37e/044025c1-de31-4307-9229-f71dfcfd4e61-master.m3u8https://nicecrew.tv/videos/embed/gp6po7LpGBuioVwUBBou5E709002024-12-14T22:35:42.727ZCutepinkhappy2016YESDreamy's LoungeNOhttps://nicecrew.tv/w/bbkMM8MmTfN3uBKtN9etu2https://nicecrew.tv/lazy-static/thumbnails/15967e55-c111-473e-a7c5-dd6a9b6542b6.jpgDrawing: Raggy Moncha 22A drawing of Raggy Moncha, a female blue 22 year old troll monster who is best friends with Lucyanna KImsel, and will always hangout with each other for the rest of time! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Raggy-Moncha-22-583021770?ga_submit_new=10%253A1452210121https://nicecrew.tv/static/streaming-playlists/hls/526d0516-9d54-4ac5-842b-bbb7be51e7ad/d03933a2-bfd7-4882-81e6-68933583dc1b-master.m3u8https://nicecrew.tv/videos/embed/bbkMM8MmTfN3uBKtN9etu2933002024-12-14T22:42:51.321ZbluedrawingcutemonsterdigitalYESDreamy's LoungeNOhttps://nicecrew.tv/w/hLwHudsuDNFcLn7y9B97x6https://nicecrew.tv/lazy-static/thumbnails/db720477-a37d-496e-b1b5-2348a7cc334c.jpgDrawing: The Doll twinsAnother doll painting but stitched twin sisters who dislike each other! You guys can give me some more suggestions in the comments and yeah! Enjoy and like, comment and sub to my channel for more! Cute little dolly Drawing: http://rainbowdoodler209.deviantart.com/art/The-Doll-twins-583253989?ga_submit_new=10%253A1452310363https://nicecrew.tv/static/streaming-playlists/hls/87c9df97-89a9-43d9-b244-7252c9329553/90f1939d-4d92-4071-96a2-aa572da3e16d-master.m3u8https://nicecrew.tv/videos/embed/hLwHudsuDNFcLn7y9B97x6673002024-12-14T22:39:01.304ZDollscreepytwin sistersAdobe PhotoshopcolorfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/qiE8vzCgRfZe9JBXufjGPohttps://nicecrew.tv/lazy-static/thumbnails/89514a84-6b83-4d67-911a-bd8c44e40ee9.jpgDrawing: Robo NekogirlA little robot nekogirl drawing because I think robots are really impressive! I just hope robots won't rule the world or anything...hehe! Robot drawing: http://rainbowdoodler209.deviantart.com/art/Robo-Nekogirl-583393902?ga_submit_new=10%253A1452371997 You guys can also check out my other channel: Arlayna Sykes 2, if you want!https://nicecrew.tv/static/streaming-playlists/hls/c4d27855-be67-434d-86dc-f655ddf340cc/0c05f438-4f91-423f-b3d3-0a72b633da06-master.m3u8https://nicecrew.tv/videos/embed/qiE8vzCgRfZe9JBXufjGPo624002024-12-14T22:36:36.525ZanimerobotsAdobe PhotoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/j7TVpgUQSnpY1WfY11n3AQhttps://nicecrew.tv/lazy-static/thumbnails/843f2ce6-062a-4c4d-a6cd-8f3a2a0e88fa.jpgDrawing: Rotting Angel dollAnother doll painting but in portrait form, I hope you guys enjoy this drawing! I had fun making this portrait! ^^ My other channel: https://www.youtube.com/channel/UC4l6nUginohPZCSHYdDcdPg another dolly rotting: http://rainbowdoodler209.deviantart.com/art/Rotting-Angel-doll-583616321?ga_submit_new=10%253A1452456964https://nicecrew.tv/static/streaming-playlists/hls/92baf4ad-b0bf-46ed-8528-33289ab75674/d2565158-580d-4b38-902c-509403d85742-master.m3u8https://nicecrew.tv/videos/embed/j7TVpgUQSnpY1WfY11n3AQ592002024-12-14T22:37:10.947ZAngelcutecreepydolliesAdobe PhotoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/wE1Q4yafK8GBdmd3qxiVbDhttps://nicecrew.tv/lazy-static/thumbnails/09c94c03-0ff6-4d22-ae0b-08c779e869f2.jpgDrawing: Robot friendsA little drawing for fun, sorry it took me a long time! I got my retainer now, and it's gross and painful! Bleep bloop drawing: http://rainbowdoodler209.deviantart.com/art/Robot-friends-583859183?ga_submit_new=10%253A1452554894https://nicecrew.tv/static/streaming-playlists/hls/f840ef08-dc65-495b-9949-a2c4940ae5f5/7058446d-cce1-477a-982c-8ce2f5858cab-master.m3u8https://nicecrew.tv/videos/embed/wE1Q4yafK8GBdmd3qxiVbD348002024-12-14T22:31:54.569ZanimeAdobe PhotoshopcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/6p9tJDWJxNeZjMNmLpLvshhttps://nicecrew.tv/lazy-static/thumbnails/7ccb3210-8f06-4766-8c6a-c92467424034.jpgDrawing: Pink sweaterAnother Hatsune Miku, I love drawing Hatsune Miku because why not.....hope you enjoy it! Vocaliod drawing: http://rainbowdoodler209.deviantart.com/art/Pink-sweater-584068423?ga_submit_new=10%253A1452645411&ga_type=edit&ga_changes=1&ga_recent=1https://nicecrew.tv/static/streaming-playlists/hls/2bb9065e-d2d8-4a02-b1e1-1b1a4ba412d8/c5865bff-9f18-43b0-b00a-348b6340352d-master.m3u8https://nicecrew.tv/videos/embed/6p9tJDWJxNeZjMNmLpLvsh825002024-12-14T22:37:17.232ZanimeVocaliodDrawingpaintingYESDreamy's LoungeNOhttps://nicecrew.tv/w/nNqXwmQ4tkZWGVLXEs3D3phttps://nicecrew.tv/lazy-static/thumbnails/df270326-0eb3-499e-94e8-38485c26c854.jpgSpeed drawing: Holding a grudgeA pencil drawing about a cat girl who holds a grudge on the people who are really negative....! EDIT: The reason I made this is because my MacBook would randomly black out on me and yeah....it still works though but still, it's annoying...https://nicecrew.tv/static/streaming-playlists/hls/b08b8179-aa63-49cf-8e3e-87c6e9029f2f/fd1632d9-239c-47f4-b324-229a7fba610a-master.m3u8https://nicecrew.tv/videos/embed/nNqXwmQ4tkZWGVLXEs3D3p19002024-12-14T22:23:50.417ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/hV88H7emUtifZjkZsZ7K7Qhttps://nicecrew.tv/lazy-static/thumbnails/6665200f-e96f-454d-b228-758a764fc66e.jpgSpeed drawing: Chuna OXOXAnother speed drawing, don't worry! I'll still make drawing videos on my computer though! And I'll make another drawing based off of my pencil drawings! ^^https://nicecrew.tv/static/streaming-playlists/hls/88fd08c0-1db3-4b66-9f94-9c1069d50618/5257c25a-ef2d-4371-8626-a456c9c352d1-master.m3u8https://nicecrew.tv/videos/embed/hV88H7emUtifZjkZsZ7K7Q17002024-12-14T22:24:07.356ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/8TdLkrPomwLH1DuXsiAPY7https://nicecrew.tv/lazy-static/thumbnails/26b9c9c2-c0fd-47e7-93ad-81548bc73024.jpgDraiwng: Demon girlA little drawing I wanted to finish for a video! Please enjoy my subs! Drawing: http://rainbowdoodler209.deviantart.com/art/Demon-girl-584662215 Like, comment and subscribe to my channel for more....sorry for the wait! ^^https://nicecrew.tv/static/streaming-playlists/hls/3fd6c4ec-5bf9-4976-b9de-d33fbbeb46b2/449041ee-ce49-4308-8c42-934b92ab1561-master.m3u8https://nicecrew.tv/videos/embed/8TdLkrPomwLH1DuXsiAPY7854002024-12-14T22:43:50.924ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/hhaJrJozw8uJUEx1Z1WCRehttps://nicecrew.tv/lazy-static/thumbnails/796aba10-a294-442e-9e69-4539a880d4fe.jpgSpeed drawing: Ryth MelA character based off of TSMB2 vid, Ryth Mel. I wanted to make this character because why not! I have an active Imagination! Enjoy! ^^https://nicecrew.tv/static/streaming-playlists/hls/83d41dc6-43fc-4fb9-8076-de321f17a4c7/523d901f-f18f-481f-8e9d-1cbad2b47de6-master.m3u8https://nicecrew.tv/videos/embed/hhaJrJozw8uJUEx1Z1WCRe22002024-12-14T22:29:55.020ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/qMi17wnwi8ALcFfsjHoQn8https://nicecrew.tv/lazy-static/thumbnails/b164bba2-649b-40b9-8d3f-1ca7bcff8962.jpgDrawing: Pastel Angel 2Another drawing of a pastel angel, Doody doody do! Sorry, I'm being a little silly! ^^ Angel drawing: http://rainbowdoodler209.deviantart.com/art/Pastel-Angel-2-585252097?ga_submit_new=10%253A1453148184https://nicecrew.tv/static/streaming-playlists/hls/c8ae467a-8658-43d2-b068-802dfd110249/5fead6c5-de76-4b6b-85a3-5c641942f61b-master.m3u8https://nicecrew.tv/videos/embed/qMi17wnwi8ALcFfsjHoQn81095002024-12-14T22:56:56.383ZangelswingscolorfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/tM2rBs3NN5n6cEwoTZYcPWhttps://nicecrew.tv/lazy-static/thumbnails/eef14136-8f7d-4dea-a73a-56f1f5252aff.jpgDrawing: Lucy and Lennon beetleA suggestion by fernando suarez and a suggestion my best friend galbrkel18, I hope you guys like it! ^^ Drawing: http://rainbowdoodler209.deviantart.com/art/Lucy-and-Lennon-beetle-585500545?ga_submit_new=10%253A1453249134https://nicecrew.tv/static/streaming-playlists/hls/e0f01a14-29f3-4aa2-a1a0-3d3068e9f018/62b12a82-7a84-4b6b-8776-9cb71e0b18a8-master.m3u8https://nicecrew.tv/videos/embed/tM2rBs3NN5n6cEwoTZYcPW779002024-12-14T22:50:26.734Zcuteanimecolorfuladobe PhotoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/gnb83CJv7ZLgnybeYMauvZhttps://nicecrew.tv/lazy-static/thumbnails/8559f111-47d4-4bd1-a261-c899922f3586.jpgDrawing: Bunny girlA little drawing of Yuzuki Yukari as a rabbit, I hope you guys enjoy this video! ^^ Hop hop carrot!: http://rainbowdoodler209.deviantart.com/art/Bunny-Girl-585719282https://nicecrew.tv/static/streaming-playlists/hls/7c6defc8-3832-491e-a50c-426577133133/535819a8-d81c-4092-9577-3bcf0985acae-master.m3u8https://nicecrew.tv/videos/embed/gnb83CJv7ZLgnybeYMauvZ631002024-12-14T22:49:59.050ZcuteanimemonochromehappysurrealYESDreamy's LoungeNOhttps://nicecrew.tv/w/28RcMiA7xPjPfafRMkesXvhttps://nicecrew.tv/lazy-static/thumbnails/c72f8203-933e-497d-ab1c-9203beefe675.jpgDrawing: Ryth Mel 2Another Ryth Mel drawing, I hope you guys like it! ^^ Killer piano: http://rainbowdoodler209.deviantart.com/art/Ryth-Mel-2-585894051https://nicecrew.tv/static/streaming-playlists/hls/0931aae4-a6e7-40e8-8bd9-c69391be11d3/0bd977fc-793a-4199-8d3b-77f8a1315ca7-master.m3u8https://nicecrew.tv/videos/embed/28RcMiA7xPjPfafRMkesXv463002024-12-14T22:43:41.912ZanimeRyth MelpianocreepyYESDreamy's LoungeNOhttps://nicecrew.tv/w/c483XnenWTWn56uNgf1sb2https://nicecrew.tv/lazy-static/thumbnails/fd5e34cf-fd93-47d2-91e3-74322a6e427f.jpgDrawing: MothGirlA drawing of a moth girl and here small friends..... Drawing: http://rainbowdoodler209.deviantart.com/art/MothGirl-586137173?ga_submit_new=10%253A1453528739https://nicecrew.tv/static/streaming-playlists/hls/59841a13-f09e-437d-ac5f-a81afeb519ad/de31d99c-b556-44b3-94ff-4bbfb365d525-master.m3u8https://nicecrew.tv/videos/embed/c483XnenWTWn56uNgf1sb2710002024-12-14T22:53:25.095Zanimebugsdrawingadobe PhotoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/bqdM3aMj6Q4qeAix4KhB1Rhttps://nicecrew.tv/lazy-static/thumbnails/98bd16da-fdd8-48da-9ee2-5e8a0327eec6.jpgDrawing: Scissor GirlI loved how this painting turned out in the end, I hope you guys enjoy and subscribe to my channel for more videos! ^^ Snip snip, snip snip...: http://rainbowdoodler209.deviantart.com/art/Scissor-Girl-586335545https://nicecrew.tv/static/streaming-playlists/hls/545d1c62-c1f4-4c85-8d53-549b38bfa16d/b96ea9d8-b011-4c77-b185-a03ab693ef57-master.m3u8https://nicecrew.tv/videos/embed/bqdM3aMj6Q4qeAix4KhB1R861002024-12-14T22:55:50.692ZscissorsanimegirlsbloodyhorrorYESDreamy's LoungeNOhttps://nicecrew.tv/w/uvvzi21KH7XeSDas416fhmhttps://nicecrew.tv/lazy-static/thumbnails/bb5c803c-603a-443c-b8d9-1115386de6ea.jpgDrawing: Negative catgirlA negative drawing I would always draw on my 3Ds, I'll make more different video at some point! Like, comment and sub for more! Nya Nya: http://rainbowdoodler209.deviantart.com/art/Negative-Catgirl-586471667https://nicecrew.tv/static/streaming-playlists/hls/e6dead6d-57b3-4100-b66b-f9dbe141e554/a851e3e5-bf56-4ade-b649-a31557ec579b-master.m3u8https://nicecrew.tv/videos/embed/uvvzi21KH7XeSDas416fhm365002024-12-14T22:44:43.559Zdrawingnegativepaintingdigitaladobe PhotoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/hzyzC6FkzyGp5EMPzyJfi8https://nicecrew.tv/lazy-static/thumbnails/bbef8320-685c-4cca-9c8b-5b39ea82d21a.jpgSpeed Drawing: Three FriendsA little drawing I made at school when I was board! Please enjoy! *\(^o^)/*https://nicecrew.tv/static/streaming-playlists/hls/8641d746-98b0-4cd2-a379-b815b148fa49/9ce10534-e9a3-4a1f-b596-f11477b3c57e-master.m3u8https://nicecrew.tv/videos/embed/hzyzC6FkzyGp5EMPzyJfi813002024-12-14T22:42:48.878ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/wBg17AA7WBg8FHQpHJjUfDhttps://nicecrew.tv/lazy-static/thumbnails/75cc63a7-2e57-4342-ae4f-4a4ad1dfeed2.jpgShyloh being cuteAnother cat video for you guys to enjoy! 🐱https://nicecrew.tv/static/streaming-playlists/hls/f7de6fe1-a080-4064-8023-ee934fd84b71/21d5f37f-c562-41ea-a59a-9d040b7289b9-master.m3u8https://nicecrew.tv/videos/embed/wBg17AA7WBg8FHQpHJjUfD199052024-12-14T22:44:57.838Zcatscutefelinesso cutecute catsYESDreamy's LoungeNOhttps://nicecrew.tv/w/fPut3KphwMAQkYtzSja4MEhttps://nicecrew.tv/lazy-static/thumbnails/daeff308-a8b5-4f9a-a47e-af51ca28cde6.jpgSpeed drawing: Slime catAnother anime drawing but with a slime cat turning into a cat! ^^https://nicecrew.tv/static/streaming-playlists/hls/78017101-a98e-45ca-95fb-f579c7e9f14c/f6bf69f7-5554-4728-b67a-6570e1944195-master.m3u8https://nicecrew.tv/videos/embed/fPut3KphwMAQkYtzSja4ME13002024-12-14T22:42:52.903ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/oh4P5ebkkqZfJNKUATijDMhttps://nicecrew.tv/lazy-static/thumbnails/1006d145-ca5c-4624-b714-3c892cb90153.jpgDrawing: Poison Slime girlAnother little drawing about slime, expect she's really poisonous by taste! I hope you guys enjoy! ^^ Slime girl awaits: http://rainbowdoodler209.deviantart.com/art/Poison-Slime-girl-587147499?ga_submit_new=10%253A1453947817https://nicecrew.tv/static/streaming-playlists/hls/b4674cc1-2c8d-49da-9e21-1912dc7c85af/b0cf8d8a-23d8-49a9-82e0-028ccfeb3824-master.m3u8https://nicecrew.tv/videos/embed/oh4P5ebkkqZfJNKUATijDM231002024-12-14T22:47:30.688Zslime girlsanimetransparentadobe photoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/4kkfJpc4D2ozeMdHpHyJvohttps://nicecrew.tv/lazy-static/thumbnails/a1fc2c7f-ab16-4a20-a70e-8e385d2813b3.jpgDrawing: FlamingoThe way I drew the flamingo, it just looks kind of funny looking! But I really tried with this bird drawing, then I added some other stuff! Enjoy! ^^ Flamingo Drawing: http://rainbowdoodler209.deviantart.com/art/Flamingo-587317850?ga_submit_new=10%253A1454028948https://nicecrew.tv/static/streaming-playlists/hls/1afe69cd-f2c5-4c24-8fca-d61eebd99dc0/73f8ec49-b6fe-4ee7-b60b-8391871bfa5b-master.m3u8https://nicecrew.tv/videos/embed/4kkfJpc4D2ozeMdHpHyJvo556002024-12-14T22:57:43.626ZpinkbirdsflamingossurrealabstractYESDreamy's LoungeNOhttps://nicecrew.tv/w/o5jKg1aFcffTQjTHbq5fNXhttps://nicecrew.tv/lazy-static/thumbnails/a0021bda-2cc8-4895-a850-aa32275cdab1.jpgColors! 3D: Embarressed FlamingoAnother drawing but on the 3ds, I hope you guys enjoy it too! ^^https://nicecrew.tv/static/streaming-playlists/hls/b2c39400-9055-4adc-bb92-3adacf1822bb/f2b37286-f459-4311-9ac5-d8944a31277d-master.m3u8https://nicecrew.tv/videos/embed/o5jKg1aFcffTQjTHbq5fNX57002024-12-14T22:44:11.256ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/7GoWEivCzEuEgHq2j8pPoBhttps://nicecrew.tv/lazy-static/thumbnails/fca5cc1b-175d-428d-9702-adfe58e60b11.jpgDrawing: Dragon cartoonA little cartoon I drew for fun, I think I'm running out of ideas for new videos now.........aw man... Cartoon: http://rainbowdoodler209.deviantart.com/art/Dragon-cartoon-587563782?ga_submit_new=10%253A1454133866https://nicecrew.tv/static/streaming-playlists/hls/363ab8b6-1c8e-4594-bd9a-e4d0a1f5b243/6221bf78-4e27-49c0-a700-e4601a6393ef-master.m3u8https://nicecrew.tv/videos/embed/7GoWEivCzEuEgHq2j8pPoB494002024-12-14T22:56:14.046ZcartoonscutecolorfulhappyfearfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/9PUXxUeAiVcNd1nif4u77fhttps://nicecrew.tv/lazy-static/thumbnails/9006afd4-da1f-49ad-ad31-3d9a649ccfe5.jpgDrawing: Rose Quartz from Steven universeRequested by @TheWattpadReviwer, I hope you enjoy it! ^^ Finished results: http://rainbowdoodler209.deviantart.com/art/Rose-Quartz-587654985?ga_submit_new=10%253A1454179191https://nicecrew.tv/static/streaming-playlists/hls/4779b3ed-dead-43ae-8d4f-a68b409a0152/e7e3a941-0719-42d2-b5a3-c913efd09ea2-master.m3u8https://nicecrew.tv/videos/embed/9PUXxUeAiVcNd1nif4u77f508002024-12-14T22:57:34.573ZpinkSteven universecartoonsanimepastelYESDreamy's LoungeNOhttps://nicecrew.tv/w/jXkLiQxRmLZgwST5BFx5cQhttps://nicecrew.tv/lazy-static/thumbnails/b337081e-67fd-4a8c-84a5-bad51c1f5ad0.jpgDrawing: Luka in a blue dressA drawing of Luka in a blue dress, I love the vocalized gang sing great songs! I hope you like the video and like, comment and sub to my channel for more! Luka in the dress: http://rainbowdoodler209.deviantart.com/art/Luka-in-a-blue-dress-587931134https://nicecrew.tv/static/streaming-playlists/hls/997e954b-4adc-4e87-bf2f-44c3e87306e6/3f0cac6a-dcf0-4eaa-b147-5d3f7ce7ee74-master.m3u8https://nicecrew.tv/videos/embed/jXkLiQxRmLZgwST5BFx5cQ715002024-12-14T23:02:51.715ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/nHoGSc98DgcjNRoQQMqzSThttps://nicecrew.tv/lazy-static/thumbnails/52f0564c-6276-4300-8c0a-a652060b42f3.jpgSpeed drawing: YufuA little drawing of a manderin character I made at school, I hope you guys like this cartoon! ^^https://nicecrew.tv/static/streaming-playlists/hls/afd7660c-1074-431c-871b-33e28a074abb/690bf028-5150-4b1d-bc6b-9bec27672fc4-master.m3u8https://nicecrew.tv/videos/embed/nHoGSc98DgcjNRoQQMqzST15002024-12-14T22:48:20.289ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/56AksfMgHvzf9UY1THmRWNhttps://nicecrew.tv/lazy-static/thumbnails/875272b5-6623-430f-9120-5a0fb91d5ded.jpgDrawing: BullGirlA little drawing for fun because why not! ^^ Thank very much fro the positive feedback everyone and passerbys a well! Drawing: http://rainbowdoodler209.deviantart.com/art/Bullgirl-588732013?ga_submit_new=10%253A1454627079https://nicecrew.tv/static/streaming-playlists/hls/212c6ef5-0848-47e4-9d45-684a74de21de/bb28be92-26c1-48e2-8fe4-30be4d356387-master.m3u8https://nicecrew.tv/videos/embed/56AksfMgHvzf9UY1THmRWN527002024-12-14T23:01:21.929ZanimebullsfantasyAdobe photoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/iS56iABquLiwENNY7f7h6Yhttps://nicecrew.tv/lazy-static/thumbnails/c8d805a1-b427-4cfb-bbd5-141daef754f4.jpgSpeed drawing: Niko-San and LucyannaAnother drawing of Niko-San but with Lucyanna, O hope you guys enjoy the video and like, comment and sub for more! ☆*:.｡. o(≧▽≦)o .｡.:*☆https://nicecrew.tv/static/streaming-playlists/hls/90a91131-4332-4b3a-b474-d31d682e142a/4b197ccf-dd99-470b-9841-8cabf3c45c65-master.m3u8https://nicecrew.tv/videos/embed/iS56iABquLiwENNY7f7h6Y20002024-12-14T22:50:37.965ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/6Zh7Vdm9oRjwoJUZSNUoHUhttps://nicecrew.tv/lazy-static/thumbnails/75d9e6f6-3624-4003-aa41-d6a75b5141e6.jpgColors! 3D: Xia is NeutralAnother 3ds drawing because why not another one, and yeah it maybe remind you guys of the classic flipnote studio, I loved that program! :) And I miss it......https://nicecrew.tv/static/streaming-playlists/hls/307d05a4-79a4-4a74-b2dc-bb9db8577116/7f1a8cf7-e0a8-44b5-a146-0bb87542c4ff-master.m3u8https://nicecrew.tv/videos/embed/6Zh7Vdm9oRjwoJUZSNUoHU122002024-12-14T22:52:26.299ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/ktrio6BgJiHwoVwzh5zUDthttps://nicecrew.tv/lazy-static/thumbnails/4b29e5d7-fb4c-46dc-9abf-5875319c3ca8.jpgDrawing: Chibi GhostieA little transparent pencil drawing of Ghostie as a cutesy in pastel colors, if you guys have any requests, send them in the comments section! Enjoy the video my followers! BOO: http://rainbowdoodler209.deviantart.com/art/Chibi-Ghostie-589349127?ga_submit_new=10%253A1454873270https://nicecrew.tv/static/streaming-playlists/hls/9db24ecc-6aab-4960-bf2c-e3dac9aceb75/5e657340-bd7f-4763-b7a1-9ded7877469d-master.m3u8https://nicecrew.tv/videos/embed/ktrio6BgJiHwoVwzh5zUDt433002024-12-14T22:59:50.761ZanimecuteghostsAdobe Photoshopanime girlsYESDreamy's LoungeNOhttps://nicecrew.tv/w/6kjxMrV1ipo8i9cBBEgqFkhttps://nicecrew.tv/lazy-static/thumbnails/57321513-a7fd-46e1-86b7-aa37631ea51a.jpgSpeed drawing: Serious Slime girlAnother speed drawing I made in school, I hope you guys enjoy it! ( ´ ▽ ` )ﾉ and Like, comment and sub for more!https://nicecrew.tv/static/streaming-playlists/hls/2b30416a-d669-4f44-98cf-009f44c81e21/22356457-02d1-4fca-ba48-702ea56268ab-master.m3u8https://nicecrew.tv/videos/embed/6kjxMrV1ipo8i9cBBEgqFk9002024-12-14T22:52:28.285ZSlime girlsanimepen drawingcutedoodleYESDreamy's LoungeNOhttps://nicecrew.tv/w/oS2zCgAKuVKrsZpZKwrq2Xhttps://nicecrew.tv/lazy-static/thumbnails/8c83d235-d06a-4358-a9de-1352c27f80bf.jpgDrawing: TSMB2 vs Ryth MelA little present fro you guys, I finally have internet now! I hope you enjoy this 80 plus sub special and I'll speed the video up as usual! Thanks for 80+ subs guys! Piano battle: http://rainbowdoodler209.deviantart.com/art/TSMB2-vs-Ryth-Mel-590157453?ga_submit_new=10%253A1455228023https://nicecrew.tv/static/streaming-playlists/hls/b925366b-3689-42a5-9d3a-ae39221d5239/e5d7c37f-eb09-4354-ad88-b860d976d026-master.m3u8https://nicecrew.tv/videos/embed/oS2zCgAKuVKrsZpZKwrq2X1639002024-12-14T23:26:33.598ZPianosBlack MidianimebattlecolorfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/aToXTcvBSLWiGdXAShNR1bhttps://nicecrew.tv/lazy-static/thumbnails/47cc3e08-be1e-463c-ac33-21322a7ff23d.jpgBlue Ghost, Red GhostA cute little flash animation with two ghosts, I just made this a few months ago so I wanted you guys to see it! Please enjoy this short animation!https://nicecrew.tv/static/streaming-playlists/hls/500f54fb-c5c0-4bbc-a06d-4eab6103a75e/382f98f2-8325-42e4-9318-6c2d7ae30925-master.m3u8https://nicecrew.tv/videos/embed/aToXTcvBSLWiGdXAShNR1b9002024-12-14T22:52:52.152ZGhostscuteanimationAdobe FlashOldYESDreamy's LoungeNOhttps://nicecrew.tv/w/8K2JTJMwTB76zpDqRXK49ghttps://nicecrew.tv/lazy-static/thumbnails/440a3e57-fd95-40f0-a467-b419573cffcc.jpgDrawing: School GirlAnother cute pencil drawing and I hope you guys enjoy it also! ^^ Cutesy drawing: http://rainbowdoodler209.deviantart.com/art/School-Girl-590361035?ga_submit_new=10%253A1455314671https://nicecrew.tv/static/streaming-playlists/hls/3eb20655-bdd7-40cc-b21d-edcea2963f93/c3b08976-6665-4b7f-a25d-bf24317148fd-master.m3u8https://nicecrew.tv/videos/embed/8K2JTJMwTB76zpDqRXK49g578002024-12-14T23:03:51.291Zcuteanimepencilsadobe Photoshoppastel colorsYESDreamy's LoungeNOhttps://nicecrew.tv/w/rnNpVFiJeC28deVgxbsXGXhttps://nicecrew.tv/lazy-static/thumbnails/31ecd3a1-18fd-4cf0-9529-088180bdf5e0.jpgDrawing: Angel GirlAnother pastel drawing, but transparent! I just wanna make another drawing video! And I like clarinets and pianos! I'm gonna upload a smaller version since the original is too big to publish.....Ugh.. Flutter flutter: http://rainbowdoodler209.deviantart.com/art/Angel-Girl-590678894?ga_submit_new=10%253A1455433325https://nicecrew.tv/static/streaming-playlists/hls/cd7fb03a-9a21-468c-b62f-c898c657f853/9306a551-3319-4cf7-9bcb-7989d08f2640-master.m3u8https://nicecrew.tv/videos/embed/rnNpVFiJeC28deVgxbsXGX1002002024-12-14T23:09:45.957Zanimeschool UniformgirlsangelsAdobe PhotoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/hG1GEC2jZHvZb77vuTuUSbhttps://nicecrew.tv/lazy-static/thumbnails/60b79f86-2436-41dc-af4f-6b2994b7d7f7.jpgDrawing: CupidA cute little cupid, I hope you like this Valentine's day drawing! ^^ And I'll make another video after this one is upload! Cupid: http://rainbowdoodler209.deviantart.com/art/Cupid-590818131?ga_submit_new=10%253A1455484196https://nicecrew.tv/static/streaming-playlists/hls/872866c5-6ff9-417f-8723-f147eea184fe/6c4fc0b2-36a6-4bc3-8ab8-7b9ce9b3491c-master.m3u8https://nicecrew.tv/videos/embed/hG1GEC2jZHvZb77vuTuUSb776002024-12-14T23:07:42.609ZCupidsanimeValentinesDaycolorfulheartsYESDreamy's LoungeNOhttps://nicecrew.tv/w/eEvtMhmKzhMXzeUvqjKquBhttps://nicecrew.tv/lazy-static/thumbnails/886faa39-bf08-42d4-a3d1-392f332eab7c.jpgStartledAnother flash animation test, that is all!https://nicecrew.tv/static/streaming-playlists/hls/6ea73b9f-b28e-4538-b009-6d14ce6afaf3/9d0f68cf-e982-4b0b-9dc6-fcfade6f54c6-master.m3u8https://nicecrew.tv/videos/embed/eEvtMhmKzhMXzeUvqjKquB15002024-12-14T22:56:50.458ZAdobe Flash CS6animelavendergirlemotionYESDreamy's LoungeNOhttps://nicecrew.tv/w/eWp2bNah4w69Nh1QuHcjMZhttps://nicecrew.tv/lazy-static/thumbnails/c5eb2d83-9ad8-4475-97d8-4dfd8aa6356e.jpgDrawing: Crow 2a little drawing of a crow fluttering her wings and leaking out oil, and that is all! I wanna make another creepy drawing! Caw! Caw!: http://rainbowdoodler209.deviantart.com/art/Crow-2-591290615?ga_submit_new=10%253A1455671020https://nicecrew.tv/static/streaming-playlists/hls/70df272c-18b0-450a-8ee9-b7b49d289bbb/345d6d67-8e4b-4586-8f0b-53d118d66acb-master.m3u8https://nicecrew.tv/videos/embed/eWp2bNah4w69Nh1QuHcjMZ490002024-12-14T23:05:40.446ZcrowssurrealanimalsAdobe PhotoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/uUWGVS39W9Vq9qzQmZhSykhttps://nicecrew.tv/lazy-static/thumbnails/ae9a8c33-68db-48c5-8095-12ff5a36246e.jpgDrawing: Kangamine RinA drawing of the young and cute, Kagamine Rin, I didn't get to finish recording after eating a burger, anyways I hope you lie the finished drawing after I post it! ^^ Ra ra ra: http://rainbowdoodler209.deviantart.com/art/Kagamine-Rin-591491434?ga_submit_new=10%253A1455763070https://nicecrew.tv/static/streaming-playlists/hls/ea2445a7-56db-4109-a75e-c4db351aea6b/c3e6d6f5-16f7-4a67-a1ef-e0aeaa924440-master.m3u8https://nicecrew.tv/videos/embed/uUWGVS39W9Vq9qzQmZhSyk766002024-12-14T23:10:02.616ZanimeVocaliodAdobe PhotoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/mq4UunE2Ac2CcthAgLcxwEhttps://nicecrew.tv/lazy-static/thumbnails/99bd5249-6517-4b09-a0d0-c2d62c56c546.jpgRed ScarfAnother little animation because why not, please enjoy this cute short animation!https://nicecrew.tv/static/streaming-playlists/hls/a55307bc-09ed-4fa1-8aa8-8a4f12e59ea6/6245b5fe-dc37-4c08-a2bb-778f9e370dbb-master.m3u8https://nicecrew.tv/videos/embed/mq4UunE2Ac2CcthAgLcxwE8002024-12-14T22:57:45.084ZAnime girlsAdobe Flashred scarfcuteshort animationsYESDreamy's LoungeNOhttps://nicecrew.tv/w/6Uw3nbPNg29AuiUqpZz1aehttps://nicecrew.tv/lazy-static/thumbnails/9f012aba-1660-496d-b2c4-6a98e720af39.jpgDrawing: Red Scarf GirlA cute drawing based off of the animation I last made! Please enjoy! Whoosh: http://rainbowdoodler209.deviantart.com/art/Red-Scarf-girl-591676119?ga_submit_new=10%253A1455845098https://nicecrew.tv/static/streaming-playlists/hls/2fd2e1f3-f7a2-4571-bcfd-f16578ac542f/4ff5d851-cee3-44eb-9b94-494b74ad9520-master.m3u8https://nicecrew.tv/videos/embed/6Uw3nbPNg29AuiUqpZz1ae445002024-12-14T23:05:22.315Zredanime girlscolorfulcuteanimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/sQFK1fqmCK6QCz1AVvELgRhttps://nicecrew.tv/lazy-static/thumbnails/aae11e95-d3ae-4f64-a5ff-ad2e6a746de9.jpgDrawing: TSMB2 the Destroyer of PiHere's another drawing of TSMB2 but summoned to destroy the evil villain Pi! Please enjoy the video, I'll speed it up as always too! ^^ Finished drawing: http://rainbowdoodler209.deviantart.com/art/TSMB2-The-destroyer-of-Pi-591874694?ga_submit_new=10%253A1455933548https://nicecrew.tv/static/streaming-playlists/hls/d959cc33-79c3-4977-87e7-fdbc4ea9d227/7eedfef7-3f01-494d-87de-f01fcd922682-master.m3u8https://nicecrew.tv/videos/embed/sQFK1fqmCK6QCz1AVvELgR1531002024-12-14T23:31:43.948ZTSMB2AnimeBlack Midipianospiano AngelYESDreamy's LoungeNOhttps://nicecrew.tv/w/cH2MVUko5ReF6iEL8GVizMhttps://nicecrew.tv/lazy-static/thumbnails/6fa1fc85-577b-4ec3-a277-63def19f4b51.jpgDrawing: Girl and the pigsRequested by @Carmine Crincoli, I hope you like this drawing and have a great night everyone! ^^ Oink Oinkity Oink: http://rainbowdoodler209.deviantart.com/art/Girl-and-the-pigs-592106246?ga_submit_new=10%253A1456023436https://nicecrew.tv/static/streaming-playlists/hls/5ecf1fc6-3a25-4a38-b53a-68a87651bc33/4b2d41f2-dadf-42fb-9260-3224609c28f2-master.m3u8https://nicecrew.tv/videos/embed/cH2MVUko5ReF6iEL8GVizM556002024-12-14T23:07:15.005Zpigsanime girlschildcutecartoonYESDreamy's LoungeNOhttps://nicecrew.tv/w/3taZE5yBfbASwjwUKbRBEFhttps://nicecrew.tv/lazy-static/thumbnails/8e3a7762-af25-4692-bee3-2df444c7df17.jpgDrawing: The Rainbow crewAnother pastel painting for fun, please enjoy and send me some requests for more, if you want! Finished drawing: http://rainbowdoodler209.deviantart.c...https://nicecrew.tv/static/streaming-playlists/hls/13fd84a7-6826-4d85-9074-2e7bf14f50d7/839df411-86f0-4664-876f-282fb0e1f6de-master.m3u8https://nicecrew.tv/videos/embed/3taZE5yBfbASwjwUKbRBEF888002024-12-14T23:15:39.622ZAnimemonstersuniformsanime girlscolorfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/8giocLfzhMKjQ9te7NMeg4https://nicecrew.tv/lazy-static/thumbnails/4b720aef-8453-48cd-9955-31ca9f0561cb.jpgDrawing: Ruby the Winged WolfA little furry character because why not, I wanted to make this drawing after I first drew her, I hope you guys enjoy the video, please tell me your thoughts about her or any critiques! I hope you guys don't mind! ^^ Enjoy! Woof woof: http://rainbowdoodler209.deviantart.c...https://nicecrew.tv/static/streaming-playlists/hls/3ad2d6f6-eed0-4c48-b42f-49947c0b26a5/fb9b4bea-84e6-4811-a019-7591d6380a60-master.m3u8https://nicecrew.tv/videos/embed/8giocLfzhMKjQ9te7NMeg4454002024-12-14T23:10:19.944ZFurrycuteconfusedanimewolfYESDreamy's LoungeNOhttps://nicecrew.tv/w/1vHCP3c9mNoXiMTEwXmqGnhttps://nicecrew.tv/lazy-static/thumbnails/313e87c2-269d-4c65-9806-45f55b1f0e70.jpgLovey DoveyAnother cute animation because why not! ^^ Please enjoy!https://nicecrew.tv/static/streaming-playlists/hls/04263a44-8cc3-45ec-8a08-19363300ded5/15285835-d59c-4845-bedc-3fc5d0ca7c4f-master.m3u8https://nicecrew.tv/videos/embed/1vHCP3c9mNoXiMTEwXmqGn8002024-12-14T23:04:22.386Zanimationpinkanimeschool girlAdobe FlashYESDreamy's LoungeNOhttps://nicecrew.tv/w/o7se1rKrjWTVK6hotoNKG1https://nicecrew.tv/lazy-static/thumbnails/a5d66fb5-0053-461d-8f5d-85a70ab914ed.jpgDrawing: Snake lady & Panda girlAnother request by Carmine Crincoli who gave me a truck load of requests which is really great too be honest! ^^ Here's your request Carmine! I hope you like it too! Hisss: http://rainbowdoodler209.deviantart.com/art/Snake-lady-and-panda-girl-593094464?ga_submit_new=10%253A1456453865https://nicecrew.tv/static/streaming-playlists/hls/b30faca6-cf33-4bc5-8309-3bae511d990c/4c2b8967-a6c9-4e7c-8639-dd57f75a4afd-master.m3u8https://nicecrew.tv/videos/embed/o7se1rKrjWTVK6hotoNKG1763002024-12-14T23:16:47.549ZanimesurrealanimalsmonstersYESDreamy's LoungeNOhttps://nicecrew.tv/w/i8dkK45cFMjxXyhKeTTCWbhttps://nicecrew.tv/lazy-static/thumbnails/1e61fa3f-a921-4a80-81ca-4c9a1084051f.jpgHappy Blue wolfAnother animation but with a blue wolf, please enjoy! ^^https://nicecrew.tv/static/streaming-playlists/hls/8aad2b2c-1d5b-414a-b437-5758bd35f55e/d83824ca-8e2d-44d8-a10e-8af0e120d51b-master.m3u8https://nicecrew.tv/videos/embed/i8dkK45cFMjxXyhKeTTCWb11002024-12-14T23:05:37.114ZcutewolfanimalsanimationsblueYESDreamy's LoungeNOhttps://nicecrew.tv/w/bR4pnUb6GBPq4Ra6AZCXUvhttps://nicecrew.tv/lazy-static/thumbnails/223902d3-d59b-42b9-95ba-4b548a429b85.jpgDrawing: Pastel smilesAnother pastel pencil drawing, please enjoy and have a great day! ^^ Finished drawing: http://rainbowdoodler209.deviantart.com/art/Pastel-Smiles-593473400?ga_submit_new=10%253A1456615002https://nicecrew.tv/static/streaming-playlists/hls/57d4edb4-dfc6-4745-ac0a-3600016ed8d1/d24fe240-8416-46b9-934b-8d21295ed58b-master.m3u8https://nicecrew.tv/videos/embed/bR4pnUb6GBPq4Ra6AZCXUv348002024-12-14T23:10:12.800Zangelscutepastel animeYESDreamy's LoungeNOhttps://nicecrew.tv/w/eAUWer6TvjcWZUNy8ywooxhttps://nicecrew.tv/lazy-static/thumbnails/a93bc839-f2d6-4149-b3bc-1d5f18102099.jpgDrawing: Safina the catAnother cute drawing of a humaniod animal, I hope you guys enjoy this painting, and sub to my channel and comment and last but not least, like my videos! ^^ Finished drawing: http://rainbowdoodler209.deviantart.c...https://nicecrew.tv/static/streaming-playlists/hls/6e26b68f-aaee-4b0a-abb7-a7941855a943/d036ef74-f623-48ca-b111-ae4e386e8fb8-master.m3u8https://nicecrew.tv/videos/embed/eAUWer6TvjcWZUNy8ywoox539002024-12-14T23:13:02.546ZAnthroSafina the catanimefurryathromonochromaticYESDreamy's LoungeNOhttps://nicecrew.tv/w/53yX3QvN7zrwSbU5WURjCahttps://nicecrew.tv/lazy-static/thumbnails/03afb7d9-9ba7-44f5-a4f5-40eed6e661ba.jpgDrawing: Creepy CrawleyA little drawing of a few bugs meeting face to face with a visitor.... Please enjoy! finished Drawing: http://rainbowdoodler209.deviantart.com/art/Creepy-Crawley-594088103?ga_submit_new=10%253A1456874619https://nicecrew.tv/static/streaming-playlists/hls/20c05909-2936-4f93-9b65-2458402f9661/47f6ebbe-3469-464a-b359-ca7ee39a4ee0-master.m3u8https://nicecrew.tv/videos/embed/53yX3QvN7zrwSbU5WURjCa585002024-12-14T23:19:41.740ZBugscreepyinsectsredmonochromeYESDreamy's LoungeNOhttps://nicecrew.tv/w/cHwF4YtAkmhBXHAgVJThndhttps://nicecrew.tv/lazy-static/thumbnails/56df3ebe-d2ba-4d85-a1cc-8d90e11e3102.jpgDrawing: Lonely CrawleyAnother drawing about this creepy crawley, I'm still thinking of a name for the big girl, enjoy the video! ^^ Finished drawing: http://rainbowdoodler209.deviantart.com/art/Lonely-Crawley-594297157https://nicecrew.tv/static/streaming-playlists/hls/5ee0ec50-92fb-4145-aec1-bcb63f741986/ad0429b3-36a6-438b-b20a-8bc6875a69a3-master.m3u8https://nicecrew.tv/videos/embed/cHwF4YtAkmhBXHAgVJThnd314002024-12-14T23:13:11.289ZcreepybugssurrealYESDreamy's LoungeNOhttps://nicecrew.tv/w/nYsgMHZZL1yGZpie2X4j6ahttps://nicecrew.tv/lazy-static/thumbnails/f5cf3f63-adfd-4b86-b555-d452d75c5aad.jpgDrawing: Safina and BalloonsAnother cute drawing of Safina the cat girl, I appreitate the likes and comments by the way! ^^ Enjoy this drawing video! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Safina-and-Balloons-594471685?ga_submit_new=10%253A1457053414https://nicecrew.tv/static/streaming-playlists/hls/b1f1c0f9-71d2-4167-80ee-b467acf904fb/c5c155ad-56d3-4f16-b6ae-76893e4789ca-master.m3u8https://nicecrew.tv/videos/embed/nYsgMHZZL1yGZpie2X4j6a303002024-12-14T23:14:16.574ZAnthroanimecuteblueAdobe PhotoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/jsJvGR9ZvnWEPgZmEiMTz1https://nicecrew.tv/lazy-static/thumbnails/df4ad2ed-acf0-4880-afd7-2a8dbf417dc7.jpgDrawing: Digital AngelAnother angel painting but with the pen tool, it's so fun to make too, please enjoy! ^^ Finished drawing: http://rainbowdoodler209.deviantart.com/art/Digital-Angel-594674629?ga_submit_new=10%253A1457145817https://nicecrew.tv/static/streaming-playlists/hls/9580086e-a87e-4602-a950-8cf32e9652fe/fb36d298-10fd-434d-a9c6-5647b3e62053-master.m3u8https://nicecrew.tv/videos/embed/jsJvGR9ZvnWEPgZmEiMTz1494002024-12-14T23:18:24.066ZAngelspastelmonochromecuteanimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/8Lqyvvgs1stzFM94itpBVKhttps://nicecrew.tv/lazy-static/thumbnails/a44a013a-429b-4655-9b34-2c130cb178f9.jpgSafina the cat girl - 90+ subs specialAnother animation, I hope you guys enjoy it! ^^ I'll probably make another piano angel video too!https://nicecrew.tv/static/streaming-playlists/hls/3ee3d51a-f605-471c-ba0b-672c33dbc7c1/1f191b3e-588c-4861-a350-018a5f07bdad-master.m3u8https://nicecrew.tv/videos/embed/8Lqyvvgs1stzFM94itpBVK11002024-12-14T23:13:09.697ZSafina the catanimeanthroanimationsAdobe FlashYESDreamy's LoungeNOhttps://nicecrew.tv/w/13W1c94iEGF3brM37Q4ew2https://nicecrew.tv/lazy-static/thumbnails/d30213d7-f7ff-41fd-9540-df9c2dc984f5.jpgDrawing: Virus Chan's awakeningI haven't drawn Virus_Chan in a long while so I thought I should draw her again! ^^ Please enjoy! Finished virus: http://rainbowdoodler209.deviantart.com/art/Virus-Chan-s-Awakening-595119048?ga_submit_new=10%253A1457316118https://nicecrew.tv/static/streaming-playlists/hls/0068c4ac-e29f-4718-bc84-b84bad6876d9/287df2da-6584-40e5-9e51-ae423b368478-master.m3u8https://nicecrew.tv/videos/embed/13W1c94iEGF3brM37Q4ew2306002024-12-14T23:21:26.327ZVirus_ChanredanimeAdobe Photoshop CS6Adobe PhotoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/3G7MuCg4KgxcBYYqAEjsL8https://nicecrew.tv/lazy-static/thumbnails/993c5fd3-c1d7-4d64-9f8c-c2d803270499.jpgDrawing: Plant girlA quick little drawing before I go to bed! Please enjoy the video everyone! Drawing: http://rainbowdoodler209.deviantart.com/art/Plant-girl-595509976?ga_submit_new=10%253A1457495204https://nicecrew.tv/static/streaming-playlists/hls/15cc358a-06a9-4ce9-b8e9-cea03bbc8217/5a8f79cb-37c4-496e-b437-fc3062072294-master.m3u8https://nicecrew.tv/videos/embed/3G7MuCg4KgxcBYYqAEjsL8272002024-12-14T23:18:18.959ZPlantgirlcutesurrealdoodleAdobe PhotoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/naGHacVUJa9ggEW5WLGUCHhttps://nicecrew.tv/lazy-static/thumbnails/bf9610d0-2af3-4a77-a4ae-4c669bc60786.jpgDrawing: Ice Donkey (Tutorial below)First you draw the mouth and eyes of the donkey, then you draw the body (any size you want) then the legs and the tail! I forgot to save again! Here's a nicer version! /)_- Eeha,Eeha: http://rainbowdoodler209.deviantart.com/art/Ice-Donkey-595658189?ga_submit_new=10%253A1457570141https://nicecrew.tv/static/streaming-playlists/hls/ab6ab1a9-7f0b-4082-b626-18ddb97aa061/8ec240f6-33ea-4ff0-8fcd-b6a67469e0bb-master.m3u8https://nicecrew.tv/videos/embed/naGHacVUJa9ggEW5WLGUCH535002024-12-14T23:34:23.500ZTutorialbluewinterYESDreamy's LoungeNOhttps://nicecrew.tv/w/kzbNrhNaBjYTw3Q1r3Yu6Qhttps://nicecrew.tv/lazy-static/thumbnails/925d2eca-d60f-48cc-9e0e-8c7dedf6f097.jpgShy SafinaAnother animation about Safina expect she show's her shy side of herself! Please enjoy! ^^ You can also see it in my Dailymotion! V Link:http://www.dailymotion.com/video/x3xahidhttps://nicecrew.tv/static/streaming-playlists/hls/9e7fd5c7-1642-4532-b784-66904c20f2c2/b0104d9b-0090-4190-8491-2fe4ed6d3aff-master.m3u8https://nicecrew.tv/videos/embed/kzbNrhNaBjYTw3Q1r3Yu6Q8002024-12-14T23:15:56.409ZPinkAdobe Flash CS6animationYESDreamy's LoungeNOhttps://nicecrew.tv/w/e63aAWCKQvPstx5Szs8pS9https://nicecrew.tv/lazy-static/thumbnails/38c383bd-3e33-451a-a78a-b2817f71ed0b.jpgDrawing: In the westYou guys may guess what game I'm referencing in this drawing, I'll give you a hint! It's made with MS paint the game is based in the western times! :) Finished drawing: http://rainbowdoodler209.deviantart.com/art/In-the-west-596281750?ga_submit_new=10%253A1457838570https://nicecrew.tv/static/streaming-playlists/hls/69fadb23-07f9-4e29-bde2-c6b40ad09d70/c4b44ada-4cdf-4aac-b983-69c30b0eed5b-master.m3u8https://nicecrew.tv/videos/embed/e63aAWCKQvPstx5Szs8pS9193002024-12-14T23:21:22.564ZHorseanimecuteAdobe Photoshop cs6Adobe photoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/gbx3zR5Zj37g9Pt3o33uSfhttps://nicecrew.tv/lazy-static/thumbnails/a770c1a3-0fe9-4789-b42f-848b7f380a5c.jpgDrawing: City in the nightI started this drawing last night and I wanted to finish it up for a video, I love drawing Safina so much, I promise I'll draw something different! ^^ Finished drawing: http://rainbowdoodler209.deviantart.com/art/City-in-the-night-596433733?ga_submit_new=10%253A1457899106https://nicecrew.tv/static/streaming-playlists/hls/7af1a644-508c-40e8-bbee-311658eb3882/30f2c7c7-e076-4440-a54b-6dddc880faaa-master.m3u8https://nicecrew.tv/videos/embed/gbx3zR5Zj37g9Pt3o33uSf1030002024-12-14T23:45:27.461ZSafina the catanimecitynight timecuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/woxD3MP3E8uvwi7VEopUMUhttps://nicecrew.tv/lazy-static/thumbnails/e0093aa8-69ff-402a-a138-3c06ee42fd11.jpgDrawing: Pi DayA drawing celebrating Pi day, the longest number ever existed! And math can be a fun drawing series, Happy Pi day everyone and have a great day! This video was originally mad yesterday... Pi drawing: http://rainbowdoodler209.deviantart.c...https://nicecrew.tv/static/streaming-playlists/hls/f6180554-5cdc-47ef-8e5c-78fa1f150fae/890e63df-c966-42f4-9e3b-ab59a92a43d3-master.m3u8https://nicecrew.tv/videos/embed/woxD3MP3E8uvwi7VEopUMU367002024-12-14T23:31:13.034ZPi DayArlayna SykescuteanimeAdobe PhotoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/4H1SLFbdX95MZw52KNXR1xhttps://nicecrew.tv/lazy-static/thumbnails/fddfeb41-4945-4769-bf25-c11fbc994a85.jpgVirus Chan's collarAnother flash animation but with Virus_Chan ripping the anti-virus collar off of her pale neck! Enjoy! ^^https://nicecrew.tv/static/streaming-playlists/hls/1e057333-6905-42fa-9b2f-7f15d8ff899b/d97beda9-cdcf-4311-8efc-5447861862fd-master.m3u8https://nicecrew.tv/videos/embed/4H1SLFbdX95MZw52KNXR1x9002024-12-14T23:18:55.094ZAdobe FlashVirus_Chan (Arlayna Sykes)shortJust for funanimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/odVCifT7dD9g9bJVSQULg2https://nicecrew.tv/lazy-static/thumbnails/d5f4e348-3a6f-4f9b-888f-f3b10250f8b1.jpgDrawing: Dean the devilA drawing of a devil boy who likes to hangout with his fiendish buddies! Please enjoy this painting and I'll probably make another video after this is uploaded! ^^ Drawing:http://rainbowdoodler209.deviantart.com/art/Dean-the-devil-597066528?ga_submit_new=10%253A1458174196https://nicecrew.tv/static/streaming-playlists/hls/b3f7061a-b82d-457a-8fe7-894655bfac37/35213c7c-737e-4d79-938f-a6329cca5aa1-master.m3u8https://nicecrew.tv/videos/embed/odVCifT7dD9g9bJVSQULg2321002024-12-14T23:28:02.588ZAdobe PhotoshopDevilsDean the devildevilscuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/omC8MSaAadboNT2q1vNBPzhttps://nicecrew.tv/lazy-static/thumbnails/6ff678dd-0015-4fd4-be95-e2acc5bff85b.jpgDrawing: Safina's happinessAnother drawing of Safina, hopefully this drawing will cheer me up since Youtube is falling apart with their awful copyright system....... Please enjoy the video everyone~ Finished drawing: http://rainbowdoodler209.deviantart.com/art/Safina-s-happiness-597089237?ga_submit_new=10%253A1458181314https://nicecrew.tv/static/streaming-playlists/hls/b50a31c9-f66d-4d0f-993c-22539068ac33/7338def9-4dd4-41e8-acee-e1b051c58cea-master.m3u8https://nicecrew.tv/videos/embed/omC8MSaAadboNT2q1vNBPz315002024-12-14T23:28:27.017ZHappinessAnimeAnthrocolorfulpastelYESDreamy's LoungeNOhttps://nicecrew.tv/w/9FRaCmSDvhioY161fc5cHfhttps://nicecrew.tv/lazy-static/thumbnails/19c5e0fe-7fbb-4d5a-ba88-1e84f4e2f351.jpgDrawing: Blue Slime bunnyAnother speed drawing of a slime girl but a bunny girl which I originally drew in my 3Ds, I hope you guys enjoy this video and have a great night! Hop Hop: http://rainbowdoodler209.deviantart.com/art/Blue-Slime-bunny-597472110?ga_submit_new=10%253A1458354322&ga_type=edit&ga_changes=1&ga_recent=1https://nicecrew.tv/static/streaming-playlists/hls/46596a79-e107-4075-b0e0-cace56f90574/938b0975-eec3-4da0-a046-b484ba678287-master.m3u8https://nicecrew.tv/videos/embed/9FRaCmSDvhioY161fc5cHf270002024-12-14T23:28:46.485Zbluecuterabbitsanime girlsHappyYESDreamy's LoungeNOhttps://nicecrew.tv/w/awUC9AiPAejvjuMvnRCBwGhttps://nicecrew.tv/lazy-static/thumbnails/b79787e0-9036-4e18-811b-65a4f097c14e.jpgDrawing: Negative thoughtsI hope I reach to 100+ subscribers at some point, I hope you guys enjoy my drawings so far, and stuff! Enjoy! Finished drawing: http://rainbowdoodler209.deviantart.c...https://nicecrew.tv/static/streaming-playlists/hls/4d32fdc3-9c75-40bd-82a3-03a561b3b870/6598525b-7e77-4be7-9978-cde64f5541a7-master.m3u8https://nicecrew.tv/videos/embed/awUC9AiPAejvjuMvnRCBwG385002024-12-14T23:34:39.999ZCutecreepyanime girlsAdobe PhotoshopanimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/syYLcZqp8FQcVsc7THPxJthttps://nicecrew.tv/lazy-static/thumbnails/ca8a1ff0-a487-4622-86be-68fa0f62ca83.jpgDrawing: Positive AngelAnother Angel painting, but based on my positivity, Please enjoy this video and comment, sub and like my channel! Be positive: http://rainbowdoodler209.deviantart.com/art/Positive-angel-597895620?ga_submit_new=10%253A1458516601https://nicecrew.tv/static/streaming-playlists/hls/d7286301-54ac-4f72-9956-1b3b0303e5c3/4f8104d9-9a59-4c3f-83cf-5e60f63db5b5-master.m3u8https://nicecrew.tv/videos/embed/syYLcZqp8FQcVsc7THPxJt409002024-12-14T23:35:40.620ZAngelanimeAdobe Photoshop CS6happycolorfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/cxq53bj5RH9KyTupFZKKtjhttps://nicecrew.tv/lazy-static/thumbnails/4f0f0a82-535d-4d61-b93b-75341d221a75.jpgZappy the sparkA year old animation I made based off of the blue ball of electricity, Zappy the spark! ^^ Enjoy!https://nicecrew.tv/static/streaming-playlists/hls/5d776a61-de84-4439-b548-d18df82e58a4/bac1c647-6497-40b2-8368-9d5cf7a3dc24-master.m3u8https://nicecrew.tv/videos/embed/cxq53bj5RH9KyTupFZKKtj19002024-12-14T23:28:00.933ZAnimationsanimepastelAdobe Flash CS6cuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/v1W8wpEFazyNqUdnLCHxSghttps://nicecrew.tv/lazy-static/thumbnails/719f8de2-6329-4738-b2c4-eaf9f35764ba.jpgDrawing: SadnessI wanted to draw sadness because why not, and I don't know what else to put in for the description, haha! *sigh* Sadness drawing: http://rainbowdoodler209.deviantart.com/art/Sadness-598469825?ga_submit_new=10%253A1458769911https://nicecrew.tv/static/streaming-playlists/hls/eafa6138-a1b8-483b-a802-106b49406e27/de004333-7337-4505-8895-5bab2662f2fc-master.m3u8https://nicecrew.tv/videos/embed/v1W8wpEFazyNqUdnLCHxSg397002024-12-14T23:40:52.458ZSadnessmonstersbluecutespeedpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/eXWWAhHLVocXywW4BuG9kShttps://nicecrew.tv/lazy-static/thumbnails/dec2053c-77b3-4684-9170-1474df24b986.jpgDrawing: MelachangA 19 year old demon who attempts to become human ends up failing, but would hide it's minion in her hair when others notice! Please enjoy! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Melachang-https://nicecrew.tv/static/streaming-playlists/hls/71169193-f8f5-4d2d-9139-a5f6ad114240/78fe59b3-d11c-44d4-a409-5d84feaa11f9-master.m3u8https://nicecrew.tv/videos/embed/eXWWAhHLVocXywW4BuG9kS344002024-12-14T23:40:19.078Zdemonsanime girlscolorfuladobe photoshopcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/xo3WdU7hgSBP6CkLbFHyAvhttps://nicecrew.tv/lazy-static/thumbnails/423b3c47-1790-472c-8c09-e991dcc2c12a.jpgDrawing: Shadow girl 2A little shadow girl drawing, please enjoy this video, sub and leave a like and a comment! ^^ Drawing: http://rainbowdoodler209.deviantart.com/art/Shadow-girl-2-599203664?ga_submit_new=10%253A1459055901https://nicecrew.tv/static/streaming-playlists/hls/fe1f7856-f3b5-4a4c-8d77-1ccb72dc86e9/4192403b-66b3-469d-a20c-3822ea3510f9-master.m3u8https://nicecrew.tv/videos/embed/xo3WdU7hgSBP6CkLbFHyAv221002024-12-14T23:37:24.623Zcuteanime girlshadowsadobe photoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/pyVoKJrJ25CDoi2eunYMBHhttps://nicecrew.tv/lazy-static/thumbnails/eb9e2500-840e-4add-9886-926b1c0837ec.jpgDrawing: 我爱你 "I love you"If you guys are wondering what "Wo ai ni" means, it means "I love you" in manderin, I hope you guys enjoy this drawing, I'm running out of ideas for more drawings! ^^" Happy easter, everyone! ^^ finished drawing: http://rainbowdoodler209.deviantart.com/art/I-love-you-599313140https://nicecrew.tv/static/streaming-playlists/hls/bedae4dd-302d-42cf-b5c9-a8a21fb41cbb/e3c3a8e4-781a-4c86-ba74-598df10a2837-master.m3u8https://nicecrew.tv/videos/embed/pyVoKJrJ25CDoi2eunYMBH176002024-12-14T23:35:08.653Z我爱你chineseanimeShipayinadobe photoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/mYJDVaLBevHXVcibRCPUQshttps://nicecrew.tv/lazy-static/thumbnails/1ced0b5b-2fb3-4ad2-9248-1cf356328463.jpgDrawing: Where are you going?Another drawing but with Yangchu who is asking Shipayin "where are you going?" Finished drawing: http://rainbowdoodler209.deviantart.com/art/Where-are-you-going-599545777?ga_submit_new=10%253A1459194487https://nicecrew.tv/static/streaming-playlists/hls/a9e2b5eb-1a97-42cc-9593-55b1c0f28f82/a11179f7-3ee0-49dc-b92a-ad1988bb9c35-master.m3u8https://nicecrew.tv/videos/embed/mYJDVaLBevHXVcibRCPUQs214002024-12-14T23:37:31.514ZYangchuanimehorrormonochromeBLack and whiteYESDreamy's LoungeNOhttps://nicecrew.tv/w/cRMzJE2VVvmEK5wT9BjViPhttps://nicecrew.tv/lazy-static/thumbnails/e18388ff-fa6b-4997-b26f-3aa5e0349da6.jpgDrawing: Sad YulkoonA drawing of a sad yulkoon, which is girl in tarreon language, I hope you guys enjoy this drawing and I may end up making a series of drawings of colorful yulkoon characters! ^^ Yulkoon drawing: http://rainbowdoodler209.deviantart.com/art/Sad-Yulkoon-599803514https://nicecrew.tv/static/streaming-playlists/hls/60080f88-87e1-4c5e-9c33-cd7f155e6d3d/3cb64401-1426-4c8e-8372-9d01a07c8595-master.m3u8https://nicecrew.tv/videos/embed/cRMzJE2VVvmEK5wT9BjViP361002024-12-14T23:41:30.116ZYulkoonanimecutebluecoldcolorsYESDreamy's LoungeNOhttps://nicecrew.tv/w/w7cLpP9LXyeUQLRcpdxuethttps://nicecrew.tv/lazy-static/thumbnails/943a7097-1c32-4484-857a-09cefbc6a8f2.jpgEating girlAnother little animation, I'll try my best on making a log animation this time, and I hope you guys have a great day! ^^https://nicecrew.tv/static/streaming-playlists/hls/f3cfdf8f-e816-4f3c-96c4-9fa129a03735/1f6861ee-8407-4b50-b366-10149506ebdb-master.m3u8https://nicecrew.tv/videos/embed/w7cLpP9LXyeUQLRcpdxuet15002024-12-14T23:36:10.302ZAnimefoodeatingAdobe Flash CS6pastelYESDreamy's LoungeNOhttps://nicecrew.tv/w/vgVDwN6uBby6dpyVHt5rmhhttps://nicecrew.tv/lazy-static/thumbnails/1d405b10-8603-49d2-a5a2-4c318f94d312.jpgDrawing: Wind chimesAn anime character based off of the beautiful wind chimes you would dangling on roofs of houses or on doors, clink clank clink goes the wind chimes.... enjoy! Clink clank clink: http://rainbowdoodler209.deviantart.com/art/Wind-Chimes-599974286?ga_submit_new=10%253A1459371332https://nicecrew.tv/static/streaming-playlists/hls/ed123d27-4839-4088-aeb2-cc24f810ab4c/6c339d6a-709a-4563-92a3-3b3c51cdb82d-master.m3u8https://nicecrew.tv/videos/embed/vgVDwN6uBby6dpyVHt5rmh201002024-12-14T23:40:27.843ZWind chimescuteanime girlscolorfulDigital artYESDreamy's LoungeNOhttps://nicecrew.tv/w/wiA3y6KmuxmXvjm6BNa1bKhttps://nicecrew.tv/lazy-static/thumbnails/13a34d34-5cca-4838-8048-2b8a732750ca.jpgDrawing: Favorite DollyA dolly version of Safina, I like drawing dolls, I just don't do it that much! So please enjoy the video! ^^ Little dolly: http://rainbowdoodler209.deviantart.com/art/Favorite-Dolly-600155939?ga_submit_new=10%253A1459450364https://nicecrew.tv/static/streaming-playlists/hls/f566c8c5-9d0b-435b-93e4-05b9da88bcd7/14b1764c-1d13-4330-9124-4e1b35244a0e-master.m3u8https://nicecrew.tv/videos/embed/wiA3y6KmuxmXvjm6BNa1bK284002024-12-14T23:42:33.696ZDollscuteanimeanthroSafina the catYESDreamy's LoungeNOhttps://nicecrew.tv/w/7xVAKz5hJUMW5ftqVQjugAhttps://nicecrew.tv/lazy-static/thumbnails/1470d94a-c85c-49a0-8de2-59bbb308fc60.jpgSD: charcoal girlAnother Speed drawing or "SD" video but drawn with charcoal pencil, please enjoy everyone! ^^ I'll also post this on my other channel as well!https://nicecrew.tv/static/streaming-playlists/hls/350beba4-eabf-45f6-979e-612d9668fee8/5d2e50a6-a390-4efc-a3ba-3c33854425b4-master.m3u8https://nicecrew.tv/videos/embed/7xVAKz5hJUMW5ftqVQjugA16002024-12-14T23:37:03.557Zanime girlsspeed drawingcutecharcoalpaperYESDreamy's LoungeNOhttps://nicecrew.tv/w/3LnA1UF9A5De5zfLYXyt23https://nicecrew.tv/lazy-static/thumbnails/2bb12bb5-61e8-446c-a6ff-5b804b3e10e4.jpgBEST DRAWING EVER MADE!!! 8DOkay, this was intended to be a joke, so yeah! Please enjoy this amazing speed drawing! I'll post another video after this too, or not I dunno! April fools! Herp a derp 8P: http://rainbowdoodler209.deviantart.com/art/Best-Drawing-Ever-Made-8D-600357374?ga_submit_new=10%253A1459534611https://nicecrew.tv/static/streaming-playlists/hls/16644e6c-3bbf-4eb6-b1b5-59337cf13c78/b15abb38-9174-4764-a6c9-53fc0925108b-master.m3u8https://nicecrew.tv/videos/embed/3LnA1UF9A5De5zfLYXyt23239002024-12-14T23:41:53.515ZCartooncutesillycolorfulAlphy_stickYESDreamy's LoungeNOhttps://nicecrew.tv/w/46LatWinyAyiwaCeZH9PSXhttps://nicecrew.tv/lazy-static/thumbnails/f07a0091-e9db-49d8-91bc-913af06d7fad.jpgDrawing: Pastel kittyI haven't made a pastel drawing in a long while, so heres another pastel drawing, I may end up making pastel goth drawings too at some point! I love drawing anime and cartoons, their so fun to make! ^^ Finished drawing: http://rainbowdoodler209.deviantart.com/art/Pastel-kitty-600647002?ga_submit_new=10%253A1459641526https://nicecrew.tv/static/streaming-playlists/hls/191959fe-8016-4875-9469-9f04e09f92d7/d24a91ba-6791-4634-97af-b825c5737c3a-master.m3u8https://nicecrew.tv/videos/embed/46LatWinyAyiwaCeZH9PSX397002024-12-14T23:44:45.035Zpastelcuteanimekittensneko girlsYESDreamy's LoungeNOhttps://nicecrew.tv/w/gPasR73Qf2aVBuLVPuu5d7https://nicecrew.tv/lazy-static/thumbnails/c9e49725-261e-4bd4-9190-4ce19c4d1e83.jpgDrawing: Tyna's pet monsterTyna brings her pet monster in class for show and tell, then awful things happened in the class room! Enjoy! Warning: Contains blood and gore! finished drawing: http://rainbowdoodler209.deviantart.c...https://nicecrew.tv/static/streaming-playlists/hls/800ede69-2e49-4953-8222-03ed68cf090e/8e79d3bb-c3f5-4082-b5c7-bec5a3eab30d-master.m3u8https://nicecrew.tv/videos/embed/gPasR73Qf2aVBuLVPuu5d7475002024-12-14T23:46:18.195ZBloodycreepymonstersschoolanime girlsYESDreamy's LoungeNOhttps://nicecrew.tv/w/uMej88KNsqL4vZr8Apcp9Uhttps://nicecrew.tv/lazy-static/thumbnails/9ad29034-876a-4f04-8db9-1a6333c269d9.jpgStressAnother short animation, I was gonna make a longer animation but It'll take forever to finish but I'm not gonna hurt myself keeping you guys entertained! ^^https://nicecrew.tv/static/streaming-playlists/hls/e9108e64-f572-41fe-ab80-c1366b6784e8/6ec50431-5cea-4557-beab-1d207829e173-master.m3u8https://nicecrew.tv/videos/embed/uMej88KNsqL4vZr8Apcp9U9002024-12-14T23:40:35.703ZanimationcuteanimechildpastelYESDreamy's LoungeNOhttps://nicecrew.tv/w/525bREJ2a6QCtPVki3bXothttps://nicecrew.tv/lazy-static/thumbnails/466efa30-cba5-4e34-9bc7-45da0dd78fe3.jpgDrawing: Old Red doll 100+ sub specialAnother creepy doll drawing, I appreciate this lovely moment, I finally reached 100 subs, thank you! Thank you for this guys, I'm so happy about this moment and we did it! ^^ I'm very sorry if this looks sloppy though! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Old-red-doll-601639732?ga_submit_new=10%253A1460066554https://nicecrew.tv/static/streaming-playlists/hls/208ae0fc-545e-4058-bfdb-60c93584d763/697438f2-5925-4bf8-a9e1-8ba9713cf167-master.m3u8https://nicecrew.tv/videos/embed/525bREJ2a6QCtPVki3bXot510002024-12-14T23:48:26.529Zdollscreepyrottinganime dollscuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/1kM7uuNwfN9iPrZXGUNY53https://nicecrew.tv/lazy-static/thumbnails/5a1d0da2-117a-4b82-a318-044e794cba2f.jpgDrawing: cat CartoonAnother cartoon I drew! Enjoy everyone! Meow meow: http://rainbowdoodler209.deviantart.com/art/Cat-cartoon-601898089?ga_submit_new=10%253A1460174715https://nicecrew.tv/static/streaming-playlists/hls/02c2eece-79d3-4c53-88ee-47140498ed7a/aa20bc06-9dfc-4016-9945-0d776d6a0ced-master.m3u8https://nicecrew.tv/videos/embed/1kM7uuNwfN9iPrZXGUNY53332002024-12-14T23:46:49.921Zcatscartoonsadobe photoshopcuteanimalsYESDreamy's LoungeNOhttps://nicecrew.tv/w/59yZigJ2exJ5Gkka6NkDZFhttps://nicecrew.tv/lazy-static/thumbnails/8359e797-28b3-4bc0-82fe-5a77fa7c8a13.jpgDrawing: Somthing's wrong hereA little monster walks around being cute, then the area around her starts to slowly get corrupted and messed up! Enjoy the drawing guys! ^^ Finished drawing: http://rainbowdoodler209.deviantart.com/art/Somthing-s-wrong-here-602067335?ga_submit_new=10%253A1460241800https://nicecrew.tv/static/streaming-playlists/hls/2196d595-6aa2-4d46-8000-ff621dba1bfd/b156dbe0-d060-45b4-ab84-2cdb34a12d14-master.m3u8https://nicecrew.tv/videos/embed/59yZigJ2exJ5Gkka6NkDZF217002024-12-14T23:44:06.544Zanimemonsterscutepastel colorsYESDreamy's LoungeNOhttps://nicecrew.tv/w/42jriX8iZ21NqALWFu53cVhttps://nicecrew.tv/lazy-static/thumbnails/772df627-59ff-4069-85c4-1e7210e992ca.jpgDrawing: Rabbit GirlAnother self portrait but in my bunny PJ's that I like to wear a lot at home in the weekend as some points! Hop hop hop I'm a cute pink rabbit! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Rabbit-girl-602255165?ga_submit_new=10%253A1460315314https://nicecrew.tv/static/streaming-playlists/hls/187a8585-6a2a-4dbb-a294-9ff71c72383b/76a2959e-313c-44f8-b7f8-3ca02338cb8d-master.m3u8https://nicecrew.tv/videos/embed/42jriX8iZ21NqALWFu53cV1099002024-12-14T23:57:29.394ZBunniescuteanimeSelfportriatsrabbitsYESDreamy's LoungeNOhttps://nicecrew.tv/w/1UhLnexGZ3efHjJwgjDjWfhttps://nicecrew.tv/lazy-static/thumbnails/9f35ddc2-61e2-4dc4-9d89-e43f32482b15.jpgVirus Monster #1Another short animation but with a cute virus monster that breathes fire and drools dark binary, please enjoy!https://nicecrew.tv/static/streaming-playlists/hls/074d01fe-f97f-49ee-b1e3-d7ee84a4009a/33e24a32-e384-4e23-94e6-425de533166a-master.m3u8https://nicecrew.tv/videos/embed/1UhLnexGZ3efHjJwgjDjWf18002024-12-14T23:44:15.223ZMonstersanimationsAdobe Flash CS6cutedarkYESDreamy's LoungeNOhttps://nicecrew.tv/w/byDB7YnbBtReJCzFt2kERqhttps://nicecrew.tv/lazy-static/thumbnails/3e601e12-199f-4578-ad56-668902dce071.jpgDrawing: ShipayinAnother drawing of Shipayin behind the far away mountains, sorry this looks sloppy but I just wanna make another quick drawing for you guys and that is all, have a great day and night! (Crap I made a song reference!) Finished drawing: http://rainbowdoodler209.deviantart.com/art/Shipayin-602898720?ga_submit_new=10%253A1460599520https://nicecrew.tv/static/streaming-playlists/hls/558a5cca-89ad-4040-95a1-678f3b9ee6b2/caf5e615-8c7e-47f5-a65b-637f8d466497-master.m3u8https://nicecrew.tv/videos/embed/byDB7YnbBtReJCzFt2kERq277002024-12-14T23:47:05.090ZmanderincuteShipayinanimedoodleYESDreamy's LoungeNOhttps://nicecrew.tv/w/tFP966MZuJ73Sj1nvJFKmjhttps://nicecrew.tv/lazy-static/thumbnails/33d08f5f-dd43-4190-b6ec-e51266fb4f0f.jpgDraiwng: John Lennon CartoonA little cartoon I made John lennon, I'll be gone for tomorrow since I'm going to be in my friend Sadie's house for her birthday sleepover, so please enjoy the cartoon! They say I'm a dreamer: http://rainbowdoodler209.deviantart.com/art/John-lennon-Cartoon-603269653https://nicecrew.tv/static/streaming-playlists/hls/e035cd33-703b-4fcc-819b-607a6b342ebe/6333e92b-2e8c-4b96-b8ec-31d3c3ca6cae-master.m3u8https://nicecrew.tv/videos/embed/tFP966MZuJ73Sj1nvJFKmj462002024-12-14T23:52:02.640ZJohn LennoncutecartoonsdoodleYESDreamy's LoungeNOhttps://nicecrew.tv/w/pjtDMibUYLbaNCnXKT9Gjxhttps://nicecrew.tv/lazy-static/thumbnails/2682c3f7-8f73-41e0-a1a0-8ffcfc4957d9.jpgDrawing: Lineless PlarineA drawing of another Yulkoon named Praline, you guys can give me any type of critisum as well since I like hearing your nice comments, even though I can't actually hear you, hehe! I hope you guys enjoy this painting and have a great Sunday! ^^ Grown up Yulkoon: http://rainbowdoodler209.deviantart.com/art/Lineless-Plarine-603626463?ga_submit_new=10%253A1460921732https://nicecrew.tv/static/streaming-playlists/hls/bcd69e29-52b9-4a1f-beb9-7df5b6aa3763/ce4a4679-b9b1-41db-a762-304fc22dd9a8-master.m3u8https://nicecrew.tv/videos/embed/pjtDMibUYLbaNCnXKT9Gjx275002024-12-14T23:48:38.139ZPlarine the Yulkoonanime girlsanimesurrealdigital artworkYESDreamy's LoungeNOhttps://nicecrew.tv/w/dtucYuw667GjXz2SMX9MdMhttps://nicecrew.tv/lazy-static/thumbnails/e254db91-c9d3-4452-b3bf-0c4e6914507d.jpgCute AlphyAnother short animation before bed, I'm sorry of lagging on Videos it's just loading, see you guys tomorrow and enjoy this cute animation!https://nicecrew.tv/static/streaming-playlists/hls/650420e8-baff-4ecc-9103-0bb813f96109/c7906a6c-a5f8-4e0c-88a5-b52f52214822-master.m3u8https://nicecrew.tv/videos/embed/dtucYuw667GjXz2SMX9MdM8002024-12-14T23:46:31.383ZAnimationFlashYESDreamy's LoungeNOhttps://nicecrew.tv/w/23SDrNKPGkkKRZQT2SHUKuhttps://nicecrew.tv/lazy-static/thumbnails/9cca2602-0697-4c0f-aaba-d4db36f4db10.jpgDrawing: Crazy ChunaI'm going to change my Youtube name to My DA name, I hope you guys don't mind it too! And please ignore me looking for something in Photoshop by the way, sorry about that! Chuna is walking closer: http://rainbowdoodler209.deviantart.com/art/Crazy-Chuna-604088952https://nicecrew.tv/static/streaming-playlists/hls/087fd670-f9b8-4ec1-9813-ae44fff18612/7c046306-059f-4bcf-8b4b-45fc3470402b-master.m3u8https://nicecrew.tv/videos/embed/23SDrNKPGkkKRZQT2SHUKu455002024-12-14T23:52:32.091ZChuna_the_NekogirlanimecreepyyandereYESDreamy's LoungeNOhttps://nicecrew.tv/w/oh9FcAM1nUtAu36bn3vT7dhttps://nicecrew.tv/lazy-static/thumbnails/3df73446-94a1-4b7c-99d6-94d26d6ee31c.jpgFlash Doodle: Zappy the sparkballAnother little drawing but with Zappy in human form, and has become an AI! Please enjoy! And I'm changing my name to my DA name too so yeah! ^^https://nicecrew.tv/static/streaming-playlists/hls/b46a4c2a-e74b-454c-83b8-f5044e20035c/84faa376-fb9c-4eeb-9f39-3ee5fb7b88f4-master.m3u8https://nicecrew.tv/videos/embed/oh9FcAM1nUtAu36bn3vT7d134002024-12-14T23:47:32.543ZZappy_SparkballanimeAdobe FlashYESDreamy's LoungeNOhttps://nicecrew.tv/w/3DVPQ9VVs5BDPp1gH34QtThttps://nicecrew.tv/lazy-static/thumbnails/ba53cbeb-9992-45e9-9e0b-822134de79f9.jpgDrawing: Lucyanna Pastel P1This is gonna have a two part since my macbook turned it's screen off, I think it's doing that so it would cool down probably. Anyways I'll be making a new background of my channel! Enjoy! Lucyanna is waiting: http://rainbowdoodler209.deviantart.com/art/Lucyanna-Pastel-604442989https://nicecrew.tv/static/streaming-playlists/hls/157df7a9-cf7f-4c33-b7f5-3175a62ae309/6be09927-4a9d-4ac3-8396-3a31a400a65e-master.m3u8https://nicecrew.tv/videos/embed/3DVPQ9VVs5BDPp1gH34QtT344002024-12-14T23:51:39.400ZLucyanna_Kimselcutetwo parterLucyanna BotanimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/rd8NCz4CpRoBVsKdCD8PbShttps://nicecrew.tv/lazy-static/thumbnails/8e8189fe-bfb6-4577-8f8a-a528e88768ee.jpgDrawing: Lucyanna Black and white P2Here is part 2, the link is in part 1! Please enjoy everyone!https://nicecrew.tv/static/streaming-playlists/hls/cc26337b-ef98-4e59-8f1c-3992e64da77a/1b08ce5f-8092-4cf5-ad4f-beae910aa9d0-master.m3u8https://nicecrew.tv/videos/embed/rd8NCz4CpRoBVsKdCD8PbS49002024-12-14T23:48:20.960ZLucyannacuteadobe photoshoppaintingsartworkYESDreamy's LoungeNOhttps://nicecrew.tv/w/o4rEG7qj66RUxehhaHsJ4bhttps://nicecrew.tv/lazy-static/thumbnails/5fb8fc9e-1d2d-4e18-81c5-4ecf5ca9a3f7.jpgShipayin_ShenmaAnother random video, please don't mind this video! I made this to I get compare her face to this text emoticon (T_T)! Please enjoy this random video! ^^ Finished drawing: http://rainbowdoodler209.deviantart.com/art/Shipayin-s-face-604686157?ga_submit_new=10%253A1461392311https://nicecrew.tv/static/streaming-playlists/hls/b2a41988-898c-4094-a4e6-b625deb811e0/91f38e87-906c-460f-bdde-f7905a981b20-master.m3u8https://nicecrew.tv/videos/embed/o4rEG7qj66RUxehhaHsJ4b124002024-12-14T23:50:21.098ZRandomboredanimeadobe photoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/f9n1CTFXazmHX2d6tteshFhttps://nicecrew.tv/lazy-static/thumbnails/a887c97a-1f6c-4ba6-a91b-87db9186fe99.jpgDrawing: Sleep ModeAnother robot drawing, please enjoy this cute rival of Lucyanna the protecter of Planet Tarreon! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Sleep-mode-604814821?ga_submit_new=10%253A1461446346https://nicecrew.tv/static/streaming-playlists/hls/728ad701-96d4-47c6-b55d-4fe5494cde47/1b0b8b12-3b65-4aa8-a229-90408f8f0023-master.m3u8https://nicecrew.tv/videos/embed/f9n1CTFXazmHX2d6tteshF1125002024-12-15T00:07:33.155ZrobotsLucyanna_Enemycolorfulanime girlsYESDreamy's LoungeNOhttps://nicecrew.tv/w/cTBrK4bbscEgtBxNoeeWcAhttps://nicecrew.tv/lazy-static/thumbnails/30da0aab-4587-4eea-b4ba-7b2d0fd7131c.jpgDrawing: Piano's attackWARNING: May contain blood Another drawing video about Piano, except she beats evil monsters and uses her piano keys, please enjoy the video! ^^ Piano girl fights back: http://rainbowdoodler209.deviantart.com/art/Piano-s-attack-605112454?ga_submit_new=10%253A1461553088https://nicecrew.tv/static/streaming-playlists/hls/60494cf2-08d9-4d1c-8f56-edb49c9843d0/6659f0c1-4db1-458b-9e46-aff1f5babd69-master.m3u8https://nicecrew.tv/videos/embed/cTBrK4bbscEgtBxNoeeWcA954002024-12-15T00:02:52.269Zpianogirlsanimebloodyhorrorspeed drawingYESDreamy's LoungeNOhttps://nicecrew.tv/w/xetK3yP83F9jrMGD536eq9https://nicecrew.tv/lazy-static/thumbnails/a5864b8e-ac09-4056-8f6a-01d30b022e9c.jpgZappy and SafinaAnother short animation with a lot of frames, I wanted to finish this animation because why not! ^^ Enjoy! ^^https://nicecrew.tv/static/streaming-playlists/hls/fced106d-95c9-47dd-a692-c77361c8ddf4/8a0fc9e3-2b37-42a1-a73c-39087d248c84-master.m3u8https://nicecrew.tv/videos/embed/xetK3yP83F9jrMGD536eq917002024-12-14T23:50:40.682ZAnimationsAdobe FlashanimecolorfulfastYESDreamy's LoungeNOhttps://nicecrew.tv/w/wgoY91BE11SsjC3WCXkz1uhttps://nicecrew.tv/lazy-static/thumbnails/5119ad06-2a86-434d-b280-3d142620c05e.jpgDrawing: Kitty Safina 2Another drawing of Safina as a normal cat, I hope you guys enjoy this cute little cartoon and have a great Thursday! ^^ Meow meow: http://rainbowdoodler209.deviantart.com/art/Kitty-Safina-2-605822714?ga_submit_new=10%253A1461884027https://nicecrew.tv/static/streaming-playlists/hls/f5187887-a9ae-4b8b-adaf-6b8a0b151228/2b61d6d6-96e5-4879-8496-fb397b7b6f80-master.m3u8https://nicecrew.tv/videos/embed/wgoY91BE11SsjC3WCXkz1u434002024-12-14T23:55:12.811ZSafina_the_catanime catsanimecutecolorfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/gySPnsriinU7CwL3Yuigxshttps://nicecrew.tv/lazy-static/thumbnails/68875bed-3784-493b-91c6-5a3c759c7a60.jpgDrawing: Cirno BluesA little Touhou drawing for my Touhou fans to enjoy and a little something to Reddevil500a, I hope everyone enjoys this video! ^^ Cirno: http://rainbowdoodler209.deviantart.com/art/Cirno-blues-606210838https://nicecrew.tv/static/streaming-playlists/hls/7e10328c-9be7-4701-92be-11a234165a24/0466dead-045b-4699-ad8d-2fbf2e30c24b-master.m3u8https://nicecrew.tv/videos/embed/gySPnsriinU7CwL3Yuigxs369012024-12-14T23:54:54.386ZTouhouanime girlsTouhou FanartAdobe photoshop CS6coldcolorsYESDreamy's LoungeNOhttps://nicecrew.tv/w/5k3BYFhEUNHuQaSHLUgDabhttps://nicecrew.tv/lazy-static/thumbnails/a69691c0-db0f-4dbd-a72e-9c88926dc430.jpgDrawing: Shadow DragonI wanted to make another dragon painting, please enjoy this painting! I love dragons, they're really cool! RAWR: http://rainbowdoodler209.deviantart.com/art/Shadow-dragon-606425710?ga_submit_new=10%253A1462131719https://nicecrew.tv/static/streaming-playlists/hls/230d4d13-e8b1-4cf4-93d1-8ad9fc941da0/4d557afe-65a5-4689-bef1-52553c020875-master.m3u8https://nicecrew.tv/videos/embed/5k3BYFhEUNHuQaSHLUgDab554002024-12-14T23:59:26.471Zdragonsshadowscreepyfiremystical creaturesYESDreamy's LoungeNOhttps://nicecrew.tv/w/rpDsLgVc2R3S15nnVBPKDXhttps://nicecrew.tv/lazy-static/thumbnails/5d70a126-de81-4d74-b8b5-fd8f44408410.jpgDrawing: Yui the army ratWARNING: Contains blood! I know you guy don't mind A little drawing of Yui the army rat, she ended up fighting the house cat in a battle and she won in victory, but feels really guilty afterwards! Yui the rat: http://rainbowdoodler209.deviantart.com/art/Yui-the-army-Rat-606859223?ga_submit_new=10%253A1462314008https://nicecrew.tv/static/streaming-playlists/hls/cdc1a8de-352b-4a23-af12-72f4aea1da0d/56cab268-9fd8-49b9-818e-c081592dbd34-master.m3u8https://nicecrew.tv/videos/embed/rpDsLgVc2R3S15nnVBPKDX622002024-12-15T00:01:01.428ZAnimeRatsarmy ratsYui the army ratbloodyYESDreamy's LoungeNOhttps://nicecrew.tv/w/7cxaJj1yLku8mXxDvGfdbmhttps://nicecrew.tv/lazy-static/thumbnails/c8ea73a9-1226-45a1-a988-9fca6f296d04.jpgCute TeddyAnother cute animation, pleas enjoy! ^^https://nicecrew.tv/static/streaming-playlists/hls/323338a3-11de-4032-870e-18d446e64398/41ce1d8d-8199-4773-97b5-aafa2877c0b6-master.m3u8https://nicecrew.tv/videos/embed/7cxaJj1yLku8mXxDvGfdbm10002024-12-14T23:51:59.326ZCuteteddy bearanimationAdobe Flash cs6YESDreamy's LoungeNOhttps://nicecrew.tv/w/6rB71kM2CVYaKXu6kyqUKqhttps://nicecrew.tv/lazy-static/thumbnails/5c184b41-c74c-4615-982c-5a6386738159.jpgDrawing: Two girlsAnother drawing of two girls except they're going somewhere really dangerous! Please enjoy and sub! ^^ Finished drawing: http://rainbowdoodler209.deviantart.com/art/Two-girls-607088611?ga_submit_new=10%253A1462413328https://nicecrew.tv/static/streaming-playlists/hls/2c10ebbe-dc4b-45a1-9c80-bc9128bb5406/8ed18614-eba5-4e5e-8681-e9b49a704ba3-master.m3u8https://nicecrew.tv/videos/embed/6rB71kM2CVYaKXu6kyqUKq362002024-12-14T23:56:36.177ZCuteanime girlsanime artworkpastel colorsAdobe Photoshop CS6YESDreamy's LoungeNOhttps://nicecrew.tv/w/ximfgbV3xmMfxgiqBqjiU3https://nicecrew.tv/lazy-static/thumbnails/2369beb4-c013-48ee-b627-ea04c60ca3a7.jpgDrawing: MeguminA drawing request by gi97ol, please enjoy this drawing! ^^ I hope you enjoy it, I'm sorry if this is lack luster! Oh well! Enjoy everyone! Like, comment and sub! And give out criticism if you want! Megumin: http://rainbowdoodler209.deviantart.com/art/Megumin-607229890?ga_submit_new=10%253A1462482966https://nicecrew.tv/static/streaming-playlists/hls/fd776b66-0280-44a3-a447-b7bc2399cdde/69f81fce-2e7d-4183-9c80-851ab252f017-master.m3u8https://nicecrew.tv/videos/embed/ximfgbV3xmMfxgiqBqjiU3271002024-12-15T00:00:36.285Zmegumin konosubaAnime girlsAdobe Photoshop CS6redhot_colorsYESDreamy's LoungeNOhttps://nicecrew.tv/w/bFBqNfWUJT41a7gXhgJHtwhttps://nicecrew.tv/lazy-static/thumbnails/ab218405-1852-4d2f-892d-0a1f744e3f07.jpgDrawing: Rainbow neko boyI'm going to use my editing programs at some point since you guys want me to use better editing programs and stuff, you can give me more ideas for what to draw or animate next! ^^ Finished drawing: http://rainbowdoodler209.deviantart.com/art/Rainbow-Neko-boy-607475173?ga_submit_new=10%253A1462586529https://nicecrew.tv/static/streaming-playlists/hls/56833a04-650d-4536-9ab0-7882c084d6c0/02017cbc-7155-4563-8ffa-b85f37fae239-master.m3u8https://nicecrew.tv/videos/embed/bFBqNfWUJT41a7gXhgJHtw349002024-12-14T23:57:12.087ZanimeNeko boyAnime artcuteAdobe Photoshop CS6YESDreamy's LoungeNOhttps://nicecrew.tv/w/fhX9s8uxxFD8564ZZs5zLehttps://nicecrew.tv/lazy-static/thumbnails/823c1d40-4d6c-4d43-84f6-9c41d609f8ee.jpgDrawing: Cton StopI wanted to draw jack the Russian man, and Cton is stop in Russian basically for those who don;t speak in Russian, I'm not trying to make fun of Russia and stuff! Please enjoy everyone! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Cton-Stop-607692112?ga_submit_new=10%253A1462672463https://nicecrew.tv/static/streaming-playlists/hls/73bdd388-a7b3-492e-b3ca-5397c0dc8d49/6b1c937f-7e71-417a-a473-dbf879108ed0-master.m3u8https://nicecrew.tv/videos/embed/fhX9s8uxxFD8564ZZs5zLe355002024-12-15T00:02:35.570ZRussiancuteanimemonstersstreetsYESDreamy's LoungeNOhttps://nicecrew.tv/w/9Pg4r9GY5xvoCzAJfT4z6ehttps://nicecrew.tv/lazy-static/thumbnails/aa16cc1e-c449-47dc-b4a2-dd41aa8847b9.jpgDrawing: Tall CakeAnother cute cartoon i made because, I love drawing monsters since I was little and stuff! And that is all sadly, I hope you guys have a great mother's day! Monster cartoon: http://rainbowdoodler209.deviantart.com/art/Tall-cake-607918259?ga_submit_new=10%253A1462760345https://nicecrew.tv/static/streaming-playlists/hls/476258d7-14f7-43dd-a0ff-7d41a747eebb/946322c6-dc09-475b-a07d-5a0259faadf0-master.m3u8https://nicecrew.tv/videos/embed/9Pg4r9GY5xvoCzAJfT4z6e158002024-12-15T00:00:13.544ZmonsterscartoonsdrawingsAdobe Photoshop CS6YESDreamy's LoungeNOhttps://nicecrew.tv/w/4FeJU7CgrHn6tAfzbfH5k9https://nicecrew.tv/lazy-static/thumbnails/a37ad62c-2c50-4380-b9ac-33f051e9af1a.jpgBored GodAnother little animation I created, please enjoy! I hope you guys have a great night! ^^https://nicecrew.tv/static/streaming-playlists/hls/1dc5e3ee-79bf-4f76-b964-e881dff6c5ae/d2940c06-434d-4ec4-93c0-219679c45e6e-master.m3u8https://nicecrew.tv/videos/embed/4FeJU7CgrHn6tAfzbfH5k955002024-12-15T00:00:39.710ZAdobe Flash CS6animationgodspurplecuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/cBKLsRBRXPYGzfySRQDt8qhttps://nicecrew.tv/lazy-static/thumbnails/356c7aa7-4694-4bfe-8920-7b6b44173fde.jpgDrawing: Super SheepA little random drawing of a sheep that will save the world along with Lucyanna, who is a humaniod robot created by an alien dressed up as a human! Please enjoy this drawing Everyone! I'll be back after my field trip to china town tomorrow for my Mandarin class! SUPER SHEEP: http://rainbowdoodler209.deviantart.com/art/Super-Sheep-608480866?ga_submit_new=10%253A1463016835https://nicecrew.tv/static/streaming-playlists/hls/5e128782-af9d-4d75-b740-d71143dd0362/9bb7003d-30f7-49d8-af61-1e30feb04b5f-master.m3u8https://nicecrew.tv/videos/embed/cBKLsRBRXPYGzfySRQDt8q587002024-12-15T00:11:54.057ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/pH2ny3Wh26UHVKF1W8boK6https://nicecrew.tv/lazy-static/thumbnails/30da1e84-4959-4aaa-8b6d-86986fd6cd5b.jpgDrawing: Theadore the rogue ClarinetAn evil humaniod clarinet who loves to shred apart human instruments who are low powered and young, Theadore is that evil to anyone! Please enjoy this painting video! Finished evil Clarinet: http://rainbowdoodler209.deviantart.com/art/Theadore-the-rogue-Clarinet-608839119?ga_submit_new=10%253A1463188744https://nicecrew.tv/static/streaming-playlists/hls/bffc876e-4178-40d3-b25b-f2318fa0961b/1c58b0a6-fbc6-46c4-863a-12dac5127801-master.m3u8https://nicecrew.tv/videos/embed/pH2ny3Wh26UHVKF1W8boK6460002024-12-15T00:07:58.133ZTheadore_Clarinetevil_clarinetanimeguysbluecartoonsYESDreamy's LoungeNOhttps://nicecrew.tv/w/37w523ZbCqjpqcAEtiyEbEhttps://nicecrew.tv/lazy-static/thumbnails/2a5700b4-0e3c-47fb-8d08-8adad58aad1b.jpgDrawing: Alien catAn alien cat from the planet called Forgali, this cat slowly looking around in Planet Earth, and instantly wants to invade this planet! Please enjoy this drawing video everyone! Alien cat: http://rainbowdoodler209.deviantart.com/art/Alien-cat-608997317?ga_submit_new=10%253A1463258543https://nicecrew.tv/static/streaming-playlists/hls/111b4552-8f49-4779-a732-4bc03d699a32/e5089304-3f29-40f5-b5b4-e43b7a2cae6e-master.m3u8https://nicecrew.tv/videos/embed/37w523ZbCqjpqcAEtiyEbE421002024-12-15T00:11:20.894ZAnime catscutealiensYESDreamy's LoungeNOhttps://nicecrew.tv/w/ddEmFCc57LdhXNKLNHe78hhttps://nicecrew.tv/lazy-static/thumbnails/6439fea2-c8e2-4223-8217-9fe4a8ed737c.jpgDrawing: MeofCoarseA drawing of my subscribes Meofcoarse, I hope you like it and stuff! I wanted to draw one of my subs because why not! You are you calling?: http://rainbowdoodler209.deviantart.com/art/MeofCoarse-609087645?ga_submit_new=10%253A1463288769https://nicecrew.tv/static/streaming-playlists/hls/62f23a2d-9c16-44b4-81b0-ce8f476bd956/d0426fd4-ba07-449e-b363-a87b6924b27e-master.m3u8https://nicecrew.tv/videos/embed/ddEmFCc57LdhXNKLNHe78h380012024-12-15T00:10:27.756ZAnime guysmonochromePaintingdigital artphonesYESDreamy's LoungeNOhttps://nicecrew.tv/w/ut9wuBSrZZdBQfUifMqfYihttps://nicecrew.tv/lazy-static/thumbnails/5264ee85-5da9-4fe0-b510-d732aab53da2.jpgDrawing: Zevatron & TSMB2Another request from a youtube, please enjoy everyone and I hope you guys love this cute blue cartoon! And have a great day MIDI team! ^^ finished blue duo: http://rainbowdoodler209.deviantart.com/art/Zevatron-and-TSMB2-609642912?ga_submit_new=10%253A1463530722https://nicecrew.tv/static/streaming-playlists/hls/e68a37ec-45bb-4aa4-988c-40fcb2fb2949/724d2bc8-51d1-4326-84fa-2a45149e94b4-master.m3u8https://nicecrew.tv/videos/embed/ut9wuBSrZZdBQfUifMqfYi507002024-12-15T00:14:08.409Zbluecuteanimeboysanime guysYESDreamy's LoungeNOhttps://nicecrew.tv/w/edQVPcF4c4XGVnD1hDbRAbhttps://nicecrew.tv/lazy-static/thumbnails/8b988eaf-49a7-468b-9539-29cc1c57e524.jpgRattingail vs catAnother animation but a battle between an old guard rat and a blue cat, please enjoy! ^^https://nicecrew.tv/static/streaming-playlists/hls/6b11e173-213b-4aa0-944a-e5df75d15202/0ab3e228-ccfd-4cc2-b70b-080f2288b2f0-master.m3u8https://nicecrew.tv/videos/embed/edQVPcF4c4XGVnD1hDbRAb74002024-12-15T00:01:31.424ZAnimationscuteanimalsAdobe Flash CS6randomYESDreamy's LoungeNOhttps://nicecrew.tv/w/qJ8uueHKEBwKDGtYrtDNf3https://nicecrew.tv/lazy-static/thumbnails/8d6ab86f-053d-4e94-b64e-e8b1bf6b268e.jpgDrawing: Little CrowA little doodle of a crow beforeI go to bed, I was at my last band concert and I loved it, and it's pretty tiring too! Anyways please enjoy! Caw Caw: http://rainbowdoodler209.deviantart.com/art/Little-Crow-610046649?ga_submit_new=10%253A1463711541https://nicecrew.tv/static/streaming-playlists/hls/c83d2ec9-c77f-4242-835b-542fa344943e/542e14ae-d249-405e-a3ff-c002aebeb95c-master.m3u8https://nicecrew.tv/videos/embed/qJ8uueHKEBwKDGtYrtDNf3347002024-12-15T00:13:04.756ZCrowRavensdoodlecutecartoonYESDreamy's LoungeNOhttps://nicecrew.tv/w/atEPh6JyaTJkTcFEKuULp6https://nicecrew.tv/lazy-static/thumbnails/cda79d91-3f05-425d-929f-9d51cd85b99b.jpgDrawing: PORK AND BEANS!A little in living color reference, please enjoy this cute and random cartoon please enjoy this drawing video! PORK AND BEANS!: http://rainbowdoodler209.deviantart.com/art/Pork-and-Beans-610261539?ga_submit_new=10%253A1463808738https://nicecrew.tv/static/streaming-playlists/hls/4cbf401a-7950-41cd-8f2e-1f241c79732b/9e8e566b-d324-4e6d-ba46-011fb4c8a2f6-master.m3u8https://nicecrew.tv/videos/embed/atEPh6JyaTJkTcFEKuULp6334002024-12-15T00:16:58.423ZCartoonsAnimalscatsYESDreamy's LoungeNOhttps://nicecrew.tv/w/84i14KS714gsHftUtPDtLGhttps://nicecrew.tv/lazy-static/thumbnails/6ef68f05-7864-410d-a01b-c642f1952b08.jpgDrawing: Randel Fingerstein's true selfA drawing of Randel Fingerstein as an alien, ever since he created his first robot "Lucyanna 10-1" who is he claims is his first daughter he ever made.....Please enjoy this speed drawing! :) Randel Fingerstein: http://rainbowdoodler209.deviantart.com/art/Randel-Fingerstein-s-true-self-610450935?ga_submit_new=10%253A1463885621https://nicecrew.tv/static/streaming-playlists/hls/3925ade2-b13b-4319-8d10-5af1434acb04/2a1dd5ba-11f8-4e4f-9892-2c6953eeb08b-master.m3u8https://nicecrew.tv/videos/embed/84i14KS714gsHftUtPDtLG581002024-12-15T00:17:47.351ZAliensRandel_FingersteincutemonsterLucyanna 10-1YESDreamy's LoungeNOhttps://nicecrew.tv/w/8794S4YGiSE8J8MV7y1ZUrhttps://nicecrew.tv/lazy-static/thumbnails/027c16e6-66b8-4d75-a87d-17d67b763b9a.jpgStrange endingAnother animation but with cartoons morphing into new beings! Please enjoy! A drawing based off of this animation: http://rainbowdoodler209.deviantart.com/art/Strange-Ending-610665746?ga_submit_new=10%253A1463968487https://nicecrew.tv/static/streaming-playlists/hls/398b678a-ed2d-43f7-b2d1-4ee64e415765/6677ed70-1b5d-4f9c-b0a6-0c2246e4003b-master.m3u8https://nicecrew.tv/videos/embed/8794S4YGiSE8J8MV7y1ZUr70002024-12-15T00:12:12.058ZAdobe Flash CS6colorfulcartoonssurrealmonstersYESDreamy's LoungeNOhttps://nicecrew.tv/w/5ThTHwK1KupGPeFyEQ729Yhttps://nicecrew.tv/lazy-static/thumbnails/4443ce6b-f5d8-4ab7-a737-4d333e27e276.jpgFlash doodle: Purple nightAnother drawing, but made in Flash, I hope you enjoy this strange little .....thing I made. So please enjoy this video! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Purple-Night-610993948?ga_submit_new=10%253A1464122057https://nicecrew.tv/static/streaming-playlists/hls/278de592-3d50-4eb3-b2da-a22c2031015c/84f3be21-38ce-49df-9166-c2e5a6d10040-master.m3u8https://nicecrew.tv/videos/embed/5ThTHwK1KupGPeFyEQ729Y249002024-12-15T00:14:31.166ZAnimalspastel colorsmonstersYESDreamy's LoungeNOhttps://nicecrew.tv/w/5Y8NWUBPmbR9fEb5UhKgHJhttps://nicecrew.tv/lazy-static/thumbnails/3c5f720c-1953-44c7-b443-fd54ee9b1783.jpgDrawing: Angel boyAnother little drawing of an angel, I really like angels, I think they're really beautiful and cute! *Ahem* Anyways I hope you guys enjoy this little angelic painting! ^^ Finished painting: http://rainbowdoodler209.deviantart.com/art/Angel-boy-611051226https://nicecrew.tv/static/streaming-playlists/hls/283b04bb-b844-4aea-8891-4a5ac4b884c8/fbc3e32e-44f6-445e-9075-9fc4acf9eab8-master.m3u8https://nicecrew.tv/videos/embed/5Y8NWUBPmbR9fEb5UhKgHJ434002024-12-15T00:21:21.667ZAngelsanime artanimeAdobe PhotoshopcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/4aeyEWxcRQ9wKsrrvraCa6https://nicecrew.tv/lazy-static/thumbnails/d031c70e-787d-4c29-9263-0b5c5b7f24aa.jpgDrawing: New profile pictureAnother cute profile picture of Lucyanna but wearing cute black bows, please enjoy this cute drawing video! Meep! Lucyanna upgrade: http://rainbowdoodler209.deviantart.com/art/New-profile-picture-2016-II-611440780?ga_submit_new=10%253A1464316830https://nicecrew.tv/static/streaming-playlists/hls/199577f5-8aa6-487e-b2c2-37dc524332f7/aafdcce8-abb2-46ce-b0c9-92f2e175eed2-master.m3u8https://nicecrew.tv/videos/embed/4aeyEWxcRQ9wKsrrvraCa6417002024-12-15T00:18:38.315ZAnimeanime girlsbluecold colorshumaniod robotYESDreamy's LoungeNOhttps://nicecrew.tv/w/kuJ1vHBAzADJjaMF4qX9QThttps://nicecrew.tv/lazy-static/thumbnails/829464cd-487a-4412-a585-43600a835023.jpgDrawing: Sweet dollyAnother cute doll girl! I'm going to make an actual channel trailer since, well I want to show people what I do on this lovely channel and stuff! Enjoy! Cute dolly: http://rainbowdoodler209.deviantart.com/art/Sweet-dolly-611631759?ga_submit_new=10%253A1464403042https://nicecrew.tv/static/streaming-playlists/hls/9de05955-ad3d-4513-bd70-b0e57826866b/92b99d05-7b2b-48d9-8393-659896e8420d-master.m3u8https://nicecrew.tv/videos/embed/kuJ1vHBAzADJjaMF4qX9QT541002024-12-15T00:21:07.600Zdollsanime girlanime artworkAdobe Photoshop CS6pastel colorsYESDreamy's LoungeNOhttps://nicecrew.tv/w/ewxaDAtfzH3ZiSnZNzQkrChttps://nicecrew.tv/lazy-static/thumbnails/26cef205-7234-4ed6-a1b5-52f7cfccfbd0.jpgDrawing: Spirit catA cat girl spirit who likes to run around and cause chaos and a lot of trouble! please enjoy this video! Nya nya!: http://rainbowdoodler209.deviantart.com/art/Spirit-Cat-611864475https://nicecrew.tv/static/streaming-playlists/hls/6d8a5297-7f85-448a-b331-d44649e5e98a/ada454c1-7ae6-41ba-8ad1-7e21a8799647-master.m3u8https://nicecrew.tv/videos/embed/ewxaDAtfzH3ZiSnZNzQkrC362002024-12-15T00:20:46.576ZAnimeanime spirit animalanime girlscute animeYESDreamy's LoungeNOhttps://nicecrew.tv/w/9i8n9rud2Q1bHZZtMT1ZmChttps://nicecrew.tv/lazy-static/thumbnails/b41dcdb8-f2e1-421c-9eb3-deaa5b54ceba.jpgGuess that song #1This is a new series where I play any song ever and you guess the title of that song, don't worry I'll make more drawing videos still! :)https://nicecrew.tv/static/streaming-playlists/hls/432d4abd-60d9-45ef-a12d-58ac319e4340/69100592-4d8a-440e-a3a3-a1a3926e81a0-master.m3u8https://nicecrew.tv/videos/embed/9i8n9rud2Q1bHZZtMT1ZmC62002024-12-15T00:15:37.595ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/2eWKWveAGw7XmeRT8oMR7Whttps://nicecrew.tv/lazy-static/thumbnails/977b6d15-538e-4bd7-9c5e-e2488e13cbca.jpgDrawing: ZevatronAnother drawing of Zevatron, since he requested me to make another profile picture for him, I hope you like it Zevvy! :) Finished drawing: http://rainbowdoodler209.deviantart.com/art/Zevatron-612255614?ga_submit_new=10%253A1464653529https://nicecrew.tv/static/streaming-playlists/hls/0a0b8da0-6324-4106-b7d6-15660085d77e/6f057d94-72ed-4cdd-907b-d5165a3e0a59-master.m3u8https://nicecrew.tv/videos/embed/2eWKWveAGw7XmeRT8oMR7W342002024-12-15T00:21:02.268ZAnime boysanime artcolorfulthree colorsAdobe Photoshop CS6YESDreamy's LoungeNOhttps://nicecrew.tv/w/qp1J4Bfy29graZqwNcj27Rhttps://nicecrew.tv/lazy-static/thumbnails/7d9d420f-e959-4527-9aa0-0929b51c763b.jpgFlash doodle: piggyA little flash doodle before bed, I hope you guys enjoy this video! ^^ Oink Oink!https://nicecrew.tv/static/streaming-playlists/hls/c591e1a8-7208-479a-9990-8f1912cbce71/7d7d4475-c94a-41a6-bcaa-506e3bf3f9d2-master.m3u8https://nicecrew.tv/videos/embed/qp1J4Bfy29graZqwNcj27R68002024-12-15T00:17:33.990ZAdobe Flash CS6pigscutefarmsanimalsYESDreamy's LoungeNOhttps://nicecrew.tv/w/gcViNkLWYEazerB6xoBveQhttps://nicecrew.tv/lazy-static/thumbnails/c672cdd1-ffa1-49b6-b9f0-ae2ff68aee63.jpgDrawing: BirdmanA drawing based off of my older cartoon characters that I drew on my 3ds! I hope you guys enjoy this cute little drawing, and subscribe to my channel! ^^ (Please ignore the last part of the video, I kind of added that video by accident! Please forgive me! ^^") Birdman watches you: http://rainbowdoodler209.deviantart.com/art/Birdman-612642180?ga_submit_new=10%253A1464819052https://nicecrew.tv/static/streaming-playlists/hls/7b231ce7-18be-4530-9540-be278b00772e/ee59974b-dbc4-4727-bcac-73f093804484-master.m3u8https://nicecrew.tv/videos/embed/gcViNkLWYEazerB6xoBveQ626002024-12-15T00:25:54.222ZanimeAdobe Photoshop CS6bluecold colorsjust for funYESDreamy's LoungeNOhttps://nicecrew.tv/w/dAGNdCJACttwJ3EQRY6GUdhttps://nicecrew.tv/lazy-static/thumbnails/ecf2bbeb-5a7f-4f9e-92d6-e1138e18d59f.jpgdrawing: Hopeful NekogirlA cute stray blue neko girl, if you save her from danger, she'll trust you comeplety, and her name is Dreamia! I hope you guys enjoy! T-Thank you: http://rainbowdoodler209.deviantart.com/art/Hopeful-nekogirl-612877124?ga_submit_new=10%253A1464916243https://nicecrew.tv/static/streaming-playlists/hls/66061814-268f-4fb9-9116-88d5e056fc5c/478bf7c7-e5a9-4fdf-9a78-8871cbc501a2-master.m3u8https://nicecrew.tv/videos/embed/dAGNdCJACttwJ3EQRY6GUd484002024-12-15T00:23:32.000ZDreamia the neko girlcutestray neko girlhopefulYESDreamy's LoungeNOhttps://nicecrew.tv/w/8AnxssQwn9qzG6NPaDkfPthttps://nicecrew.tv/lazy-static/thumbnails/b87b6902-c0ab-417f-a747-60507c36610c.jpgDrawing: Tough SafinaAnother drawing of Safina, except looking a little threatening and a little agitated, I hope you guys enjoy this drawing! ^^ Hiss!: http://rainbowdoodler209.deviantart.com/art/Tough-Safina-613104522?ga_submit_new=10%253A1465009555https://nicecrew.tv/static/streaming-playlists/hls/3d7c88e5-00dd-4887-bcb1-cb1e6b831b61/4c876bea-a30b-434e-a76c-5d7ab317f349-master.m3u8https://nicecrew.tv/videos/embed/8AnxssQwn9qzG6NPaDkfPt779002024-12-15T00:28:10.883ZSafina the catanthroanime girlsanime artYESDreamy's LoungeNOhttps://nicecrew.tv/w/1qTpWco9igMTuYvUbAtFG3https://nicecrew.tv/lazy-static/thumbnails/538d3d55-c2f1-473a-9e22-6a7320119f12.jpgStuck in a box + DoodleA little animation I made, PLUS a little doodle for you guys since I always make separate videos of doodles of cartoons and stuff! I hope you guys enjoy and have a great night! :) Take me to your leader: http://rainbowdoodler209.deviantart.com/art/Deila-hovering-613334431?ga_submit_new=10%253A1465103284https://nicecrew.tv/static/streaming-playlists/hls/037988df-689d-435e-a08a-7bb5641a69a6/8fde2ce1-f69d-474f-87c3-77d92d7e6b01-master.m3u8https://nicecrew.tv/videos/embed/1qTpWco9igMTuYvUbAtFG3303002024-12-15T00:32:03.880ZAdobe Flash CS6animationsdoodlescutecartoonsYESDreamy's LoungeNOhttps://nicecrew.tv/w/uwmdKXHxSB5qp57WJ6p5tkhttps://nicecrew.tv/lazy-static/thumbnails/cc6cafb7-737c-4194-94c0-fec1c6fa57dc.jpgDrawing Contest: Anime characterI request you guys to make an anime character, or any cartoon of your style and choice, you guys can link the drawings in the comments! I hope you guys have fun!https://nicecrew.tv/static/streaming-playlists/hls/e6fca815-5631-4257-be63-743c5d821c69/2db14edf-0265-4769-9b1e-684a832c2951-master.m3u8https://nicecrew.tv/videos/embed/uwmdKXHxSB5qp57WJ6p5tk133002024-12-15T00:22:36.769ZDrawing contests #1animecartoonsYESDreamy's LoungeNOhttps://nicecrew.tv/w/n9UanrAGC6JQrejVYijEFUhttps://nicecrew.tv/lazy-static/thumbnails/4881a6c0-8993-4af2-bdfe-4af075778cdc.jpgDrawing: light DragonA drawing of a dragon made from the light you see, I hope you guys enjoy this video! I also lost a sub, probably because of the sub removing glitch still happening.... Roar!: http://rainbowdoodler209.deviantart.com/art/Light-Dragon-613904233?ga_submit_new=10%253A1465339494https://nicecrew.tv/static/streaming-playlists/hls/ab4e01f9-9840-4430-91bd-253e45f1eb82/238d225d-1eb9-48e8-b7db-7f3ad2463e42-master.m3u8https://nicecrew.tv/videos/embed/n9UanrAGC6JQrejVYijEFU333002024-12-15T00:26:00.792ZDragonscuteanimalsfantasyYESDreamy's LoungeNOhttps://nicecrew.tv/w/udL6kci4tFpjSxfgHxozVhhttps://nicecrew.tv/lazy-static/thumbnails/9392992c-4426-44f5-b7ab-531267c4e700.jpgDrawing: Hoodie manJust a little brushy doodle, please enjoy everyone! Hoodieman: http://rainbowdoodler209.deviantart.com/art/HoodieMan-613912614?ga_submit_new=10%253A1465342229https://nicecrew.tv/static/streaming-playlists/hls/e487faf6-ac4c-4a82-ab4e-95e29b465c76/6527837d-d43e-4f31-8271-3fc15668dfa9-master.m3u8https://nicecrew.tv/videos/embed/udL6kci4tFpjSxfgHxozVh440002024-12-15T00:24:27.400ZAnimecuteAdobe Photoshop CS6doodlebrushesYESDreamy's LoungeNOhttps://nicecrew.tv/w/kcJUVT4cHuq1SKztv2KFHnhttps://nicecrew.tv/lazy-static/thumbnails/bc77f549-d214-49b8-bbd7-711fc26d7325.jpgDrawing: GreediaA drawing of the seven deadly sins as, children, meet Greedia. She is an evil child who likes to have money to herself and would even hurt others for money as well! Please enjoy this drawing! ^^ Greedia: http://rainbowdoodler209.deviantart.com/art/Greedia-614121604?ga_submit_new=10%253A1465429976https://nicecrew.tv/static/streaming-playlists/hls/9b814306-9e47-402f-a562-1f1c638e1103/a60e7a99-94e4-4d28-96b5-edbea205064b-master.m3u8https://nicecrew.tv/videos/embed/kcJUVT4cHuq1SKztv2KFHn441002024-12-15T00:27:32.956ZGreedSeven Deadly Sin girlsAnime girlsYESDreamy's LoungeNOhttps://nicecrew.tv/w/uKkbmn1YqhZBjs3XHDHi7thttps://nicecrew.tv/lazy-static/thumbnails/01f95596-bdf3-4400-a5cc-27ef8232f38a.jpgUpdate with ShilohI'll be having surgery tomorrow for my foot since it's been bothering me so much, I'm pretty nervous to be honest! Have a great summer guys! ♡https://nicecrew.tv/static/streaming-playlists/hls/e8ccaf09-9268-4be6-bf7f-5e8a6b5259f3/8c9a9d9c-31fb-4854-841a-c6142a07c721-master.m3u8https://nicecrew.tv/videos/embed/uKkbmn1YqhZBjs3XHDHi7t117012024-12-15T00:25:34.871ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/922TXaCF8wUK6ct2votqAghttps://nicecrew.tv/lazy-static/thumbnails/1af94954-93b7-4ba5-bce7-c42420713a3f.jpgDrawing: Lemina chibiAnother girl but she loves cakes very much! I hope you guys enjoy this little speed drawing! Like, comment and sub to my channel newcomers for more drawing videos and animations! ^^ Cake loving Slime: http://rainbowdoodler209.deviantart.com/art/Lemina-Chibi-614337850?ga_submit_new=10%253A1465519079https://nicecrew.tv/static/streaming-playlists/hls/40ee0575-6073-44c3-bea6-6feb5de5b29b/b78c22db-7d7a-4a39-86ff-3b5aa87f10c5-master.m3u8https://nicecrew.tv/videos/embed/922TXaCF8wUK6ct2votqAg312002024-12-15T00:27:06.140ZLeminaanimegirlscutechibiAdobe Photoshop CS6YESDreamy's LoungeNOhttps://nicecrew.tv/w/b5sWiKKt1X4PXfJns62f1mhttps://nicecrew.tv/lazy-static/thumbnails/22ca864c-20c9-43ed-8baa-3da282692759.jpgDrawing: 愛して愛してAnother drawing based pff of Kikuo's songs, "Love me love me!" I hope you guys enjoy this cute pink drawing Love Me: http://rainbowdoodler209.deviantart.com/art/love-me-Love-me-614559251?ga_submit_new=10%253A1465609870https://nicecrew.tv/static/streaming-playlists/hls/519af636-b265-47a5-96cf-33c3f268ea04/7f951f01-cef7-4230-b438-fb43d29902e1-master.m3u8https://nicecrew.tv/videos/embed/b5sWiKKt1X4PXfJns62f1m682002024-12-15T00:34:02.774ZSafina the catAnime anthroCatgirlspinkKikuoYESDreamy's LoungeNOhttps://nicecrew.tv/w/rzkugke7FunAR2NBhdQj1Phttps://nicecrew.tv/lazy-static/thumbnails/08c5db05-81a6-45e5-8e11-2704799032a5.jpgDrawing: Safina and SheemaA drawing of Safina and Sheema dancing in a nightly Hawaiian festival, I hope you guys enjoy this drawing video! Like comment and sub for more! Hula Hula:http://rainbowdoodler209.deviantart.com/art/Safina-and-Sheema-614966852?ga_submit_new=10%253A1465772230https://nicecrew.tv/static/streaming-playlists/hls/cf1c0538-9b4c-4ebe-8b84-dfcb815d53b7/525980b1-af1b-462d-8043-438f0c3c7f95-master.m3u8https://nicecrew.tv/videos/embed/rzkugke7FunAR2NBhdQj1P574002024-12-15T00:35:50.028ZSheema LosinecuteanimeanthroSafinaYESDreamy's LoungeNOhttps://nicecrew.tv/w/24MJ7wAKvnCcKga7EuCbTJhttps://nicecrew.tv/lazy-static/thumbnails/9953d034-3e08-4de4-8960-6af21955ac65.jpgDrawing: Catgirl profileAnother new profile picture, I love making catgirl drawings, so here is a drawing of Lucyanna as a cute cat! Please enjoy the video! *Purring*:http://rainbowdoodler209.deviantart.com/art/Lucyanna-Catgirl-615191171?ga_submit_new=10%253A1465864426https://nicecrew.tv/static/streaming-playlists/hls/08a08cb6-fa3f-44f0-9ff8-2c46f4e04d40/b9a370b6-533a-4dcb-89c8-4357275c8c06-master.m3u8https://nicecrew.tv/videos/embed/24MJ7wAKvnCcKga7EuCbTJ478002024-12-15T00:36:51.841ZcuteanimeLucyanna_KimselAnime girlsnyaYESDreamy's LoungeNOhttps://nicecrew.tv/w/aRQULLqnU3MNNUyy7SZvXYhttps://nicecrew.tv/lazy-static/thumbnails/66ca14d7-b6e8-4dfa-85f5-79e9c72a0c4a.jpgDrawing: cute YulkoonAnother little Yukon drawing for you guys to observe, this is basically about a yulkoon being sad and gloomy about the world around her and tries to think about happy thoughts about the good things in life! I hope you guys enjoy the video and have a great night! Yulkoon rots in sadness: http://rainbowdoodler209.deviantart.com/art/Cute-Yulkoon-615417454?ga_submit_new=10%253A1465957663https://nicecrew.tv/static/streaming-playlists/hls/4fd7d59d-f532-4cf6-b89f-5a3ea01c638a/7527a340-0c38-40c8-8b20-fcbd3dc9afdc-master.m3u8https://nicecrew.tv/videos/embed/aRQULLqnU3MNNUyy7SZvXY466002024-12-15T00:43:28.021ZYulkoonscutesadanimeAnime girlsYESDreamy's LoungeNOhttps://nicecrew.tv/w/8oDpmaHjVZTs5RDDkET2P7https://nicecrew.tv/lazy-static/thumbnails/28e10241-b657-4dac-858f-a128b524bc02.jpgDrawing: melachang, neutral and insaneAnother flash drawing but with Melachang in two faces, neutral and insane, I don't know hat else to day here and thank very much for supporting my channel! :') Screech!: http://rainbowdoodler209.deviantart.com/art/Neutral-and-insane-Melechang-615538566?ga_submit_new=10%253A1466016355https://nicecrew.tv/static/streaming-playlists/hls/3bd9623a-0e8b-45a9-b089-04168d61cdc8/d57e07eb-de23-4eef-a9e5-8ea53504b9a9-master.m3u8https://nicecrew.tv/videos/embed/8oDpmaHjVZTs5RDDkET2P7386002024-12-15T00:32:50.135ZAdobe Flash Cs6CuteAnime girlsCreepydemonYESDreamy's LoungeNOhttps://nicecrew.tv/w/p1tPYJP9AwwePxeY1jh7hchttps://nicecrew.tv/lazy-static/thumbnails/6911e4c6-39f4-4055-8b40-36024ec44fba.jpgDrawing: Happy pairA light-hearted drawing about two slime boys becoming friends! That's basically it! When I reach 120 plus subs, I will make a cute cat girl animation for you guys! Happy friends: http://rainbowdoodler209.deviantart.com/art/Happy-Pair-615710575?ga_submit_new=10%253A1466093362https://nicecrew.tv/static/streaming-playlists/hls/ba53569b-58f5-4ac6-89fa-840af3fbafa3/1169b974-45d3-4fed-9f29-4c5b730ca971-master.m3u8https://nicecrew.tv/videos/embed/p1tPYJP9AwwePxeY1jh7hc395002024-12-15T00:44:14.781ZSlime boysslimeanime drawingscutehappyYESDreamy's LoungeNOhttps://nicecrew.tv/w/kEQGFznVmNANTEmzGrp3Jdhttps://nicecrew.tv/lazy-static/thumbnails/124c3abc-7b10-4633-91a7-75914d07d73f.jpgGuess that song: #2Sorry if the speakers are popping, I'm trying to clean the piano with a pixystick, anyways sorry if I did bad on the song I was Justin's waking up from bed! Enjoy! Y(^_^)Yhttps://nicecrew.tv/static/streaming-playlists/hls/9f49e93e-e5ee-4bb8-8a01-eaf67ce94140/03630d14-fed8-40b7-90c3-f93bf5afa860-master.m3u8https://nicecrew.tv/videos/embed/kEQGFznVmNANTEmzGrp3Jd78002024-12-15T00:30:50.499ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/cEGd7d1HuSR5JrVZFomFwkhttps://nicecrew.tv/lazy-static/thumbnails/169e6439-b111-4ca3-9308-ece79beba506.jpgThe boredom songA song about three wood winds trying to think of a song to play!https://nicecrew.tv/static/streaming-playlists/hls/5e7b916a-e5e8-439f-832c-3d64431942fb/765ab4f5-af99-45a8-9686-a3e012a0d360-master.m3u8https://nicecrew.tv/videos/embed/cEGd7d1HuSR5JrVZFomFwk88002024-12-15T00:32:00.641ZGarbageBandcutehappyClarinetBassoonYESDreamy's LoungeNOhttps://nicecrew.tv/w/nzXiGxYGBhQxWvfqTJydsQhttps://nicecrew.tv/lazy-static/thumbnails/a3bd3ed9-6057-4538-9f6b-5e1e3ad18faa.jpgDrawing/ Line up Plebs!I used Adobe Premiere Pro CS6 for editing this video to make it really fast! I hope it's not laggy! If so I'm sorry! :( Left Left: http://rainbowdoodler209.deviantart.com/art/Line-up-Plebs-616034570?ga_submit_new=10%253A1466216803https://nicecrew.tv/static/streaming-playlists/hls/aecd8a0e-89f1-4bd2-b2f1-39f0a1061a44/c083df20-1a75-42bc-a426-ea0a66e01d14-master.m3u8https://nicecrew.tv/videos/embed/nzXiGxYGBhQxWvfqTJydsQ23002024-12-15T00:31:59.304ZArmyMilitary schoolAnime artSpeed drawingcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/sjHZyPme6bSnKCgpenc9hMhttps://nicecrew.tv/lazy-static/thumbnails/da3b113b-e210-4c3d-bce1-7fc861b5d233.jpgMagnum the demonI haven't made an animation in a longtime, so please enjoy! Magnum is a blue cat ghost, but likes to eat souls when people look at her hypnotic red eyes.....for too long!https://nicecrew.tv/static/streaming-playlists/hls/d52adf2f-fa2c-4ea6-b9e7-61c8a832eb55/1a159140-7d0b-460b-b373-b5ef64f44c03-master.m3u8https://nicecrew.tv/videos/embed/sjHZyPme6bSnKCgpenc9hM64002024-12-15T00:32:02.130ZMagnum the demoncuteAdode Flash CS6animationsanimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/pTpU9BHuxmmtMkXSmAfS6Fhttps://nicecrew.tv/lazy-static/thumbnails/18b3c062-2d31-4bb4-8aad-85627a0a6830.jpgDrawing I'm WaitingA little drawing of Magnum, waiting for the sun to fall! Please enjoy the video everyone! Still waiting: http://rainbowdoodler209.deviantart.com/art/I-m-waiting-616160920?ga_submit_new=10%253A1466275226https://nicecrew.tv/static/streaming-playlists/hls/c16fd98c-9530-41bf-9844-893904947821/a4ba3c50-ed0b-4212-8ac6-ef9674436856-master.m3u8https://nicecrew.tv/videos/embed/pTpU9BHuxmmtMkXSmAfS6F95002024-12-15T00:32:17.566ZMagnumdemonchinesecuteredanime artYESDreamy's LoungeNOhttps://nicecrew.tv/w/pfeZbq8EzxfvxnHwPoPkWehttps://nicecrew.tv/lazy-static/thumbnails/36a83b0a-abb8-47a5-ace5-69b1555f75cd.jpgDrawing: GoriaA drawing of Goria who is a zombie girl who likes to see herself split into pieces! I'm sorry if this it's kind of gory but you guys don't seem to mind though! Please enjoy! Gloria the Zombie: http://rainbowdoodler209.deviantart.com/art/Goria-616407776?ga_submit_new=10%253A1466372636https://nicecrew.tv/static/streaming-playlists/hls/bc3f3896-aca1-4917-bf12-28b3897dc40d/434fcc9b-fc68-4aa4-8849-53acb61638ea-master.m3u8https://nicecrew.tv/videos/embed/pfeZbq8EzxfvxnHwPoPkWe293002024-12-15T00:37:30.076ZGoriacreepyanime girlsanime artYESDreamy's LoungeNOhttps://nicecrew.tv/w/khtRS2yJKehi7LrZEbiDpohttps://nicecrew.tv/lazy-static/thumbnails/bd526eb7-5f0f-4079-a0b8-cf56dd8ca6aa.jpgDrawing: Colorful ManAnother colorful drawing but a rainbow made into a man with bright eyes and shall, please enjoy this psycodelic painting everyone! ^^ Colorfull man: http://rainbowdoodler209.deviantart.com/art/Colorful-Man-616657026?ga_submit_new=10%253A1466474037https://nicecrew.tv/static/streaming-playlists/hls/9c2ab439-f335-491d-8ec5-a62d472c8748/4fcb29b5-7d57-456e-9d90-09234e753a38-master.m3u8https://nicecrew.tv/videos/embed/khtRS2yJKehi7LrZEbiDpo288002024-12-15T00:41:37.482ZColorful manPsycodelictrippyanimeAdobe Photoshop CS6YESDreamy's LoungeNOhttps://nicecrew.tv/w/qya7A6wWuvxXA2ajzSwmNmhttps://nicecrew.tv/lazy-static/thumbnails/83674b68-2b63-4537-972e-84344dae222d.jpgDrawing: Keeping coolA drawing of a neko girl trying to keep her cool, @Null Null requested me to use two colors which are dark orange and dark purple! I hope you enjoy! OH! And any newcomers watching, welcome! ^^ Finished drawing: http://rainbowdoodler209.deviantart.com/art/Keeping-cool-616833761?ga_submit_new=10%253A1466546868https://nicecrew.tv/static/streaming-playlists/hls/c6d8beb3-6b43-457a-9f81-e2f5bee380c0/e07f1c3c-afda-47ed-bdea-15c062ddabd9-master.m3u8https://nicecrew.tv/videos/embed/qya7A6wWuvxXA2ajzSwmNm531002024-12-15T00:52:33.996ZNeko girlsTwo colorsAdobe Photoshop CS6Color PaletteYESDreamy's LoungeNOhttps://nicecrew.tv/w/fLiN1UPVf5YapAZLN2JmT9https://nicecrew.tv/lazy-static/thumbnails/c8ae5721-27e9-4c0e-be69-5a9631e2ba02.jpgDrawing: Monster GirlA little monster girl drawing, I hope you guys enjoy the drawing! I'm sorry if the drawing hurts your eyes because of some bright colors I used! Please enjoy the video! Monster girl: http://rainbowdoodler209.deviantart.com/art/Monster-Girl-617091675?ga_submit_new=10%253A1466648450https://nicecrew.tv/static/streaming-playlists/hls/778fa1f7-12fd-4574-826b-44c168049246/0a5ba1a1-0e6d-41a5-a977-33ed5e3c4db5-master.m3u8https://nicecrew.tv/videos/embed/fLiN1UPVf5YapAZLN2JmT9741002024-12-15T01:01:09.974Zmonstersanime girlscolorfulAdobe Photoshop CS6YESDreamy's LoungeNOhttps://nicecrew.tv/w/trazK26KUaTVt3HDXkFY8Ghttps://nicecrew.tv/lazy-static/thumbnails/a176d44b-3d27-4a07-9c37-b518b2ea220f.jpgDrawing: Encountering PhenaiI'm curretly making the 120 plus special video! I hope you guys enjoy this cute little monster cartoon! Enjoy! ^^ Finished monster drawing: http://rainbowdoodler209.deviantart.com/art/Encountering-Phenai-617313466?ga_submit_new=10%253A1466739177https://nicecrew.tv/static/streaming-playlists/hls/de2a3e37-8d04-403a-a729-2bec69af8d06/cd23921e-7646-47c3-b325-36668fb5fb70-master.m3u8https://nicecrew.tv/videos/embed/trazK26KUaTVt3HDXkFY8G356002024-12-15T00:48:31.669ZcutemonsterscartoonsSketchbookpro7YESDreamy's LoungeNOhttps://nicecrew.tv/w/cWcuaXQPpgEntDJeb3qYJ2https://nicecrew.tv/lazy-static/thumbnails/3479f011-fe25-4803-a57e-5a92dd77d317.jpg120+ Subs Special: Oil NekogirlAnother flash animation for 120+ subs special, please enjoy the video! ^^https://nicecrew.tv/static/streaming-playlists/hls/60a5c465-0537-4371-af2b-66b273a850c5/9bb539d9-4acf-48f3-9869-3f17aad7ce7e-master.m3u8https://nicecrew.tv/videos/embed/cWcuaXQPpgEntDJeb3qYJ234002024-12-15T00:33:21.779ZAdobe Flash CS6cuteanimationsAnime girlneko girlsYESDreamy's LoungeNOhttps://nicecrew.tv/w/aV1qjuYB2WarDpZ4YPMfcDhttps://nicecrew.tv/lazy-static/thumbnails/1cd2d209-ccd6-4a95-9ce3-f12f56c1e11f.jpgDrawing: Wolf GirlA cute drawing of a crying wolf girl because why not! ^^ Please enjoy the video and sub to my channel! Woof woof: http://rainbowdoodler209.deviantart.com/art/Wolf-Girl-617726367?ga_submit_new=10%253A1466912111https://nicecrew.tv/static/streaming-playlists/hls/5048ed18-0928-42b6-8c5d-87a2920de2d3/4832d4ea-b6cc-4c0f-89a2-bc3abbe7eced-master.m3u8https://nicecrew.tv/videos/embed/aV1qjuYB2WarDpZ4YPMfcD343002024-12-15T00:49:46.343ZAnimeWolf GirlColorfulcryingYESDreamy's LoungeNOhttps://nicecrew.tv/w/p7bRfov7wwKZaGA6yAtF9uhttps://nicecrew.tv/lazy-static/thumbnails/d2edcdef-8267-48c2-a968-febb165e174b.jpgDrawing: Robot cat girlA drawing of a robot cat girl who is not finished, and also created by Lucyanna when she was bored! I hope everyone enjoys this video, newcomers welcome also! ^^ Bleep bloop: http://rainbowdoodler209.deviantart.com/art/Robot-Cat-girl-617916601?ga_submit_new=10%253A1466990872https://nicecrew.tv/static/streaming-playlists/hls/bb1f5679-ee99-416f-b761-0884927ec700/d4ed6b1e-455c-49a2-982b-93bc51e13177-master.m3u8https://nicecrew.tv/videos/embed/p7bRfov7wwKZaGA6yAtF9u885002024-12-15T01:05:01.095ZAnime drawingSketchbookPro7pencil and PenDigital drawingcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/dHbVJcwMLUXEj3QfWCyC29https://nicecrew.tv/lazy-static/thumbnails/80916b3b-bc36-44e3-bf55-0b7a033eb382.jpgDrawing: Prideful TheadoreAnother drawing of the evil human clarinet, he likes painting his grounds in blood to say... I hope you guys enjoy the video and stuff! Theodore wants to see you: http://rainbowdoodler209.deviantart.com/art/Prideful-Theadore-618128406?ga_submit_new=10%253A1467076061https://nicecrew.tv/static/streaming-playlists/hls/66ede45f-a64c-4484-8063-0858a16099d2/0afb8d0e-840e-4e89-a211-d76ef379fab6-master.m3u8https://nicecrew.tv/videos/embed/dHbVJcwMLUXEj3QfWCyC29933002024-12-15T01:05:58.177ZClarinetanime drawingPen toolspeed drawingAdobe Photoshop CS6YESDreamy's LoungeNOhttps://nicecrew.tv/w/5yxDJcmV3R86p8XMCp1dvbhttps://nicecrew.tv/lazy-static/thumbnails/ba99e876-1b3d-43dc-b21b-5bc4430b8c5c.jpgDrawing: Three monstersA little drawing of three multi-colored monsters! I hope you guys enjoy this cute speed doodle thing! That is all! Three's a crowd: http://rainbowdoodler209.deviantart.com/art/Three-monsters-618351451?ga_submit_new=10%253A1467166637https://nicecrew.tv/static/streaming-playlists/hls/24efdc4e-d436-4c21-80bf-054d62704efc/12fb382f-3263-4375-8f66-87cd2fb58434-master.m3u8https://nicecrew.tv/videos/embed/5yxDJcmV3R86p8XMCp1dvb180002024-12-15T00:47:13.256ZmonstersanimesmallYESDreamy's LoungeNOhttps://nicecrew.tv/w/2qqHXqWbJRgWUnpYhJis7ehttps://nicecrew.tv/lazy-static/thumbnails/a6d99a17-387c-4d39-8dfc-6f7e1c609da3.jpgShape shifterAnother little flash animation before I go to bed, please enjoy everyone! ^^https://nicecrew.tv/static/streaming-playlists/hls/0b8239b7-c7f0-42ff-ab1e-f80be71d1ed9/5edeaa49-af31-4a60-96ee-b3d796be4a29-master.m3u8https://nicecrew.tv/videos/embed/2qqHXqWbJRgWUnpYhJis7e16002024-12-15T00:41:31.631ZAdobe Flash CS6surrealoddstrangemonstersYESDreamy's LoungeNOhttps://nicecrew.tv/w/iz8tFG1RBAKzsJiGyiYQ33https://nicecrew.tv/lazy-static/thumbnails/7ce4f40c-ada1-4c80-9f38-3629e2e5b521.jpgDrawing: Silverfish girlI just wanted to draw another silverfish drawing! I hope everyone enjoys this video and stuff! A shy Silverfish appears: http://rainbowdoodler209.deviantart.com/art/Silverfish-Girl-618583247?ga_submit_new=10%253A1467257878https://nicecrew.tv/static/streaming-playlists/hls/8e4b827a-ffcb-4706-917b-19565eac9886/b98ced4b-b282-4cbc-b3db-ae6ba31388a5-master.m3u8https://nicecrew.tv/videos/embed/iz8tFG1RBAKzsJiGyiYQ33289002024-12-15T00:52:36.051ZAnimeanime girlscolorfulAdobe Photoshop CS6YESDreamy's LoungeNOhttps://nicecrew.tv/w/swUq2CPvsmWGSR43mZJSiPhttps://nicecrew.tv/lazy-static/thumbnails/00fe87d4-05c2-4ec8-a6a6-dc8d2595e401.jpgI talk about: Russian candy and moreAnother I talk about video! I was running out of ideas since, well... I was making my little cartoon! I hope you guys enjoy this video and the drawing! Have a cup: http://rainbowdoodler209.deviantart.com/art/Forest-Coffee-618718780?ga_submit_new=10%253A1467318478https://nicecrew.tv/static/streaming-playlists/hls/d6de383e-b5e4-4f46-8725-3e0a628d99b1/08778a11-49d3-4e25-bb65-23e9ad84d62b-master.m3u8https://nicecrew.tv/videos/embed/swUq2CPvsmWGSR43mZJSiP646002024-12-15T01:02:01.835ZcutecartoonsForestsCrittersfantasyYESDreamy's LoungeNOhttps://nicecrew.tv/w/d8VsXKjpsAxhmeJK8SBzQwhttps://nicecrew.tv/lazy-static/thumbnails/6a05a3a7-f4d9-479f-946e-4028e335cdec.jpgDrawing: Water demonA cute water fox demon named Enali, who will pull you down the lake where she lives! Don't wander around her lake too much, or else she'll drown you on the spot! I hope you guys enjoy this lovely drawing and that is all! ^^ She's watching: http://rainbowdoodler209.deviantart.com/art/Water-demon-618795916https://nicecrew.tv/static/streaming-playlists/hls/6248d1b6-9ebd-442c-8e44-c671e562875a/7215b0a1-a07d-4f30-94a4-90fe24127af5-master.m3u8https://nicecrew.tv/videos/embed/d8VsXKjpsAxhmeJK8SBzQw457002024-12-15T00:58:59.472ZDemonschineseEnaliAnime girlsfantasyYESDreamy's LoungeNOhttps://nicecrew.tv/w/3qHQP3xwsLPNVmmzpgkpivhttps://nicecrew.tv/lazy-static/thumbnails/e20e697a-e883-4be9-b9c2-288fb1f88416.jpgHake the fire demonA little cute animation of Hake the fire demon! Please enjoy this cute animation video!https://nicecrew.tv/static/streaming-playlists/hls/13a5e9e0-a5e7-4753-90a4-7d850b159ebb/dc341f8d-2f11-4daa-a9f9-96ecf19ac94a-master.m3u8https://nicecrew.tv/videos/embed/3qHQP3xwsLPNVmmzpgkpiv18002024-12-15T00:47:24.882ZPurpleAnimationAdobe Flash CS6demonYESDreamy's LoungeNOhttps://nicecrew.tv/w/cHmGy21xxMdasZf5Pfj4Qihttps://nicecrew.tv/lazy-static/thumbnails/da081ca5-2bcb-4f33-aa0a-7b25f26e2c01.jpgFlash doodle: HakeA cute flash drawing of Hake and her little demon mask! Enjoy this video! ^^ Finished drawing: http://rainbowdoodler209.deviantart.com/art/Hake-the-demon-618911981?ga_submit_new=10%253A1467398455https://nicecrew.tv/static/streaming-playlists/hls/5edac6b1-a8df-46e5-ba80-52e51d2bd56d/9652317a-c51b-4689-8ebe-cda2faf4e08f-master.m3u8https://nicecrew.tv/videos/embed/cHmGy21xxMdasZf5Pfj4Qi484002024-12-15T01:00:39.065ZcuteAdobe Flash CS6demonAnimepurpleYESDreamy's LoungeNOhttps://nicecrew.tv/w/atcCUZVHy5wjWyXM1zNb9fhttps://nicecrew.tv/lazy-static/thumbnails/d8ecf128-71ec-49ab-86b1-6bfa05fe0169.jpgThree beingsAnother little animation for you guys since you're loving my animations! Please enjoy! ^^https://nicecrew.tv/static/streaming-playlists/hls/4cae803d-d58b-4d69-9b79-8d456d913646/437e70cb-66aa-494c-8715-75229558492f-master.m3u8https://nicecrew.tv/videos/embed/atcCUZVHy5wjWyXM1zNb9f20002024-12-15T00:47:26.401ZAnimationsAdobe Flash CS6colorfulsurrealmonstersYESDreamy's LoungeNOhttps://nicecrew.tv/w/qZPcDEf3Y8B5kSjUDZxr9jhttps://nicecrew.tv/lazy-static/thumbnails/cce68b26-f7dd-4201-9474-2927b9ac3616.jpgSad dissapearingsAnother animation since you lovely subs and new comers wanted! Well the new comers just came here so welcome! ^^https://nicecrew.tv/static/streaming-playlists/hls/ca6dcfb0-8267-438a-8afb-a11bb82017ee/b3686e0e-a8a3-45ca-a96a-2f22d524f74d-master.m3u8https://nicecrew.tv/videos/embed/qZPcDEf3Y8B5kSjUDZxr9j17002024-12-15T00:50:40.324ZAnimationstrangesurrealmonsterscuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/54XWVTph3vjKS71QtUYnBuhttps://nicecrew.tv/lazy-static/thumbnails/1d227e22-5b87-4cbc-ae04-1c374989a2a6.jpgSafina and laser pointerAnother animation video of Safina, please enjoy this cute animation!https://nicecrew.tv/static/streaming-playlists/hls/20f243b9-5027-4ef6-b109-9c23e08455de/8dd0e111-bc99-4032-9ee9-161e230f7144-master.m3u8https://nicecrew.tv/videos/embed/54XWVTph3vjKS71QtUYnBu28002024-12-15T00:50:41.864ZAnimeAnthroColorfulcuteAdobe Flash CS6YESDreamy's LoungeNOhttps://nicecrew.tv/w/cotevarR86JF3xLpASGMc8https://nicecrew.tv/lazy-static/thumbnails/8800c0da-b858-4122-b1e6-8e56919d0bb1.jpgDrawing: My upcoming BirthdayHere's a little birthday drawing for fun and for the fact that my birthday is coming real soon in three days!I hope you guys enjoy this drawing video! Happy Early bird: http://rainbowdoodler209.deviantart.com/art/My-Upcoming-B-day-619208192?ga_submit_new=10%253A1467513156https://nicecrew.tv/static/streaming-playlists/hls/5c37abc7-8aaf-4492-a48c-c601b3f68139/bb8c1e51-26a4-4bc6-8c60-adc2f48bffc7-master.m3u8https://nicecrew.tv/videos/embed/cotevarR86JF3xLpASGMc8522002024-12-15T01:02:40.277ZAdobe Photoshop CS6Safina_the_catanimeBirthdaycuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/2iDoyq3DbtyP1kNCgpTK82https://nicecrew.tv/lazy-static/thumbnails/faa66e0e-ff2c-40a6-9c90-51ebc2ba57b8.jpgRequests: How to draw an anus and how to act like a MermaidThese are two requests by two people, I hope you guys love the video (It felt rushed to honest) but please enjoy everyone and new comers! ^^https://nicecrew.tv/static/streaming-playlists/hls/0a8fd312-ded6-4c75-875b-7d196d9f006b/78c1a794-11de-44df-b023-a286d46940ea-master.m3u8https://nicecrew.tv/videos/embed/2iDoyq3DbtyP1kNCgpTK82176002024-12-15T00:55:24.427ZTutorialscartoonsrequestsdrawingYESDreamy's LoungeNOhttps://nicecrew.tv/w/jWXhh8ZMnheaWWpctqZJYehttps://nicecrew.tv/lazy-static/thumbnails/f60790af-294f-42a1-9d44-b9ea5b5b305a.jpgdrawing: Can you come closerAnother drawing of melechang! I was planning on uploading this on my second channel but.....meh! I hope you guys like it! ^^ Come here stranger: http://rainbowdoodler209.deviantart.com/art/Can-you-come-closer-619426927https://nicecrew.tv/static/streaming-playlists/hls/9970ba35-595a-4c32-91c8-894505c51d2d/90464a10-2b54-4deb-9dd5-7c9a01ec5ec9-master.m3u8https://nicecrew.tv/videos/embed/jWXhh8ZMnheaWWpctqZJYe465002024-12-15T01:07:35.346Zcreepy horroranime girlsdemonsAdobe Photoshop CS6YESDreamy's LoungeNOhttps://nicecrew.tv/w/ddZQ9k3mcNYFZQY2a46h9qhttps://nicecrew.tv/lazy-static/thumbnails/9ace6158-d0ff-4616-9f49-580bcccf2e60.jpgFlying blobAnother little animation! please enjoy! ^^https://nicecrew.tv/static/streaming-playlists/hls/62fe3a6b-6eef-468a-bb76-9983d2d1e900/cc880450-55b0-4854-ab79-8b7cc54c2321-master.m3u8https://nicecrew.tv/videos/embed/ddZQ9k3mcNYFZQY2a46h9q4002024-12-15T00:54:10.434ZanimationAdobe Flash CS6blobsstrangewingsYESDreamy's LoungeNOhttps://nicecrew.tv/w/joCRXX287j9EmyVWxxoS3ehttps://nicecrew.tv/lazy-static/thumbnails/d293fa39-a562-4b9c-84e9-9a6b8f007a3a.jpgDrawing: Mono BlobAnother drawing video but based off of an animation I just made which is really short! Oh well! Please enjoy this lovely 5 minute video! Hello though: http://rainbowdoodler209.deviantart.com/art/Mono-Blob-619763807?ga_submit_new=10%253A1467746890https://nicecrew.tv/static/streaming-playlists/hls/94ed9354-0b0d-4e83-ae55-993b8fb14249/51b8da4f-bbeb-45bf-b324-b50071e23c4a-master.m3u8https://nicecrew.tv/videos/embed/joCRXX287j9EmyVWxxoS3e175002024-12-15T00:59:23.599ZAdobe Photoshop CS6palemonochromecutecartoonsYESDreamy's LoungeNOhttps://nicecrew.tv/w/f3yvsS3tV4tgNY6dNZEoBJhttps://nicecrew.tv/lazy-static/thumbnails/c9468b13-bee1-46f2-980d-2fb641c4e417.jpgDrawing/ BBomg02A little request by BBomg02, I hope you like it too! That's basically it really for the description! ^^ Peek a Boo: http://rainbowdoodler209.deviantart.com/art/BBomg02-620041296?ga_submit_new=10%253A1467852675https://nicecrew.tv/static/streaming-playlists/hls/71bb7668-de0e-4010-9086-8ef5a8b99df0/f3b09366-c4b0-4622-875e-e20936598728-master.m3u8https://nicecrew.tv/videos/embed/f3yvsS3tV4tgNY6dNZEoBJ582002024-12-15T01:10:40.992ZAnime girlsAdobe Photoshop CS6dark colorscolorfulcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/kA6U6kGbD6RCSQSVvJ1mV3https://nicecrew.tv/lazy-static/thumbnails/9ff856df-7946-437a-bf8d-63bfdcab06cc.jpgRequest: How to Worshop ShrekA request by Null Null, I hope you like it everyone! ^^ The finished drawing will be below when I'm done! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Hello-Kitty-and-Mimmie-620174168https://nicecrew.tv/static/streaming-playlists/hls/9ea08ebd-5f2f-4c0d-b618-62712dd46ed4/b422bcf1-f1c5-4370-8250-594691bdb30c-master.m3u8https://nicecrew.tv/videos/embed/kA6U6kGbD6RCSQSVvJ1mV3271002024-12-15T01:04:05.669ZTutorialscuteShrekRandomYESDreamy's LoungeNOhttps://nicecrew.tv/w/uWcppw9hYQyMa6msQj51wFhttps://nicecrew.tv/lazy-static/thumbnails/379817b1-9cd3-4e06-b0e9-39385643bc22.jpgBirds and monstersAnother short animation, I couldn't think of a title for this animation! ^^ Please enjoy!https://nicecrew.tv/static/streaming-playlists/hls/ea5112e0-d174-465a-957b-30c49e3ba033/8b3bc77c-f2fa-4f47-8bf8-cb54fdeffa4e-master.m3u8https://nicecrew.tv/videos/embed/uWcppw9hYQyMa6msQj51wF8002024-12-15T00:59:36.758ZAnimationsAdobe Flash CS6monsterssurrealcartoonsYESDreamy's LoungeNOhttps://nicecrew.tv/w/aXckghBvhca1N2ZYoaGHswhttps://nicecrew.tv/lazy-static/thumbnails/56a92be3-5d80-42ab-b50b-1bd3531db528.jpgBitta AngelAn animation based off of the video, "Bitta" by Piñata gamer! Please enjoy this animation! ^^https://nicecrew.tv/static/streaming-playlists/hls/50972393-19fb-4ac8-812a-0c5c3fe3a1d6/044718ac-c086-4f10-90e5-25dc85662d8b-master.m3u8https://nicecrew.tv/videos/embed/aXckghBvhca1N2ZYoaGHsw8002024-12-15T01:01:13.318ZAdobe Flash CS6animationsangelsweirdsurrealYESDreamy's LoungeNOhttps://nicecrew.tv/w/vSvbabc1SxyqiUUi9wXMGZhttps://nicecrew.tv/lazy-static/thumbnails/8f394b50-7f66-454f-a294-302209f58026.jpgDrawing: Hake the fire demonAnother little drawing, but with Hake the purple demon! I wanted to make another drawing for you guys! Enjoy! Hake is watching...: http://rainbowdoodler209.deviantart.com/art/Hake-the-demon-620594451?ga_submit_new=10%253A1468087440https://nicecrew.tv/static/streaming-playlists/hls/f1e63080-6958-4304-9c41-d34eb3041655/5e49affa-0dff-4d0a-84d6-f2cb7cd1e42f-master.m3u8https://nicecrew.tv/videos/embed/vSvbabc1SxyqiUUi9wXMGZ731002024-12-15T01:16:46.456ZHake the demonfirecutepurpleyellowYESDreamy's LoungeNOhttps://nicecrew.tv/w/egoDPPe2LWGurArpbVYyzwhttps://nicecrew.tv/lazy-static/thumbnails/08a456d7-be68-4473-b3fd-36497c61fdee.jpgMonsters and blueAnother animation but with the color blue named Monsterine! Please enjoy everyone! ^^https://nicecrew.tv/static/streaming-playlists/hls/6b6ceb44-3c1e-474b-91a2-41bb1df483a8/290aa0a0-6191-456b-b3c2-d6c5e9939908-master.m3u8https://nicecrew.tv/videos/embed/egoDPPe2LWGurArpbVYyzw9002024-12-15T01:02:07.477ZAdobe Flash CS6animationsstrangemonstersYESDreamy's LoungeNOhttps://nicecrew.tv/w/6X16DywLvcKksKktSd2mD7https://nicecrew.tv/lazy-static/thumbnails/2095e6a3-60df-44d8-a82d-0487a8b06fc0.jpgDrawing: MS CatgirlAnother MS paint drawing, sorry if this drawing looks sloppy! I wanted to goof around with the brushes again! ^^ Enjoy!https://nicecrew.tv/static/streaming-playlists/hls/302ba920-df21-4811-b285-566e57de72a0/f9505037-9a41-4b22-9382-b1fa0d4134a7-master.m3u8https://nicecrew.tv/videos/embed/6X16DywLvcKksKktSd2mD7940002024-12-15T01:25:12.923ZMS Paintcuteanime girlnekogirlYESDreamy's LoungeNOhttps://nicecrew.tv/w/umBgifxbNB7qu9JiW9KXXthttps://nicecrew.tv/lazy-static/thumbnails/46bf4d56-7782-46e0-ab97-c82a3d53781a.jpgI made a drawing! ^^For some reason when I was recording it won't let me draw for a little while and it freaks out.....I dunno why! Hope you guys enjoy this short drawing showcase! ^^https://nicecrew.tv/static/streaming-playlists/hls/e5a07d6c-82b2-4e92-ad9e-7728c414bf85/b352c346-5fb7-4a46-82bb-cab9886d5e6b-master.m3u8https://nicecrew.tv/videos/embed/umBgifxbNB7qu9JiW9KXXt16002024-12-15T01:04:39.735ZAliensanimeClip studio paint!YESDreamy's LoungeNOhttps://nicecrew.tv/w/edGcnXnvheYtpZb9AMQFSxhttps://nicecrew.tv/lazy-static/thumbnails/0fb49d6f-7fb6-4efa-a99e-884b6e1f470a.jpgPositivityAnother animation because why not! I'll just make some animations since you guys love them so much! ^^https://nicecrew.tv/static/streaming-playlists/hls/6b0c7fe5-94d3-480d-975d-c0855bbcc47f/1f81c73e-af9e-4315-828b-87c8e1dc2323-master.m3u8https://nicecrew.tv/videos/embed/edGcnXnvheYtpZb9AMQFSx6002024-12-15T01:05:01.099ZHappypastelAdobe Flash CS6monstersanimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/qSaKWNcBKvEFmkTMjWTXbPhttps://nicecrew.tv/lazy-static/thumbnails/c6820153-b7e8-43b6-abb2-e71a8cf7c2d4.jpgDrawing: Ronia Lee the Tarreon DictatorShe is the dictator of Planet Tarreon, she can be aggressive and would literally kick others out of her office for being nice! Pleas enjoy everyone! This drawing is on my Tumblr! :)https://nicecrew.tv/static/streaming-playlists/hls/c95c879b-8109-4d1f-bc66-43f657bbf987/f78495af-9c82-4f34-b5a2-cdc043ede1dd-master.m3u8https://nicecrew.tv/videos/embed/qSaKWNcBKvEFmkTMjWTXbP33002024-12-15T01:05:04.871ZAnimeアニメPen and inkpaper drawingsspeedpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/wW5FigUtekbrroeqiQy9oYhttps://nicecrew.tv/lazy-static/thumbnails/e651d6a1-4472-44e3-905c-f086ab30bcdc.jpgDrawing: Moon flower girl 2A cute little anime girl who is born from the moon! I hope you guys enjoy everyone! I'll probably get a new screen recorder for Clip studio paint! Any suggestions? Moon flower girl: http://rainbowdoodler209.deviantart.com/art/Moon-flower-girl-2-621714189?ga_submit_new=10%253A1468548819https://nicecrew.tv/static/streaming-playlists/hls/fa7f34bd-d3fd-41a9-8099-944166d65874/2b83bfef-cc52-4fdb-9d99-b6d505564830-master.m3u8https://nicecrew.tv/videos/embed/wW5FigUtekbrroeqiQy9oY429002024-12-15T01:15:31.381ZAnime girlMoon flowersspeedpaintCutemoon flowersYESDreamy's LoungeNOhttps://nicecrew.tv/w/2nvUqJH7W2ee1mityeAs84https://nicecrew.tv/lazy-static/thumbnails/254929fc-7cc6-4949-bfce-b33974b0b416.jpgLucyanna's songAn Animation based off of Lucyanna being an UTAUloid.... Enjoy everyone! ^^https://nicecrew.tv/static/streaming-playlists/hls/0b1a2fcf-e944-4cc7-a106-821247ad29a1/ffbe7524-42cd-4f31-be1b-58877dc62e9c-master.m3u8https://nicecrew.tv/videos/embed/2nvUqJH7W2ee1mityeAs848002024-12-15T01:05:27.953ZLucyanna_Kimselanimeblack and yellowAdobe Flash CS6cartoonsYESDreamy's LoungeNOhttps://nicecrew.tv/w/rti6XAunavWJrS6FfAutmUhttps://nicecrew.tv/lazy-static/thumbnails/c57319a3-f417-4d25-a6bc-834d902c197c.jpgUtau staticI finally have sound to this video, I made the other two UTAU videos unlisted because.....why not! Enjoy....I guess! :/https://nicecrew.tv/static/streaming-playlists/hls/ce441695-d20a-413b-aeb2-d7224b8f3b08/7872a9d0-3c6f-4835-ba0a-1fb1e87a4ac7-master.m3u8https://nicecrew.tv/videos/embed/rti6XAunavWJrS6FfAutmU21002024-12-15T01:05:38.380ZUTAULucyanna UTAUUTAU testYESDreamy's LoungeNOhttps://nicecrew.tv/w/qm4w4oLQSWt2czfsJaWsk5https://nicecrew.tv/lazy-static/thumbnails/e87f9d90-839b-4e7d-813a-12897bc1bb34.jpgLittle Envious MonsterAnother monster animation I made, It's about a little pale monster dreaming to be a dragon! Enjoy!https://nicecrew.tv/static/streaming-playlists/hls/c5285f16-941d-4085-8725-25eed241b0ba/fe3871e3-6df0-412f-ab89-4011208de47e-master.m3u8https://nicecrew.tv/videos/embed/qm4w4oLQSWt2czfsJaWsk59002024-12-15T01:05:47.976ZAdobe Flash CS6MonsterscutesadhopefulYESDreamy's LoungeNOhttps://nicecrew.tv/w/1RggWzkNDzawuZ1mZeqsQ5https://nicecrew.tv/lazy-static/thumbnails/aabcf1af-72b8-4447-a694-c4f0dbf287b8.jpgTSMB2 VS Ryth MelAn animation requested by @TSMB2, I hope you guys enjoy this little animation!https://nicecrew.tv/static/streaming-playlists/hls/06e0dbb2-24c3-460a-bf4a-441341b98cbc/c4707c52-8715-4e64-844b-7366da53efc2-master.m3u8https://nicecrew.tv/videos/embed/1RggWzkNDzawuZ1mZeqsQ511002024-12-15T01:05:49.475ZTSMB2MidiPianoAngelsAdobe Flash CS6AnimationsYESDreamy's LoungeNOhttps://nicecrew.tv/w/fqon1gjFiQGMQgk23uScEJhttps://nicecrew.tv/lazy-static/thumbnails/33036cd0-bd12-4720-a743-10b8c067814a.jpgDrawing: Neko schoolgirlI haven't made a drawing video in a while! I realized that I have to update my computer! Anyways! I hope you guys enjoy this cute drawings! :) Finished drawing: http://rainbowdoodler209.deviantart.com/art/Neko-schoolgirl-622529622?ga_submit_new=10%253A1468898724https://nicecrew.tv/static/streaming-playlists/hls/74c792a8-7406-492c-ba76-02e46cc85ee2/b62e710a-43a0-4f30-9203-1cba3793ee88-master.m3u8https://nicecrew.tv/videos/embed/fqon1gjFiQGMQgk23uScEJ334002024-12-15T01:13:42.452ZAnime girlsNeko girlsAnime artClip Studio PaintcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/wtuXXciQcCqs7Gcfn9Qr9Hhttps://nicecrew.tv/lazy-static/thumbnails/db55def3-6bc3-4f0f-87bd-a25264107556.jpgDrawing: Citrus SafinaI was gonna make another guro drawing but I'll making that after this is posted! I hope you guys enjoy this cute citrus colored drawing! Nya: http://rainbowdoodler209.deviantart.com/art/Citrus-Safina-622738474?ga_submit_new=10%253A1468981302&ga_type=edit&ga_changes=1&ga_recent=1https://nicecrew.tv/static/streaming-playlists/hls/f6c9177a-4f33-4f84-bdaf-b63f4958779d/7baedb42-4c3c-4b2b-8893-cf9991130512-master.m3u8https://nicecrew.tv/videos/embed/wtuXXciQcCqs7Gcfn9Qr9H760002024-12-15T01:23:54.281ZSafina_the_catpastel colorsNeko girlsanthroClip studio Paint ProYESDreamy's LoungeNOhttps://nicecrew.tv/w/fP7sVu7Cm7e48BgqhiQo6Shttps://nicecrew.tv/lazy-static/thumbnails/aea275b1-df98-4f1d-87fc-f1f90d65c80c.jpgDrawing: Unhappy RandelAnother drawing of Randel Fingerstein, except a little unhappy! That is all sadly! I wanted to draw Randel again! You guys can send me requests! By the way, the euro Magnum drawing video! It's in my other channel! ^^ I'm Sad: http://rainbowdoodler209.deviantart.com/art/Unhappy-Randel-622957039?ga_submit_new=10%253A1469065513https://nicecrew.tv/static/streaming-playlists/hls/77f3e1d2-90e6-45ac-ad71-4279c8aca27c/0699f585-929d-4b4f-a413-477f9886665f-master.m3u8https://nicecrew.tv/videos/embed/fP7sVu7Cm7e48BgqhiQo6S387002024-12-15T01:18:17.403ZRandel_FingersteinaleinYESDreamy's LoungeNOhttps://nicecrew.tv/w/fauiAQJimaTRBeKdmL6DKShttps://nicecrew.tv/lazy-static/thumbnails/d4623bc4-73d6-4f3a-bf46-fbcc46b19965.jpgGuess the song: #3Here's a hint for you! I played this in garage band once! ;)https://nicecrew.tv/static/streaming-playlists/hls/72b313ea-8046-40e6-b6a2-7efd4926b7ac/28f02673-7770-4a49-a4c5-56a20a7f047a-master.m3u8https://nicecrew.tv/videos/embed/fauiAQJimaTRBeKdmL6DKS73002024-12-15T01:12:04.137ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/hRVYgbrkzjonTjFtzt9LZWhttps://nicecrew.tv/lazy-static/thumbnails/9dd265bd-5abc-46ab-8914-157bb0042485.jpgDrawing: Alien studentA student alien taking notes for a galactic school in planet Tarreon! I hope you guys enjoy this cute drawing! The teacher a talk with you: http://rainbowdoodler209.deviantart.com/art/Alien-Student-623145671?ga_submit_new=10%253A1469145104https://nicecrew.tv/static/streaming-playlists/hls/888aec6a-a6fc-4e8b-83e8-8c399f11d120/254e7d41-b10b-442d-b897-f4076aba6342-master.m3u8https://nicecrew.tv/videos/embed/hRVYgbrkzjonTjFtzt9LZW565002024-12-15T01:23:21.249ZCuteAlienAnime artworkClip Studio Paint ProYESDreamy's LoungeNOhttps://nicecrew.tv/w/11jZr5Dt2emCA8es6EyPjfhttps://nicecrew.tv/lazy-static/thumbnails/aa7ab725-0c0b-4ffb-8be5-72a0bc850b6f.jpgRandomnessAnother little flash animation, sorry for lagging on uploading! Please enjoy the show!https://nicecrew.tv/static/streaming-playlists/hls/000bb400-abb9-44fc-95cd-35562eb1753e/27744de5-1f34-40dd-8b88-ffdd2935bb88-master.m3u8https://nicecrew.tv/videos/embed/11jZr5Dt2emCA8es6EyPjf9002024-12-15T01:16:09.629ZAdobe Flash CS6AnimationscutesurrealweirdYESDreamy's LoungeNOhttps://nicecrew.tv/w/wcPbcYRidwYifPDZA88y5nhttps://nicecrew.tv/lazy-static/thumbnails/8e87c58b-2bb7-4426-88dc-761ac7b0f38a.jpgDrawing: YueXin is mourningA little drawing video of the moon Goddess YueXin! I hope you guys enjoy this video and I'm sorry for lagging! YueXin are you okay?: http://rainbowdoodler209.deviantart.com/art/YueXin-is-mourning-623406455?ga_submit_new=10%253A1469253788https://nicecrew.tv/static/streaming-playlists/hls/f4986a1c-7ee2-446c-ab15-490c1ba27f05/f5686f8e-cfa7-477d-87e3-f6004d76e2fa-master.m3u8https://nicecrew.tv/videos/embed/wcPbcYRidwYifPDZA88y5n381002024-12-15T01:23:13.623ZMoon GoddessAnimeClipstudioPaintProcolorfulcute/KawaiiYESDreamy's LoungeNOhttps://nicecrew.tv/w/u7LMFJH29fKhEXiA5nYzmRhttps://nicecrew.tv/lazy-static/thumbnails/d5a3e1f6-ebe1-4956-9678-73a4b70d419b.jpgDrawing: Hake in the fieldsHake is in the fields releasing little "fire petals" on the land to burn everything pretty much! Please enjoy! Hake: http://rainbowdoodler209.deviantart.com/art/Hake-in-the-fields-623556938?ga_submit_new=10%253A1469321746https://nicecrew.tv/static/streaming-playlists/hls/e3b1f24c-d1df-488b-a44c-4667371929ed/1e54ee2b-02ad-45c2-99ec-497bbf286b3b-master.m3u8https://nicecrew.tv/videos/embed/u7LMFJH29fKhEXiA5nYzmR453002024-12-15T01:25:37.507ZCutepurplecolorfulClipStudioPaintProanimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/4LUN37kkMMLTrr31keVRbHhttps://nicecrew.tv/lazy-static/thumbnails/ea3ab9be-dadd-48c2-894c-cca31c18fd08.jpgMy new youtube BackgroundThis is me finishing my new youtube back ground! Please enjoy everyone! I was bored when I made this! Meow: http://rainbowdoodler209.deviantart.com/art/Yellow-kitty-623642295?ga_submit_new=10%253A1469365035https://nicecrew.tv/static/streaming-playlists/hls/1e90ad59-db20-43d5-842b-6124e3dcc949/d08ff3e6-507a-45a3-95f6-c8ffefae0bbb-master.m3u8https://nicecrew.tv/videos/embed/4LUN37kkMMLTrr31keVRbH336002024-12-15T01:23:56.133ZCatsboreddrawingYESDreamy's LoungeNOhttps://nicecrew.tv/w/bj7bKsVxEMswKvyhagRDNShttps://nicecrew.tv/lazy-static/thumbnails/6365d7c0-62f3-42fd-828c-97542d5dafb6.jpgBuckets of bloodI hope you guys enjoy this 20 second animation! Please enjoy and you can critique if you like! Enjoy! May contain blood and stuff!https://nicecrew.tv/static/streaming-playlists/hls/53829618-3fda-4ed5-bbe8-8360a570600a/4d63c0f2-4e3e-42c1-9b9b-eaa8726f780a-master.m3u8https://nicecrew.tv/videos/embed/bj7bKsVxEMswKvyhagRDNS20002024-12-15T01:16:17.075ZAnimationscuteAdobe Flash cs6bloodybucketsYESDreamy's LoungeNOhttps://nicecrew.tv/w/eEotpH2syKAMioEdo1cXK1https://nicecrew.tv/lazy-static/thumbnails/fed4cd93-d2d3-438f-81a6-880abb5556dc.jpgDrawing: Len's BakeryWelcome to Len's bakery, any cake flavor is available for anyone who wants a sweet sweet cake and other goodies! I hope you guys enjoy! Cake is love Cake is life! This video was originally 57 minutes! Welcome customer!: http://rainbowdoodler209.deviantart.com/art/Len-s-Bakery-623959094?ga_submit_new=10%253A1469491091https://nicecrew.tv/static/streaming-playlists/hls/6ea2ea40-b52f-4d28-9085-a4f66faa15f2/c70cbffd-0e4c-43dd-b1e9-03c5e6ebbbd2-master.m3u8https://nicecrew.tv/videos/embed/eEotpH2syKAMioEdo1cXK1867002024-12-15T01:32:09.026ZVocaliodcutecolorfulAnime artClip studio Paint ProYESDreamy's LoungeNOhttps://nicecrew.tv/w/astkUsFQsiaRa9LgvToeeQhttps://nicecrew.tv/lazy-static/thumbnails/bc8e1e4b-2ccb-4379-968b-611193cbcb6d.jpgDrawing: Angel SlimeA little blue slime girl with angel wings that are ready to beat in the sky! Anyways, I hope you guys enjoy this drawing video and stuff! ^^ Slime Angel: http://rainbowdoodler209.deviantart.com/art/Angel-Slime-624170034?ga_submit_new=10%253A1469575173https://nicecrew.tv/static/streaming-playlists/hls/4c946fd1-b76e-4985-b289-96f7023d3476/379fd3e0-22d3-40e0-931f-791eaa211de2-master.m3u8https://nicecrew.tv/videos/embed/astkUsFQsiaRa9LgvToeeQ328002024-12-15T01:25:23.413ZAnime artworkClip Studio Paint ProcolorfulCold colorsSlime MonstersYESDreamy's LoungeNOhttps://nicecrew.tv/w/9AnhzJjKrpj9HtKotZ3Qcdhttps://nicecrew.tv/lazy-static/thumbnails/7c6c94f8-dca0-46e7-b710-8f31df737aa9.jpgThe Fun BakerySorry it took me so long! I was making this animation and stuff! I'll make another drawing after this animation is uploaded! Enjoy! ^^https://nicecrew.tv/static/streaming-playlists/hls/459583ee-4cf6-4c2f-939a-46fc847ad00a/0d23aadc-f47b-4e35-b5a8-20197479a73a-master.m3u8https://nicecrew.tv/videos/embed/9AnhzJjKrpj9HtKotZ3Qcd22002024-12-15T01:18:39.775ZAnimationcuteanimebakeryAdobe Flash CS6YESDreamy's LoungeNOhttps://nicecrew.tv/w/6aqCmo1WEjDzh4g3GggWkghttps://nicecrew.tv/lazy-static/thumbnails/31da2643-2605-487c-8f08-4c903dd1c442.jpgDrawing: Wanna play baseball?A baseball themed drawing of a neko girl who wants to play baseball with you, wait...something's not right! Hey batter batter: http://rainbowdoodler209.deviantart.com/art/Wanna-play-Baseball-624433457?ga_submit_new=10%253A1469680657https://nicecrew.tv/static/streaming-playlists/hls/29ce9062-7806-42aa-b9ea-6bd98ff5103d/3971064a-8392-41d4-ab50-863dd8f375ae-master.m3u8https://nicecrew.tv/videos/embed/6aqCmo1WEjDzh4g3GggWkg600002024-12-15T01:28:44.931ZbloodyAnime horrorbaseball themesportsclip studio paint proYESDreamy's LoungeNOhttps://nicecrew.tv/w/nsRxT2cYnTLdkwrPYuzzFohttps://nicecrew.tv/lazy-static/thumbnails/7d0958e5-5b84-451d-bbcd-2bc5d19f9d7f.jpgDrawing: Pastel RoniaAnother drawing of Ronia Lee, I hope you guys enjoy this little pastel drawing of the planet dictator! OBEY ME: http://rainbowdoodler209.deviantart.com/art/Pastel-Ronia-624592671?ga_submit_new=10%253A1469750144https://nicecrew.tv/static/streaming-playlists/hls/adcfc933-1db0-496d-ac4f-7a86eca99ab8/5670a677-7842-4280-9c82-0d4181b906b7-master.m3u8https://nicecrew.tv/videos/embed/nsRxT2cYnTLdkwrPYuzzFo407002024-12-15T01:27:39.619Zcolorfulpastelanimeanthrodictator of TarreonYESDreamy's LoungeNOhttps://nicecrew.tv/w/9uJxg8PWD381fi89kd6N5ahttps://nicecrew.tv/lazy-static/thumbnails/2d225e5d-a8a1-49e0-a7a7-5b537180d807.jpgDrawing: Ihav nofrensA little drawing of one of my subscribers, sorry if this looks too sad. It's just her name sounds really really sad you know! X{ Anyways please enjoy everyone! ^^ IHav Nofrens: http://rainbowdoodler209.deviantart.com/art/Ihav-nofrens-624702853?ga_submit_new=10%253A1469803020https://nicecrew.tv/static/streaming-playlists/hls/44cc2681-dae1-4ca0-8248-405c3c13e851/a9dc2899-f41e-4285-b643-2433fa1c5457-master.m3u8https://nicecrew.tv/videos/embed/9uJxg8PWD381fi89kd6N5a485002024-12-15T01:29:46.161ZMonsterssurrealPastel colorscutesadYESDreamy's LoungeNOhttps://nicecrew.tv/w/22Hvs78YpmovCiBw2XZGt8https://nicecrew.tv/lazy-static/thumbnails/e05460c6-63c3-4a54-9520-5652b0550c1f.jpgDrawing: Purple FlowerA full drawing of a boy holding a purple flower and smiling, I originally drew this on my samsung cricket for fun and stuff, please enjoy! Pretty flower: http://rainbowdoodler209.deviantart.com/art/Purple-flower-624837066?ga_submit_new=10%253A1469850462https://nicecrew.tv/static/streaming-playlists/hls/08567666-2656-4db7-8b07-358cdc78f2bd/30b6caf0-2f95-4a7b-968a-3b58375bb202-master.m3u8https://nicecrew.tv/videos/embed/22Hvs78YpmovCiBw2XZGt8462002024-12-15T01:30:24.062ZPurplemonochromaticcutehappyAnime boysYESDreamy's LoungeNOhttps://nicecrew.tv/w/atLX4dUNREfdG6QWxR9v13https://nicecrew.tv/lazy-static/thumbnails/a0b5246d-13a6-4fb2-bee7-d916ab9d6577.jpgWithered FlowersAnother little animation with flash! I hope you guys enjoy this little animation!https://nicecrew.tv/static/streaming-playlists/hls/4cc307da-9c36-4c36-91e3-b7ed13318b46/850a9f88-423d-4d12-b013-cbe8a6897bfa-master.m3u8https://nicecrew.tv/videos/embed/atLX4dUNREfdG6QWxR9v1313002024-12-15T01:24:33.631ZAnimationssurrealflowerswitheringYESDreamy's LoungeNOhttps://nicecrew.tv/w/d1BFyg4s5pHTY1WcBpLBHZhttps://nicecrew.tv/lazy-static/thumbnails/7d4981f6-aa55-4d5d-8d26-f3697733e99b.jpgDrawing: Any Napkins?A drawing of Lesima Rode who really needs napkins! Please enjoy! I need some ASAP: http://rainbowdoodler209.deviantart.com/art/Any-Napkins-625477833?ga_submit_new=10%253A1470106907https://nicecrew.tv/static/streaming-playlists/hls/6143a75b-3b01-405d-81d1-ee4f725c055f/e2fe1de5-8434-445f-9cd2-49a39efa94c3-master.m3u8https://nicecrew.tv/videos/embed/d1BFyg4s5pHTY1WcBpLBHZ286002024-12-15T01:25:56.115ZLesima_Rodemonstershybridsclip studio paint artclip studio paint proYESDreamy's LoungeNOhttps://nicecrew.tv/w/7YruXPoNpLFditi6kTT7hdhttps://nicecrew.tv/lazy-static/thumbnails/6487225f-409a-43bb-8675-b6378ba52f7a.jpgDrawing: Vina_LoveVina Love is a monster girl who will be protested by her owner at all times until the owner gets older! I hope you guys enjoy this drawing video! Vina_Love is shy: http://rainbowdoodler209.deviantart.com/art/Vina-Love-625697987?ga_submit_new=10%253A1470196381https://nicecrew.tv/static/streaming-playlists/hls/38783296-ca90-4c3f-a52b-7abcf5e32c4c/9da5d33f-4b6a-444e-a259-8ea6c2951f41-master.m3u8https://nicecrew.tv/videos/embed/7YruXPoNpLFditi6kTT7hd408002024-12-15T01:29:35.214ZVina_LoveAnime girlsAnime artClip studio Paint ProClip studio PaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/fwocWryZCwXxLDpQZsc2YNhttps://nicecrew.tv/lazy-static/thumbnails/2c0002df-f487-4b64-929c-4cc0e1d88f5a.jpgDrawing: The Winged GoatShipayin is in her flying goat form, that's it basically! I hope you guys enjoy! Shipayin is waiting: http://rainbowdoodler209.deviantart.com/art/The-winged-Goat-625834948https://nicecrew.tv/static/streaming-playlists/hls/759df06d-b64c-4488-8e1d-cec6ce1c2c7a/855f2ffe-8e92-41d3-83cd-3b498acfaf9e-master.m3u8https://nicecrew.tv/videos/embed/fwocWryZCwXxLDpQZsc2YN699002024-12-15T01:33:22.240ZNeutral colorsBloodyChineseAnimeGoatsYESDreamy's LoungeNOhttps://nicecrew.tv/w/gUgQwoyNK33Sx2S8n5MMKfhttps://nicecrew.tv/lazy-static/thumbnails/420ce441-ece3-44c3-bd18-2e3fd20840b2.jpgDrawing: Anone BlackA profile picture for my subscribers @AnoneBlackmidi, I hope you like it and stuff! Cheers to the MIDI community! ^^ Anone is happy: http://rainbowdoodler209.deviantart.com/art/Anone-Black-626061412?ga_submit_new=10%253A1470348452https://nicecrew.tv/static/streaming-playlists/hls/80c583fe-9842-43eb-bd8e-381eccc20448/0c5d2134-0a1c-4ddb-a159-5a1f3b279ca5-master.m3u8https://nicecrew.tv/videos/embed/gUgQwoyNK33Sx2S8n5MMKf329002024-12-15T01:27:58.019ZPiano AngelAnime girlssurrealClip Studio Paint ProClip Studio Paint artYESDreamy's LoungeNOhttps://nicecrew.tv/w/tQbhAe8KXyq7RWbcuC7dUvhttps://nicecrew.tv/lazy-static/thumbnails/3d45e224-c4c9-406d-877f-145e5601be67.jpgSlime And Natsuki8000Another animation, A guest appears in this animation, guess who it is! Please enjoy everyone!https://nicecrew.tv/static/streaming-playlists/hls/e160c8a5-781b-4c43-9e8a-9527ef8c9005/9e795ac5-d75a-4d60-8c99-5dfe36cb778a-master.m3u8https://nicecrew.tv/videos/embed/tQbhAe8KXyq7RWbcuC7dUv7012024-12-15T01:25:39.853ZAnimeAdove Flash CS6cutemonstersMIDIYESDreamy's LoungeNOhttps://nicecrew.tv/w/7mtnaFS3BBmkJEHKFvizvvhttps://nicecrew.tv/lazy-static/thumbnails/af7c6930-4371-4092-8863-4054aa3b05ec.jpgDrawing: Macbook boyA drawing about my Macbook OS X, I was thinking about a lot of things to draw and couldn't pick one! Anyways I hope you guys enjoy it and stuff! Macbook boy: http://rainbowdoodler209.deviantart.com/art/Macbook-boy-626563908?ga_submit_new=10%253A1470544635https://nicecrew.tv/static/streaming-playlists/hls/33729254-f350-4a5e-bad0-3d777ea39c6b/6c5a91fb-5e5e-4f7b-ba9c-67ed485c068a-master.m3u8https://nicecrew.tv/videos/embed/7mtnaFS3BBmkJEHKFvizvv424002024-12-15T01:32:17.030ZAnimecutedoodleClip studio Paint ProClip Studio Paint ArtYESDreamy's LoungeNOhttps://nicecrew.tv/w/mTAw2TZWVPsHx713Fz5n5Hhttps://nicecrew.tv/lazy-static/thumbnails/5a3c944a-d27c-4043-9877-5302c6b416af.jpgDrawing: Red SlimeI wanted to make another slime girl! I hope you guys enjoy this little drawing! ^^ "Blood" Slime: http://rainbowdoodler209.deviantart.com/art/Red-Slime-626789739https://nicecrew.tv/static/streaming-playlists/hls/a92afa52-9c0a-4378-ad52-1eb12de1b495/4f30b1c6-a0ef-4e44-b821-8e69abe2fabb-master.m3u8https://nicecrew.tv/videos/embed/mTAw2TZWVPsHx713Fz5n5H282002024-12-15T01:29:38.400ZSlime girlsclip studio paintClip Studio Paint ProSlimesAnime artYESDreamy's LoungeNOhttps://nicecrew.tv/w/2WcuUgUoYvESRFko4EY2jUhttps://nicecrew.tv/lazy-static/thumbnails/b0c17ae9-32d3-40b5-8c9f-51f7812a03cd.jpgDrawing: Bloody Hello KittyAnother little Hello Kitty drawing because why not! Please enjoy this video I'm almost reaching 130 plus Subs! ^^ EDIT: Wow, I'm already at 130 plus subs now and I didn't post a video last night! I'm surprised! O-O Hello Kitty in blood: http://rainbowdoodler209.deviantart.com/art/Bloody-Hello-Kitty-627211298?ga_submit_new=10%253A1470799395https://nicecrew.tv/static/streaming-playlists/hls/0faa6368-cc59-46ea-94e9-ca2314b8356c/7b530388-7f79-4ec6-aa7e-fc0716f83871-master.m3u8https://nicecrew.tv/videos/embed/2WcuUgUoYvESRFko4EY2jU465002024-12-15T01:32:22.176ZHelloKittyAnime artcatsSpeed drawingClip Studio Paint ProYESDreamy's LoungeNOhttps://nicecrew.tv/w/te82dK2KDh9AezKyuWpKVvhttps://nicecrew.tv/lazy-static/thumbnails/c77216e0-44b2-44a3-af09-c674e7b168a5.jpgBlue GenieA short animation made with Clip Studio, What do you guys think so far? Please tell me in the comments! ^^ Enjoy!https://nicecrew.tv/static/streaming-playlists/hls/dc7bbd5c-7efa-4572-9c50-739832b3e023/3b9df192-4063-46a6-92e6-65c862539d07-master.m3u8https://nicecrew.tv/videos/embed/te82dK2KDh9AezKyuWpKVv1002024-12-15T01:28:36.925ZBlueGenieAnimeartDigitalYESDreamy's LoungeNOhttps://nicecrew.tv/w/6NSAtKTTCKfZGcA3xnw1gohttps://nicecrew.tv/lazy-static/thumbnails/9f59a993-849e-4516-ac97-befbccb27b60.jpgDrawing: Girl PortraitA little drawing for fun to be honest, I hope you guys enjoy this little doodle! :) Girl Doodle: http://rainbowdoodler209.deviantart.com/art/Girl-Portrait-627690583https://nicecrew.tv/static/streaming-playlists/hls/2f09162f-842b-469e-855a-8dee8f6f155c/f8d29318-6d90-40ae-b8ae-3a4ce4e7dd7f-master.m3u8https://nicecrew.tv/videos/embed/6NSAtKTTCKfZGcA3xnw1go431002024-12-15T01:35:57.896ZAnimeAnime artSpeed paintDoodleClip studio Paint ProYESDreamy's LoungeNOhttps://nicecrew.tv/w/xm5KxTZiE1sZAtfFKKuseshttps://nicecrew.tv/lazy-static/thumbnails/c7643daa-1b4c-42ff-921c-92ef39204994.jpgI Talk about EARRAPE!A video were I talk about a trending thing on youtube...EARRAPE! I dunno why this is a thing but I don't really mind it though! Sorces: http://www.extremetech.com/extreme/175996-can-a-loud-enough-sound-kill-you Finished drawing: http://rainbowdoodler209.deviantart.com/art/PAstel-Monster-627908843?ga_submit_new=10%253A1471073455https://nicecrew.tv/static/streaming-playlists/hls/fdd91a07-d104-42ed-aab1-2c1e9f593264/a03b4b2c-4147-4a0c-8d0d-5ccc4a956f86-master.m3u8https://nicecrew.tv/videos/embed/xm5KxTZiE1sZAtfFKKuses387002024-12-15T01:30:50.020ZI talk aboutEARRAPEDrawingMonstersYESDreamy's LoungeNOhttps://nicecrew.tv/w/tZuPE8zmyVnAVvWCmzdqq4https://nicecrew.tv/lazy-static/thumbnails/10be5349-bc83-4398-8597-7ee660a95ea6.jpgDrawing: Blue Stone MonsterAnother little drawing of a human faced but made out of blue shining stone! Please enjoy and stuff! ^^ Finished drawing: http://rainbowdoodler209.deviantart.com/art/Blue-Stone-Monster-627909262?ga_submit_new=10%253A1471073858https://nicecrew.tv/static/streaming-playlists/hls/e2ade694-55fc-4039-9e91-577c9a913143/6b98dd19-2ad6-430c-b81f-3134426d90dc-master.m3u8https://nicecrew.tv/videos/embed/tZuPE8zmyVnAVvWCmzdqq4502002024-12-15T01:36:31.930ZBlue and pinkMOnsterHuman FaceClip studio Paint ArtClip Studio Paint ProYESDreamy's LoungeNOhttps://nicecrew.tv/w/jn2u9HsrsfEiSvX2dU3zRNhttps://nicecrew.tv/lazy-static/thumbnails/2b8974db-629a-4fd7-80ec-2ed1490df7d3.jpgThe Blank SnakeAnother little animation, I may end up making a part two for this animation as well hopefully! Please enjoy!https://nicecrew.tv/static/streaming-playlists/hls/94b407ca-2e33-472d-aafd-0ac5b8dd68bc/a33b3944-81b9-46de-ba5e-4d5384a13cd6-master.m3u8https://nicecrew.tv/videos/embed/jn2u9HsrsfEiSvX2dU3zRN2002024-12-15T01:30:34.906ZAnimationsSnakessurrealweirdClip Studio PaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/4aMSQUBKUZi9vB7BQfDAX2https://nicecrew.tv/lazy-static/thumbnails/0155f5bc-4899-49ab-a6cd-735892151ffa.jpgThe Blank Snake P2Part 2 of the Blank snake animation, pleas enjoy and stuff, that is all sadly! ^^ Have a great day! ^https://nicecrew.tv/static/streaming-playlists/hls/19a961e3-3fc0-4069-b02b-bf170d329ea7/fc0c3ad4-c170-45d3-a105-e21d98f0120b-master.m3u8https://nicecrew.tv/videos/embed/4aMSQUBKUZi9vB7BQfDAX211002024-12-15T01:30:33.452ZAnimationsurrealanimeAdobe Flash CS6YESDreamy's LoungeNOhttps://nicecrew.tv/w/39Z99AYdh7kUXDXnXKehQ9https://nicecrew.tv/lazy-static/thumbnails/1a394961-ae40-4664-bedc-cf0cf77aabe4.jpgSpeed drawing: In a hurryI'm not dead, the drawing video will be here tomorrow since I post mostly at night pretty much, so here is a little angel doodle for you guys and newcomers! This drawing will be on my tumblr! :)https://nicecrew.tv/static/streaming-playlists/hls/11737109-e335-4739-bf0c-f4fdcfa91000/185b0615-92e9-48ac-bcee-aa32b3c42f6a-master.m3u8https://nicecrew.tv/videos/embed/39Z99AYdh7kUXDXnXKehQ910002024-12-15T01:30:36.490ZAngelscuterushingdoodlespeed drawingYESDreamy's LoungeNOhttps://nicecrew.tv/w/4XQDwiqx8s1M38mXQAkqRyhttps://nicecrew.tv/lazy-static/thumbnails/800a07b2-7b5a-4bb6-83ba-4238c5c6a517.jpgDrawing: Pastel Berry ChanA little drawing of Berry_Chan, I hope you guys enjoy this cute little drawing of Berry_Chan who is baste off of fruit punch! Enjoy mu subs and newcomers! Berry_Chan: http://rainbowdoodler209.deviantart.com/art/Pastel-Berry-Chan-628295461?ga_submit_new=10%253A1471230295https://nicecrew.tv/static/streaming-playlists/hls/20174d96-0d90-466b-aff0-26f35bfb5a72/bd073909-c11b-497f-ac46-5436b568985c-master.m3u8https://nicecrew.tv/videos/embed/4XQDwiqx8s1M38mXQAkqRy363002024-12-15T01:33:20.016ZCuteCartoonsAnimePastel colorsClip studio Paint ProYESDreamy's LoungeNOhttps://nicecrew.tv/w/eiJBj5xfZAM2Tnh8cXkhk4https://nicecrew.tv/lazy-static/thumbnails/c01b9407-ed01-4dc2-89f4-de50a84754f6.jpgDrawing: Gi97olA drawing of the lovely Ytpooper, Gi97ol! I hope you guys enjoy this little drawing! Please enjoy and stuff! The greatist YTPooper: http://rainbowdoodler209.deviantart.com/art/Gi97ol-628485656?ga_submit_new=10%253A1471308461https://nicecrew.tv/static/streaming-playlists/hls/6bc0b48d-dbd6-4ef7-8366-33128a0e8699/57b0da38-cdaf-4274-b276-6b5764b97db7-master.m3u8https://nicecrew.tv/videos/embed/eiJBj5xfZAM2Tnh8cXkhk4370002024-12-15T01:33:15.772ZAnimeGi97olyellowredClipstudiopaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/ezxhAbQr6wUgeqjSXxadj6https://nicecrew.tv/lazy-static/thumbnails/d4aa085c-dcbc-48d8-8e54-0c4146e95e05.jpgStrawberry slimeA little short animation, I'll make this as my new profile picture! Please enjoy! ^^ This will be in Tumblr as a GIF!https://nicecrew.tv/static/streaming-playlists/hls/6df5a0b0-221b-439c-8d5d-c18898b6a301/8832c042-4c89-472e-a122-4d4119e99c6f-master.m3u8https://nicecrew.tv/videos/embed/ezxhAbQr6wUgeqjSXxadj61002024-12-15T01:30:45.335ZGIFSLime girlscuteAnimepinkYESDreamy's LoungeNOhttps://nicecrew.tv/w/igirCZSJ5ctj6ZGBeZWriihttps://nicecrew.tv/lazy-static/thumbnails/76f1a6b2-42d7-4b4f-87da-8a0fa6cbd6c3.jpgDrawing: エア本さんAnother request by @Gi97ol, I lost a sub tonight....Oh well, anyways I hope you like it GG and others! I hope you guys enjoy and stuff! エア本さん: http://rainbowdoodler209.deviantart.com/art/Eribon-san-628701400?ga_submit_new=10%253A1471396697 I'll change my profile picture too....sorryhttps://nicecrew.tv/static/streaming-playlists/hls/8bce4347-256f-4631-bf39-b33d662fdc4f/ac732f56-52a4-432a-8d9b-c0db221551ca-master.m3u8https://nicecrew.tv/videos/embed/igirCZSJ5ctj6ZGBeZWrii709002024-12-15T01:37:53.638ZCuteRequestedAnime artClip studio Paint ProColorfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/murMpwyhkKGrpWrNQxRXNXhttps://nicecrew.tv/lazy-static/thumbnails/9b81622d-a6b7-4a25-aad0-1c669d75cab2.jpgDrawing: Tanni the TrollA cute character I made on my 3Ds, she wants to protect the little village in an island called "Guyima"! I hope you guys enjoy this colorful drawing! ^^ Tanni: http://rainbowdoodler209.deviantart.com/art/Tanni-the-troll-628931330https://nicecrew.tv/static/streaming-playlists/hls/a5ef7cee-2be4-493f-a4f3-9584a1d407f7/83575f19-078a-4647-9eff-893e6b228c93-master.m3u8https://nicecrew.tv/videos/embed/murMpwyhkKGrpWrNQxRXNX458002024-12-15T01:37:34.164ZTanni the Trollcutecolorfulspeedpaintingdigital artYESDreamy's LoungeNOhttps://nicecrew.tv/w/6BxiCvwpzuRwVtFFBn2VpGhttps://nicecrew.tv/lazy-static/thumbnails/420920a5-25d0-48be-bf22-6a19155c359f.jpgDrawing: Guro maidenSorry about the lag here, my MacBook blacked out for some reason so here is a little Guro speed drawing! Enjoy! :)https://nicecrew.tv/static/streaming-playlists/hls/2d74045a-02f1-470f-ac8a-a67562f9496a/16b36dbd-b975-413a-9e57-861611c9bda8-master.m3u8https://nicecrew.tv/videos/embed/6BxiCvwpzuRwVtFFBn2VpG27002024-12-15T01:33:05.913ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/vtiNgbEpish2RpYyVv39HDhttps://nicecrew.tv/lazy-static/thumbnails/9cb6a793-8a8e-46c0-8d19-b0487dc96407.jpgColors 3D: Aquena the fishAnother 3ds drawing but with a cute little fish girl! I also made another fish girl but couldn't think of a good name for her! Anyways I hope you guys enjoy and stuff! Colorslive: Soft_Wondershttps://nicecrew.tv/static/streaming-playlists/hls/eea91233-ab4f-4c7d-9e7b-f1fa196e24cf/c61f4b64-76bf-462b-a5d9-cc414a52adb4-master.m3u8https://nicecrew.tv/videos/embed/vtiNgbEpish2RpYyVv39HD70002024-12-15T01:35:27.478ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/3M9YVeRRPEFyfg1gnznqzDhttps://nicecrew.tv/lazy-static/thumbnails/15e3f4b8-e578-4fd3-af0d-5e062fc995c2.jpgDrawing: Puddle girl (P1)A little drawing of a girl forming from a little puddle, I'll make part two when this gets uploaded because I'm not finished yet with the drawing! :)https://nicecrew.tv/static/streaming-playlists/hls/1680482b-dfa0-4168-9aae-91e6010fee37/a400ad4c-a4c7-422d-a504-a59e08f468e1-master.m3u8https://nicecrew.tv/videos/embed/3M9YVeRRPEFyfg1gnznqzD29002024-12-15T01:34:50.519ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/7fYyXedLKbXbwr9KKdtK7Thttps://nicecrew.tv/lazy-static/thumbnails/d3ed074b-4018-405e-b659-2836fb21ab93.jpgPuddle girl (P2)I finally finished the drawing now, it's on DeviantART and soon on my Tumblr! Enjoy! :)https://nicecrew.tv/static/streaming-playlists/hls/32ae1b29-1795-49dd-89f0-ce27c610fd33/522cd1fb-f323-4979-b289-f04f91f0e063-master.m3u8https://nicecrew.tv/videos/embed/7fYyXedLKbXbwr9KKdtK7T9002024-12-15T01:34:46.032ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/vWZKCs1mRvm3p9yMDpDBBVhttps://nicecrew.tv/lazy-static/thumbnails/c223c284-7641-4251-b369-68e8e76d576e.jpgSpeed drawing: Blue SafinaA colored pencil drawing of Safina, I'm gonna try to get used to using pen and colored pencil! :)https://nicecrew.tv/static/streaming-playlists/hls/f286c699-ecf3-48f5-9eda-da0c0d9a27a7/5f681417-c68b-4fbf-8219-ef2c49776a01-master.m3u8https://nicecrew.tv/videos/embed/vWZKCs1mRvm3p9yMDpDBBV30002024-12-15T01:34:53.799ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/eYbQ6MNtbwA8E9KxCdBN8Uhttps://nicecrew.tv/lazy-static/thumbnails/70c155e5-59ca-4bce-a905-97ec19d4f6b1.jpgSpeed drawing: Sherbet YulkoonAnother little drawing of a Yulkoon because why not, I forgot to draw the tail too! Oh well! Pleas enjoy and stuff! :3https://nicecrew.tv/static/streaming-playlists/hls/711f20a3-ae7b-4846-ba22-d9c18f144e3a/abeda6f2-00e4-47a4-b9eb-82448c5da8f4-master.m3u8https://nicecrew.tv/videos/embed/eYbQ6MNtbwA8E9KxCdBN8U28002024-12-15T01:35:07.963ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/bVFpk18PPRBYYJTPLCFtrchttps://nicecrew.tv/lazy-static/thumbnails/51f0da75-374d-40d6-a223-cab852a33fdd.jpgColors 3D: Choco LoversA little monster drawing on my doodle account! Please enjoy! Doodle account// @Bubble_Kat1https://nicecrew.tv/static/streaming-playlists/hls/587a16c0-c0e1-4cca-9e29-8fb8bcc93199/85df8944-9290-48be-b133-4efe9702c697-master.m3u8https://nicecrew.tv/videos/embed/bVFpk18PPRBYYJTPLCFtrc49002024-12-15T01:35:39.232ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/dFE11W5SMYDUsowVpmnJ1Jhttps://nicecrew.tv/lazy-static/thumbnails/66a5bec4-ff2d-4c21-aa31-e7feffe79e72.jpgSpeed drawing: An Odd worldAnother pencil and pen drawing, please enjoy this little cartoon! :) This'll be on on my DA too! :)https://nicecrew.tv/static/streaming-playlists/hls/66b716e6-6045-46f2-a17b-43ae7cbf5c3a/a3ddcd34-e692-44cc-b77b-18a42464bc8a-master.m3u8https://nicecrew.tv/videos/embed/dFE11W5SMYDUsowVpmnJ1J25002024-12-15T01:35:25.425ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/2tNVqmKg8fGSJQrdNwsDnyhttps://nicecrew.tv/lazy-static/thumbnails/dfcfe8d6-9068-40ea-b330-df627d64ed06.jpgSpeed drawing: Pastel Yulkoon girlAnother drawing with Paint tool sai! I promise I'll make more videos! :) Please enjoy! I'll be using my windows 7 computer until my Macbook is fixed! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Pastel-Yulkoon-girl-630514304?ga_submit_new=10%253A1472166620https://nicecrew.tv/static/streaming-playlists/hls/0bfb22f5-e399-4a1e-8707-85d00b1bab46/53c7a63a-cc8d-4f6f-badb-0540323aa927-master.m3u8https://nicecrew.tv/videos/embed/2tNVqmKg8fGSJQrdNwsDny26002024-12-15T01:36:03.824ZAnime artanime artYulkoonspeed paintPaint tool SaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/2hBnCHp6tr5Fwhgbk5db5ihttps://nicecrew.tv/lazy-static/thumbnails/3fe32558-16dd-4330-84df-47e191784c2e.jpgDrawing: NumbAnother little pastel drawing but with blood! :) please enjoy and stuff!https://nicecrew.tv/static/streaming-playlists/hls/0a6ad69e-70d4-4a1f-8fee-29d5a5e09161/6ce247a1-6cea-4dbe-9ae9-9f572b7bf342-master.m3u8https://nicecrew.tv/videos/embed/2hBnCHp6tr5Fwhgbk5db5i22002024-12-15T01:35:10.994ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/71KPpjaCpE8tcxHnJssHo1https://nicecrew.tv/lazy-static/thumbnails/e3cb5450-9274-46ee-9c04-1d7ea436cb35.jpgDrawing request: Allen/Carlo CPA request by Allen really wanted me to drawing him so I made him into a midi angel because why not! Hope you like it dude! ^^ Finished song: http://rainbowdoodler209.deviantart.com/art/Allen-Carlo-CP-630860935?ga_submit_new=10%253A1472319477https://nicecrew.tv/static/streaming-playlists/hls/30b1d5d7-3635-48d3-aed3-af10811cba70/e78939f6-98fe-400a-bd40-aa675a45476f-master.m3u8https://nicecrew.tv/videos/embed/71KPpjaCpE8tcxHnJssHo138002024-12-15T01:36:17.110ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/8tWPB6gwrch354ArZgvRBghttps://nicecrew.tv/lazy-static/thumbnails/293aeb10-9b43-4eee-b016-773b5e2c81b9.jpgDrawing: NervousnessAnother little Safina drawing but she's very very nervous! Please enjoy the drawing video! :) Finished drawing: http://rainbowdoodler209.deviantart.com/art/Nervousness-630952864?ga_submit_new=10%253A1472349557https://nicecrew.tv/static/streaming-playlists/hls/3c96d63f-f7eb-44f4-8eb8-dfffcd0c3b39/6684686a-8213-4419-ac0f-c7fa9d1ca81e-master.m3u8https://nicecrew.tv/videos/embed/8tWPB6gwrch354ArZgvRBg25002024-12-15T01:36:01.779ZSpeed drawingSafinaPainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/1kzbY3ALtGvz59FUwz8RERhttps://nicecrew.tv/lazy-static/thumbnails/84ac03fc-b697-4618-9322-095f9bf86403.jpgDrawing: woke up in inkA little ink drawing, my left hand kind of hurts now! Please enjoy and stuff! I wanted to make another ink drawing again! :)https://nicecrew.tv/static/streaming-playlists/hls/02bb95ca-a83e-468c-b59b-68ffda2ab619/93eb1037-55be-4881-b0cc-880593394242-master.m3u8https://nicecrew.tv/videos/embed/1kzbY3ALtGvz59FUwz8RER17002024-12-15T01:36:15.239ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/hrm1zUwsneaozkV9K6WVKhhttps://nicecrew.tv/lazy-static/thumbnails/c1a8e2f8-39d2-457d-a14e-d6a887c3f4c2.jpgDrawing Sunset SlimeA drawing of a slime neko but with warm sunset colors! Please enjoy! This drawing is a few days old! :) Finished slime: http://rainbowdoodler209.deviantart.com/art/Sunset-Slime-630930647https://nicecrew.tv/static/streaming-playlists/hls/851c24fb-4609-42ea-b275-f49736150562/b68cfe1f-c0f1-4b15-b253-dd73b3d9cc88-master.m3u8https://nicecrew.tv/videos/embed/hrm1zUwsneaozkV9K6WVKh1332002024-12-15T01:39:34.551ZSlime girlscuteanimePainttoolSaiDigital artYESDreamy's LoungeNOhttps://nicecrew.tv/w/8pyhgyFMRuXHyMRdLrr6GKhttps://nicecrew.tv/lazy-static/thumbnails/d36de9d7-c1bc-4666-9098-f48328574d0e.jpg140+ Sub special! Drawing: Great morningA little speed drawing video for you guys, sorry if I didn't make animations at all, and I will upload that request Allen, it keeps messing up when I'm trying to upload it! Anyways please enjoy! :Dhttps://nicecrew.tv/static/streaming-playlists/hls/3bf9f88c-1ae4-458a-baf2-c9e44575cd67/ff1b6da2-03fb-47f6-b2d2-46066951ad99-master.m3u8https://nicecrew.tv/videos/embed/8pyhgyFMRuXHyMRdLrr6GK20002024-12-15T01:36:31.163ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/6EVFF6McdT8tPpQKgy7ciphttps://nicecrew.tv/lazy-static/thumbnails/6b018ede-f622-47d4-b91e-bea74c30a683.jpgDrawing request: Allen-CarlosCP pony versionHere's the request for Allen, please enjoy and stuff! ^^https://nicecrew.tv/static/streaming-playlists/hls/2ded0a5f-b888-4b17-8745-fcae7abfcd8d/ad0d8cee-21d6-4c41-a970-09bd53c7e05b-master.m3u8https://nicecrew.tv/videos/embed/6EVFF6McdT8tPpQKgy7cip703002024-12-15T01:38:06.819ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/jsYgchZ3tCcPPCvdC5mYwPhttps://nicecrew.tv/lazy-static/thumbnails/06b11ff7-b603-42a4-9159-08f721378fb1.jpgColors! 3D: Frosted Honey BunAnother little 3D drawing I made a moment ago, I hope you guys enjoy! It's in my gallery if your wondering! :)https://nicecrew.tv/static/streaming-playlists/hls/958881ae-ee1c-447e-95c5-291acd77ca3b/87d7080d-cb7d-4eca-a2fe-ac8001e26b6a-master.m3u8https://nicecrew.tv/videos/embed/jsYgchZ3tCcPPCvdC5mYwP79002024-12-15T01:36:37.078ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/qx82RswVREPC2JSS3wqP3Thttps://nicecrew.tv/lazy-static/thumbnails/4da84300-0655-4587-b9df-6c883264d5f5.jpgCircus Band (Original Song)A song about a group of instruments slowly escaping the circus tents!https://nicecrew.tv/static/streaming-playlists/hls/c6b3b7e2-6e3f-4568-bab5-1699cc79e2a3/a24092f4-113d-4aa2-84c3-d08c6dda9988-master.m3u8https://nicecrew.tv/videos/embed/qx82RswVREPC2JSS3wqP3T216002024-12-15T01:36:29.477ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/jXbcZPnMoGdHjaNmQotu8Zhttps://nicecrew.tv/lazy-static/thumbnails/3947fb90-8d24-4cca-a52f-4cb9d17a5d7b.jpgDrawing: Spilling out (Guro)A little pastel guro drawing becuase why not! they're pretty fun to make to be honest! Please enjoy! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Spilling-out-631601464https://nicecrew.tv/static/streaming-playlists/hls/9978b183-f4a6-4427-bd28-601a2ce4c257/9d06f24c-6ce5-485d-994f-a05966d5b36f-master.m3u8https://nicecrew.tv/videos/embed/jXbcZPnMoGdHjaNmQotu8Z525002024-12-15T01:37:14.277ZcolorfulpastelGuro speedpaintanimeartbrutalYESDreamy's LoungeNOhttps://nicecrew.tv/w/sdiozEpXWrYWD1ycdS9VhEhttps://nicecrew.tv/lazy-static/thumbnails/bcbd1a2a-7308-42d4-945f-f0142e8e3ae0.jpgComplete This Drawing: 11 PagesA little surprise I want to show you guys the drawing book was given as a birthday present! I already loved it! Please enjoy!https://nicecrew.tv/static/streaming-playlists/hls/d4453f37-ec4c-4c32-bff7-42a514a85cda/1501cc2b-a7d1-4d1b-8051-e83471848f55-master.m3u8https://nicecrew.tv/videos/embed/sdiozEpXWrYWD1ycdS9VhE40002024-12-15T01:36:46.126ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/kaHaXpKXdztPQE1Gv8thT4https://nicecrew.tv/lazy-static/thumbnails/3bb3def8-889c-4fb0-b235-54a6c6881072.jpgSpeed Drawing: Anone Black midi x Allen/CarlosCPA little ship drawing since Allen kindly requested to me! So here it is my lovely viewers! :) Please enjoy everyone!https://nicecrew.tv/static/streaming-playlists/hls/9b38b38e-bd43-4a72-83ec-38f70a6cf299/4768306b-e767-4975-9351-ce0420f2ea08-master.m3u8https://nicecrew.tv/videos/embed/kaHaXpKXdztPQE1Gv8thT426002024-12-15T01:36:35.149ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/5zezTivUxwzmxrA15neSY7https://nicecrew.tv/lazy-static/thumbnails/655d1819-fd6a-477b-ae1f-ad42bd76c730.jpgDerpoFantasiaA little derpy version of the Touhou song, Necrofantasia! Please enjoy! :)https://nicecrew.tv/static/streaming-playlists/hls/2508787a-93fb-4d36-abe4-39365abb3696/3983a744-ec9f-43f3-be4e-69e2202ef66b-master.m3u8https://nicecrew.tv/videos/embed/5zezTivUxwzmxrA15neSY7140002024-12-15T01:36:55.097ZTouhou Anime GarageBandYESDreamy's LoungeNOhttps://nicecrew.tv/w/sXpWV9eQYmM7GYhrYseKD2https://nicecrew.tv/lazy-static/thumbnails/19cd9138-3aa9-4724-9e78-9d98be567e23.jpgDrawing: Homicidal LavenderAnother flower girl drawing but.....something isn't right though... It's finally over..:http://rainbowdoodler209.deviantart.com/art/Homicidal-Lavender-632392350?ga_submit_new=10%253A1472959089https://nicecrew.tv/static/streaming-playlists/hls/da4a4530-5baa-4163-a129-e662f4c78c57/21488f06-fb95-4bcf-b1fd-7ad0154853c1-master.m3u8https://nicecrew.tv/videos/embed/sXpWV9eQYmM7GYhrYseKD223002024-12-15T01:36:56.883ZAnimeSpeedpaintPainttoolsaicutecreepyYESDreamy's LoungeNOhttps://nicecrew.tv/w/dn2xQPUnbfoZuVwni6AGGchttps://nicecrew.tv/lazy-static/thumbnails/aff6113f-c0dd-4c83-aa29-ac761708645f.jpgDrawing: Lonely AlienA little cartoon I made with the "Skecth app" I will speed this up since It's not sped up! Please enjoy! :) Finished: http://rainbowdoodler209.deviantart.com/art/Lonely-Alien-632582695https://nicecrew.tv/static/streaming-playlists/hls/641d3cd9-75ed-415a-8007-22d802f7603b/c05ece8e-570e-4209-97a4-321915f530e6-master.m3u8https://nicecrew.tv/videos/embed/dn2xQPUnbfoZuVwni6AGGc570002024-12-15T01:37:42.954ZSketch AppanimedoodlecolorfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/k8g8Y9awHeT3BToeoQswsMhttps://nicecrew.tv/lazy-static/thumbnails/13659547-86a3-4173-b177-eee43c7c5f19.jpgDrawing: Tanni vs the shadowsAnother Tanni drawing but her about to fight a crowd of shadow monsters! Please enjoy!https://nicecrew.tv/static/streaming-playlists/hls/9ae12b6f-8944-46f6-a8b9-f5133f901059/4f8e3e34-3291-426a-9f7b-9ebf1c76e2ee-master.m3u8https://nicecrew.tv/videos/embed/k8g8Y9awHeT3BToeoQswsM1183002024-12-15T01:40:23.271ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/6Kummr4cXcyU3fzi6539gdhttps://nicecrew.tv/lazy-static/thumbnails/653ca3ac-09d9-48a1-af03-a7c135bfd4fc.jpgDrawing: Devil ParkAnother drawing with a crowd of cartoons on paper! Please enjoy and have a great night! :3https://nicecrew.tv/static/streaming-playlists/hls/2e9025b3-b9e6-4fea-b82b-b46953b80802/8196acbb-465f-48cf-a6da-f760979f8a00-master.m3u8https://nicecrew.tv/videos/embed/6Kummr4cXcyU3fzi6539gd24002024-12-15T01:37:17.004ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/sFMcchMX4Z8REo56w23sZ8https://nicecrew.tv/lazy-static/thumbnails/a6f1d022-728a-49ad-a66e-b1aa02fb56d5.jpgComplete this drawing: 10 pagesAnother video with Comeplete this drawing book! Please enjoy! ^^https://nicecrew.tv/static/streaming-playlists/hls/d81b769f-92f5-4568-872d-91ecc0d7d3f9/c65bc1f9-1a8f-4cf3-bef8-bcec6fe7b594-master.m3u8https://nicecrew.tv/videos/embed/sFMcchMX4Z8REo56w23sZ825002024-12-15T01:37:15.231ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/nUkU8S7k6YnhHMuVnemscvhttps://nicecrew.tv/lazy-static/thumbnails/8b733636-6542-41c8-adea-29e142b658ca.jpgDrawing request: Kamen rider ex aidA lovely request by my new subscriber "Ge XiaoMing" Thanks for the request dude! I had fun making this character! ^^ Enjoy! The reason my macbook was acting funny was my mother board needs to be replaced! Now my mac is finally fixed! Pew pew pew: http://rainbowdoodler209.deviantart.com/art/Kamen-rider-ex-aid-633547240?ga_submit_new=10%253A1473471566https://nicecrew.tv/static/streaming-playlists/hls/b15ed9dc-d849-4002-b33b-71b6afc16393/62710c0f-dbd0-4f10-8d60-61c0c169a84c-master.m3u8https://nicecrew.tv/videos/embed/nUkU8S7k6YnhHMuVnemscv487002024-12-15T01:39:51.284ZRobotJapanese showsrequestcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/gP9HfpAxcFGFHWHSPaZH8Ahttps://nicecrew.tv/lazy-static/thumbnails/02049bb7-b6da-446c-80dc-e1e05de802d9.jpgGoat girlA quick animation while my request video's loading! Please enjoy!https://nicecrew.tv/static/streaming-playlists/hls/800e67d1-c7f1-41ad-91f2-0503a8dc5054/19bb92c0-fc65-43da-9f10-2fa93684f07b-master.m3u8https://nicecrew.tv/videos/embed/gP9HfpAxcFGFHWHSPaZH8A2012024-12-15T01:37:30.717ZcutegoatanimationClip studio paintYESDreamy's LoungeNOhttps://nicecrew.tv/w/dQAoPoyuBYESH7RVBrLuyZhttps://nicecrew.tv/lazy-static/thumbnails/50b7e902-4ee5-47ba-869d-c7694a5e085e.jpgDrawing Tsmb2 x Ryth MelNother speed drawing video! I made this for @tsmb2, I hope you guys see it! Please enjoy! *Looks very nervous* EDIT: I was originally posting this as 1 hour but youtube doesn't like that so yeah! ^^" Finished drawing: http://rainbowdoodler209.deviantart.com/art/Tsmb2-x-Ryth-Mel-633797011https://nicecrew.tv/static/streaming-playlists/hls/67f68f81-2172-4d58-b2d2-4ba9d2ece779/1bd44807-ac96-44e9-9484-3407aade130f-master.m3u8https://nicecrew.tv/videos/embed/dQAoPoyuBYESH7RVBrLuyZ85002024-12-15T01:37:37.075ZColorfulAnimePianoAngelscutelovey doveyYESDreamy's LoungeNOhttps://nicecrew.tv/w/cGgsHAt33Z8VFPcRzh6EYAhttps://nicecrew.tv/lazy-static/thumbnails/be655c71-3883-4f93-86b0-805aa5317365.jpgMy piano loveA little cute animation of a young midi maker falling in love! Please enjoy!https://nicecrew.tv/static/streaming-playlists/hls/5eb3cdd4-2063-4726-b49a-9be2f9b14452/af9e7f3c-7d0b-46ed-8e82-5bb3b5bbaf32-master.m3u8https://nicecrew.tv/videos/embed/cGgsHAt33Z8VFPcRzh6EYA10002024-12-15T01:37:40.486ZCutepianoAnimeAdobe flash cs6monochromeYESDreamy's LoungeNOhttps://nicecrew.tv/w/2tMRnpUDFeQqRDJh4jVpEahttps://nicecrew.tv/lazy-static/thumbnails/f4c7dbd5-5231-409c-89e5-48a88518c167.jpg150 sub special// drawing :Pink girlA quick 3 minute drawing, my MacBook freaked out AGAIN, anyways I hope you enjoy! :)https://nicecrew.tv/static/streaming-playlists/hls/0bfa7a2d-26d9-499c-a318-6775ead41929/d4338bdb-a44f-46cc-832e-e26063c8016d-master.m3u8https://nicecrew.tv/videos/embed/2tMRnpUDFeQqRDJh4jVpEa180002024-12-15T01:37:51.233Zdrawingpinkpastelipad appcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/9b6HAqBPHPwaQsov5JFPvihttps://nicecrew.tv/lazy-static/thumbnails/11d624cb-70ca-41a7-b0b9-6655d8b5f067.jpgDrawing: Light alienAnother doodle because why not! Please enjoy and stuff! :)https://nicecrew.tv/static/streaming-playlists/hls/423211fe-486b-492c-9bd0-8221692341b7/82b96ccc-831f-4333-a940-7e9de6868bd6-master.m3u8https://nicecrew.tv/videos/embed/9b6HAqBPHPwaQsov5JFPvi169002024-12-15T01:38:16.748ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/uWEfUHswriqVqkSF4VAYgyhttps://nicecrew.tv/lazy-static/thumbnails/24c8945e-f51e-4bcf-b3b5-46bd6cc36a73.jpgColors 3D: MatjikAn odd monster drawing I made in the morning after school! It's posted too! :)https://nicecrew.tv/static/streaming-playlists/hls/ea619f70-1863-4795-8893-d8d21fd6f9a6/703cad24-f464-4179-a045-3caa2e89a673-master.m3u8https://nicecrew.tv/videos/embed/uWEfUHswriqVqkSF4VAYgy120002024-12-15T01:38:22.889ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/v4Y36ZJ3jFVWoiw4eCucEThttps://nicecrew.tv/lazy-static/thumbnails/e9d0c25f-af32-4c17-858f-fc6c637a1b55.jpgDrawing/ Girl in the darkA little painting on painttoolsai! I'm basically trying to make a lineless painting! Tell me what you guys think in the comments! Girl in the darkness: http://rainbowdoodler209.deviantart.com/art/Girl-in-the-dark-635103437?ga_submit_new=10%253A1474172023https://nicecrew.tv/static/streaming-playlists/hls/eb66c938-ee79-4c18-85d4-f89797acafdb/08b58ada-4216-4e41-b5d4-71dfc5f107fc-master.m3u8https://nicecrew.tv/videos/embed/v4Y36ZJ3jFVWoiw4eCucET150002024-12-15T01:38:20.289ZPainttoolsaiDigital PaintingcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/hB2iVZukRq9DeZiGpm7oz1https://nicecrew.tv/lazy-static/thumbnails/9e67331f-163f-4727-bb0a-f48a65852cc5.jpgDrawing Grey and teaA little grey alien for one of my subscribers @TCisNEONwhite! Please enjoy! Take me to your leader: http://rainbowdoodler209.deviantart.com/art/Grey-and-tea-635303124?ga_submit_new=10%253A1474249824https://nicecrew.tv/static/streaming-playlists/hls/86760eab-7b7c-4544-95e0-606695d887a2/0d3df4b7-25ea-4dd3-b604-f0178fe04cb1-master.m3u8https://nicecrew.tv/videos/embed/hB2iVZukRq9DeZiGpm7oz1300002024-12-15T01:39:41.829ZAliendrawingpastel colorscutecartoonsYESDreamy's LoungeNOhttps://nicecrew.tv/w/145bAg724oPHwVLpBAnbCphttps://nicecrew.tv/lazy-static/thumbnails/1a109897-4d93-4aee-86c6-17a07a9b7b19.jpgDrawing Cute WombatA little wombat drawing, I had to hurry when making this drawing too since I'm using the free version of bandicam on my windows 7! Sorry for my wimpering, please enjoy the video and like comment and sub! ;) Finished cartoon: http://rainbowdoodler209.deviantart.com/art/Cute-Wombat-635646654?ga_submit_new=10%253A1474419252https://nicecrew.tv/static/streaming-playlists/hls/006dcf15-e35d-4c1a-b6a9-0524ff98dcaf/dc2afec3-a919-424b-8836-3a6296061bd8-master.m3u8https://nicecrew.tv/videos/embed/145bAg724oPHwVLpBAnbCp233002024-12-15T01:39:25.798ZCuteAnimeAnthropainttoolsaidrawing videoYESDreamy's LoungeNOhttps://nicecrew.tv/w/2yBDkXCw3kQEYTtESFHcQkhttps://nicecrew.tv/lazy-static/thumbnails/93e3bc29-0aab-4511-897c-2c8e06a1a3a2.jpgAnother spider visitAnother cute spider visit my home, but a jumping spider! I met the little guy after walking out of the bus stop! Please enjoy this little video! :3https://nicecrew.tv/static/streaming-playlists/hls/0ca6e7d6-2c3b-43d3-93e5-9e9096dfb697/4ce28065-366c-4d5c-aac2-5cfed73b43fc-master.m3u8https://nicecrew.tv/videos/embed/2yBDkXCw3kQEYTtESFHcQk86002024-12-15T01:38:50.785ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/uPKcXBNHiK42YogH5pSFRvhttps://nicecrew.tv/lazy-static/thumbnails/01266033-c41a-413e-8f90-c80081c4e2da.jpgDrawing Upset Ronia LeeThis drawing is basically about Ronia not liking criticism at all and tells her hive mind to eraze the one who do it! :/ Ronia is sad: http://rainbowdoodler209.deviantart.com/art/Upset-Ronia-Lee-636003019?ga_submit_new=10%253A1474596259https://nicecrew.tv/static/streaming-playlists/hls/e96a7767-e8b6-4a4c-9fe0-833f785a9a33/90d2e0a5-f8f6-406e-8b38-e3c497b1cc44-master.m3u8https://nicecrew.tv/videos/embed/uPKcXBNHiK42YogH5pSFRv219002024-12-15T01:39:39.529ZRedAnimeAnthroSadupsetYESDreamy's LoungeNOhttps://nicecrew.tv/w/sAXJCvTMQrhAkjDpoTXRmPhttps://nicecrew.tv/lazy-static/thumbnails/c1567300-85ea-4bc7-80fa-a11bd61484a3.jpgDrawing: Cherry-SanAnother girl based off of a twin red fruit, yummy cherry! I'm still playing around with "Animation paper" I'm just trying figure out how to save my animations on my windows 7, Please enjoy everyone! ^^ Cherry san is happy: http://rainbowdoodler209.deviantart.com/art/Cherry-San-636425284?ga_submit_new=10%253A1474784502https://nicecrew.tv/static/streaming-playlists/hls/d76f3dc2-849f-4cae-998e-92f145dc6963/9d0ee232-352b-4e82-a1cb-40aaeed2b837-master.m3u8https://nicecrew.tv/videos/embed/sAXJCvTMQrhAkjDpoTXRmP600002024-12-15T01:40:50.328ZCherry-SananimePainttoolsaicuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/2eEuBzqvBAqXm8BSiFnvrKhttps://nicecrew.tv/lazy-static/thumbnails/bd92e38a-5742-4293-b659-13f33a9c71a6.jpgThe Pale PainterA quick little animation for fun! Sorry that it looks really messy, please enjoy! and stuff!https://nicecrew.tv/static/streaming-playlists/hls/0a0187b0-0cca-4ddb-865c-532a685ce841/8f1839a4-d879-41af-9f7b-4147b12daf68-master.m3u8https://nicecrew.tv/videos/embed/2eEuBzqvBAqXm8BSiFnvrK19002024-12-15T01:38:48.673ZAnimationWizardAnimationPaperpaintbrushYESDreamy's LoungeNOhttps://nicecrew.tv/w/woh8dNLuDMHX37U4oh73tRhttps://nicecrew.tv/lazy-static/thumbnails/9254536a-e48e-450b-8bd7-20c2c383c94f.jpgDrawing: Sir SporkA drawing for one of my lovely midi subs! Sir spork! I hope you like it very much and stuff! Enjoy! ^^https://nicecrew.tv/static/streaming-playlists/hls/f60e75b6-5a46-4fdf-9708-8bcd0ddfcd07/d46cb576-0f93-4793-abd8-e5748be99c15-master.m3u8https://nicecrew.tv/videos/embed/woh8dNLuDMHX37U4oh73tR526002024-12-15T01:39:57.053ZSir SporkRedcartoonsSpeedpaintCuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/pteG4U4yAiDRXbmPtH28qghttps://nicecrew.tv/lazy-static/thumbnails/f3eaec10-81e8-45f9-b46c-393c9a357261.jpgDrawing Adult Neko maidenA little drawing of a neko maiden but grown up! Sorry about that other drawing that popped up! I'm still working on another NSFW drawing! Please enjoy! Little maiden: http://rainbowdoodler209.deviantart.com/art/Adult-Neko-maiden-636959632?ga_submit_new=10%253A1475027358https://nicecrew.tv/static/streaming-playlists/hls/be0fb54e-caeb-4705-917e-7dc7d7e48ed3/f8857f55-3cf9-4f16-b5bc-db407fae29b2-master.m3u8https://nicecrew.tv/videos/embed/pteG4U4yAiDRXbmPtH28qg300002024-12-15T01:39:48.884ZAnime cuteAnimeMaidenAdultGrown upYESDreamy's LoungeNOhttps://nicecrew.tv/w/sxoYLeXviWNX3VKBsjrNeQhttps://nicecrew.tv/lazy-static/thumbnails/e3d5520c-fee3-4dff-a78a-5c7e6af1a0c6.jpgDrawing: Sr PeloA little cartoon of Sr Pelo for fun! I hope you guys enjoy and stuff! I love making cartoons! SrPelo and icecream: http://rainbowdoodler209.deviantart.com/art/Sr-Pelo-637136248?ga_submit_new=10%253A1475113330https://nicecrew.tv/static/streaming-playlists/hls/d6efd2b9-2030-490c-9841-3ea36746be22/44d14ea8-3d2c-4fad-94c3-4c0059d6da0e-master.m3u8https://nicecrew.tv/videos/embed/sxoYLeXviWNX3VKBsjrNeQ300002024-12-15T01:39:53.206ZCutecartoonsSrPelodoodleYESDreamy's LoungeNOhttps://nicecrew.tv/w/nbN6g6aGDuhnAUbuzBBTyqhttps://nicecrew.tv/lazy-static/thumbnails/63675abf-76ec-4dcf-ba39-ed40dfd54498.jpgDrawing: Shy crowA cute little cartoon of a shy little crow in a dull dull world! Enjoy! caw caw: http://rainbowdoodler209.deviantart.com/art/Shy-Crow-637298735https://nicecrew.tv/static/streaming-playlists/hls/ab91c103-66f9-421b-840f-ac167bd87fcc/aede0e47-3d50-4275-88ee-b36a3aeb9fcb-master.m3u8https://nicecrew.tv/videos/embed/nbN6g6aGDuhnAUbuzBBTyq300002024-12-15T01:39:50.569ZCrowsbirdscutecartoonsshyYESDreamy's LoungeNOhttps://nicecrew.tv/w/k3Ae7qV1C1YCMoGwMeurMshttps://nicecrew.tv/lazy-static/thumbnails/5d8132a2-1937-4b3f-a22a-cd194a981395.jpgDrawing Masked BirdA little drawing video of a masked bird, sorry I didn't post at all today! I was busy with marching band and stuff! Please enjoy the video! (*^^*) Finished bird: http://rainbowdoodler209.deviantart.com/art/Masked-bird-637507677?ga_submit_new=10%253A1475294106&ga_type=edit&ga_changes=1&ga_recent=1https://nicecrew.tv/static/streaming-playlists/hls/9a3a36f2-2056-403c-a7ea-8ec5b7fb1da0/1019dad1-8f95-45b6-872b-08a284d747ab-master.m3u8https://nicecrew.tv/videos/embed/k3Ae7qV1C1YCMoGwMeurMs284002024-12-15T01:40:55.374ZbirdscartoonsoddweirdcolorfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/afjnK3uxsAvghrT9b48EShhttps://nicecrew.tv/lazy-static/thumbnails/bbaeabea-4607-49ef-bb06-28bd364d5dca.jpgDrawing: DispairI'll be making a new series of drawings about Dispair and other sad topics....Please enjoy everyone! :) This is a sequal to the ashamed drawings from my 3ds! Finshed drawing:https://nicecrew.tv/static/streaming-playlists/hls/4ae1fc10-dc52-4d54-a79d-c3fb0669bbc4/b0ffe971-ac7a-4e17-8e07-8eb7666106b4-master.m3u8https://nicecrew.tv/videos/embed/afjnK3uxsAvghrT9b48ESh297002024-12-15T01:41:22.274ZCutecreepyanimedispairmonochromaticYESDreamy's LoungeNOhttps://nicecrew.tv/w/7cckfvJFZYBV3uCEMSeA3Thttps://nicecrew.tv/lazy-static/thumbnails/1a41d17d-6cd9-497c-b957-cff46c9a48b6.jpg【Utau】 ClarinaA little Utau video! I just made this utau for fun to be honest! This will be my second Utau! Please enjoy this little Utau video!https://nicecrew.tv/static/streaming-playlists/hls/3226ff38-e0bc-4538-811f-eafa8b9c3137/a93ab92f-1bc8-41cb-a0c7-3a2a50f52659-master.m3u8https://nicecrew.tv/videos/embed/7cckfvJFZYBV3uCEMSeA3T55002024-12-15T01:39:54.807ZClarina_UTAUUTAUcuteVocaliodYESDreamy's LoungeNOhttps://nicecrew.tv/w/1N5CnSH5jWN3zaiCQfhNGjhttps://nicecrew.tv/lazy-static/thumbnails/09a4d4ad-4a69-4ce7-84b0-10cfb1508d67.jpg160+ sub special//Drawing: Cute bunnyA little cute fluffy bunny girl! Please enjoy and stuff! I love fluffy bunnies! U^.^U Hop hop: http://rainbowdoodler209.deviantart.com/art/Cute-bunny-638307299?ga_submit_new=10%253A1475631311https://nicecrew.tv/static/streaming-playlists/hls/066f10a5-b465-4911-addf-e20680f43b7a/1ac468a3-9511-4799-9b0f-89ce66803172-master.m3u8https://nicecrew.tv/videos/embed/1N5CnSH5jWN3zaiCQfhNGj150002024-12-15T01:40:52.000ZCuteanimebunnybluepastel colorsYESDreamy's LoungeNOhttps://nicecrew.tv/w/jEiBaqs9KKwmA7HCkU2gJchttps://nicecrew.tv/lazy-static/thumbnails/02a518cb-a144-4ac3-8e48-28036bbea245.jpgColors 3D: Red demonHe may not look like one, but him and his species of monsters are shy but very vicious when bothered! Please enjoy this little 3ds drawing! :)https://nicecrew.tv/static/streaming-playlists/hls/971d9c00-14f2-48e2-941d-7d035262a473/de2fe7d5-4acd-461d-a59b-370964d79678-master.m3u8https://nicecrew.tv/videos/embed/jEiBaqs9KKwmA7HCkU2gJc44002024-12-15T01:39:58.921ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/6g8gUrnv1ey8TrLvz5nxmihttps://nicecrew.tv/lazy-static/thumbnails/378494ec-c69a-4d39-8653-ed2266f3dbc7.jpgDrawing Dark angel and fog p1Part two will have the finished drawing since I only can make ten minute videos with Bandicam! Please enjoy this little drawing video! ^^https://nicecrew.tv/static/streaming-playlists/hls/2a9a552e-767f-4f69-9ffe-6350c55b755d/0f44d617-15d4-4c8e-b8e7-c9faf75e4c04-master.m3u8https://nicecrew.tv/videos/embed/6g8gUrnv1ey8TrLvz5nxmi300002024-12-15T01:41:30.925ZDark angelstwo partercuteegdyAngelsYESDreamy's LoungeNOhttps://nicecrew.tv/w/ugy7SLTFvpEfZ4WS6j9kDQhttps://nicecrew.tv/lazy-static/thumbnails/1f4d5fd4-3d08-401a-98a8-56ef63d37b41.jpgDrawing Dark angel and fog p2I hope you guys enjoy this drawing! I love you all! ^^ Finished: http://rainbowdoodler209.deviantart.com/art/Dark-angel-in-fog-638673221?ga_submit_new=10%253A1475810492https://nicecrew.tv/static/streaming-playlists/hls/e4ebd531-593a-46bb-88be-88e3e6c73f3e/05124f44-9c77-46cd-b172-59cfbf0ab747-master.m3u8https://nicecrew.tv/videos/embed/ugy7SLTFvpEfZ4WS6j9kDQ443002024-12-15T01:41:47.835ZCuteTwo parterAnimegreyYESDreamy's LoungeNOhttps://nicecrew.tv/w/dTTHVwbaYcckHBiZWEx3tHhttps://nicecrew.tv/lazy-static/thumbnails/c81dbe52-26c1-4731-a85e-68a9bc4c0714.jpgDrawing Cocktail HulaA cute little Cockatiel bird drawing when I was thinking of something else to draw! Please enjoy! Cheep cheep: http://rainbowdoodler209.deviantart.com/art/Cocktail-hula-638877616?ga_submit_new=10%253A1475911662https://nicecrew.tv/static/streaming-playlists/hls/686c78b4-570e-4f11-8b99-e48eb236a347/7681630e-6325-4c62-94cc-790e03ddede2-master.m3u8https://nicecrew.tv/videos/embed/dTTHVwbaYcckHBiZWEx3tH300002024-12-15T01:41:41.934ZCuteCockatielcolorfulPainttoolsaibirdsYESDreamy's LoungeNOhttps://nicecrew.tv/w/7XqMYnc1H8v22Er8Vh2AVehttps://nicecrew.tv/lazy-static/thumbnails/dbd22ef7-e8cb-4fa8-9076-de54e00bfca8.jpg【Utau】 Clarina: HypernessAnother little Utau video for fun! I'm trying to make a song that makes you very hyper! Or just trying to make a fast paced song! Please enjoy and stuff!https://nicecrew.tv/static/streaming-playlists/hls/385404af-872e-44cb-b981-02f106ad7e5f/aa810642-6eda-40a9-bd01-e64347c7e8b7-master.m3u8https://nicecrew.tv/videos/embed/7XqMYnc1H8v22Er8Vh2AVe73002024-12-15T01:40:53.538ZUTAUloidUTAU NEWCOMERUTAU ClarinaBoredomYESDreamy's LoungeNOhttps://nicecrew.tv/w/f5qdo9DQ19urH3EdgV7mmohttps://nicecrew.tv/lazy-static/thumbnails/ac397068-a5a0-40a0-9f05-0a4454a7b316.jpgDrawing Dispair DevilAnother despair drawing but with a little devil girl! please enjoy! Thanks for watching and enjoy everyone! ^^ Little devil: http://rainbowdoodler209.deviantart.com/art/Despair-Devil-639250307https://nicecrew.tv/static/streaming-playlists/hls/71fdd6a1-e064-4f1c-b5de-942e3e3b2b0e/06bbfb3e-a114-4b7b-a18b-5607bf52973f-master.m3u8https://nicecrew.tv/videos/embed/f5qdo9DQ19urH3EdgV7mmo300002024-12-15T01:41:43.897ZDevilscuteshirtPainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/fppuoHC65YF5aLXJGCugtUhttps://nicecrew.tv/lazy-static/thumbnails/e94a71e1-7acb-4207-81da-e225b1f596bc.jpgDrawing: Zinc GirlA little Zinc girl drawing because why not! Finished elemental girl: http://rainbowdoodler209.deviantart.com/art/Zinc-girl-639627615?ga_submit_new=10%253A1476240811https://nicecrew.tv/static/streaming-playlists/hls/74a4861c-b9c0-4e05-a11a-9e755811a50e/e4bfcdcf-bbe9-49a0-8d5d-4976902f30a0-master.m3u8https://nicecrew.tv/videos/embed/fppuoHC65YF5aLXJGCugtU150002024-12-15T01:41:29.001ZCuteElementsZincMetalsYESDreamy's LoungeNOhttps://nicecrew.tv/w/jNjLChExq19xmQyx77S26xhttps://nicecrew.tv/lazy-static/thumbnails/c2c6af75-4af2-45c3-a4b2-aed64fff7a2f.jpgSpeed Drawing: bored DevilA little devil drawing before bed, I just wanted to draw a devil girl again! :)https://nicecrew.tv/static/streaming-playlists/hls/983c46bf-69f4-46d6-9b58-d4b446e5c015/e5897c3d-d9ac-4666-b0ff-001c528b0155-master.m3u8https://nicecrew.tv/videos/embed/jNjLChExq19xmQyx77S26x24002024-12-15T01:41:04.744ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/go4UHZu1fAicShMn4HFxzMhttps://nicecrew.tv/lazy-static/thumbnails/3a4c934b-97b5-4e56-880a-34c9b6f9c564.jpgDrawing: LonerA drawing of a loner piano angel that will only be used as a replacement for instrument players! Finished loner: http://rainbowdoodler209.deviantart.com/art/Loner-639971259?ga_submit_new=10%253A1476410769https://nicecrew.tv/static/streaming-playlists/hls/7c8dda14-016c-42da-9b35-7289dc91a74b/c9deaeb6-03d8-44f2-a700-d27ebe9b06dd-master.m3u8https://nicecrew.tv/videos/embed/go4UHZu1fAicShMn4HFxzM300002024-12-15T01:41:45.764ZPianoAngellonercolorfulTransparentYESDreamy's LoungeNOhttps://nicecrew.tv/w/oEUQFeRrd4w5kbMFB1TDgLhttps://nicecrew.tv/lazy-static/thumbnails/da231154-1a37-47a8-aecf-77d984f51c9b.jpg(UTAU Clarina) MehAnother little Utau! I hope you guys enjoy! That is all! :)https://nicecrew.tv/static/streaming-playlists/hls/b797e08b-41ed-41db-8036-20761096e8de/95a5a27f-e68b-479a-b713-ccf26b1c782e-master.m3u8https://nicecrew.tv/videos/embed/oEUQFeRrd4w5kbMFB1TDgL123002024-12-15T01:41:53.302ZUTAUUTAU ClarinaYESDreamy's LoungeNOhttps://nicecrew.tv/w/tRcrscKmBWuyBjnmg6Nrqrhttps://nicecrew.tv/lazy-static/thumbnails/3a1c16ba-5b49-4fab-9992-f7ffc21e705f.jpgGirl and MonsterAnother animation because why not! I'll be at a Chinese festivel tomorrow so I'll be back after the festival!https://nicecrew.tv/static/streaming-playlists/hls/e1853ceb-f16c-44d8-97e5-cfbdbe61606d/81ea1cb7-d18a-4f02-b699-c2ba30fc7c5b-master.m3u8https://nicecrew.tv/videos/embed/tRcrscKmBWuyBjnmg6Nrqr15002024-12-15T01:41:20.463ZCutemonstersBlack and whiteYESDreamy's LoungeNOhttps://nicecrew.tv/w/7PrD33UgbVStKBmmoaxiQshttps://nicecrew.tv/lazy-static/thumbnails/55e9288c-3c71-49e0-85c5-82afbe6f6fae.jpgDrawing: Grey GooseA little grey goose, he mostly appear at night honking loudly to annoy others! Please enjoy! ^^ Honk Honk: http://rainbowdoodler209.deviantart.com/art/Grey-Goose-640262368?ga_submit_new=10%253A1476554230https://nicecrew.tv/static/streaming-playlists/hls/373696e6-f905-455a-a599-d48dc6832286/b6a45cd9-7cf8-400f-a8b9-adf8fb0743d9-master.m3u8https://nicecrew.tv/videos/embed/7PrD33UgbVStKBmmoaxiQs517002024-12-15T01:42:01.424ZGoose drawingsbirdsgreycuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/cM9YLa39ocKDBVNQuU7CsGhttps://nicecrew.tv/lazy-static/thumbnails/591ed13d-e393-46a4-a2e9-a6730b14b251.jpgDrawing: милый котA cute little Russian inspired cartoon! Please enjoy and stuff! I don't have a Russian keyboard so yeah! Enjoy! Cute cat: http://rainbowdoodler209.deviantart.com/art/Cute-cat-640567943?ga_submit_new=10%253A1476670135https://nicecrew.tv/static/streaming-playlists/hls/5f628737-cfad-46f7-9e1e-4f8a5da66ecc/6e54e311-2c3f-478b-826d-b5be708db03d-master.m3u8https://nicecrew.tv/videos/embed/cM9YLa39ocKDBVNQuU7CsG287002024-12-15T01:42:00.582Zмилый котcute catPastelPainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/h44ewKa5b5EyoavhiMpZ18https://nicecrew.tv/lazy-static/thumbnails/80427309-a206-41f0-96c0-9ac41bbea742.jpgDrawing: Cute trollA little drawing of a little female troll! please enjoy! Ta ta ta: http://rainbowdoodler209.deviantart.com/art/Cute-troll-640753688?ga_submit_new=10%253A1476757400https://nicecrew.tv/static/streaming-playlists/hls/81ff7144-3f4f-4e09-a8dc-baaa86b7ab93/9e99e63e-5f4e-4318-9919-622c356eed98-master.m3u8https://nicecrew.tv/videos/embed/h44ewKa5b5EyoavhiMpZ18150002024-12-15T01:41:58.150ZCutecolorfulTrollsCartoonsYESDreamy's LoungeNOhttps://nicecrew.tv/w/8fpADVfrYP3aCXLfuutZ6chttps://nicecrew.tv/lazy-static/thumbnails/084a5dec-f286-4560-98aa-f4e7e24ff3ca.jpgDrawing: Star NekoA cute little neko girl drawing but wearing a galaxy shirt! Please enjoy and stuff! Nya~: http://rainbowdoodler209.deviantart.com/art/Star-Neko-640911582?ga_submit_new=10%253A1476839120https://nicecrew.tv/static/streaming-playlists/hls/3ab2ed05-58a1-4b83-8356-a2366ab58429/ddebe55e-f007-49ff-8932-8d8ca2e7c9e3-master.m3u8https://nicecrew.tv/videos/embed/8fpADVfrYP3aCXLfuutZ6c150002024-12-15T01:41:59.780ZAnimeNeko girlcutecolorfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/rFcuJpv6FGosKfNXArbrenhttps://nicecrew.tv/lazy-static/thumbnails/fd6f6d64-4032-4ba8-b938-a03071141b0a.jpgDrawing: Purple girl (MS Paint)Another rlittle MS paint drawing beucause I feel this paint program needs more love and care since, well you might know why MS paint has an awful rep! Anyways please enjoy this little drawing and goodnight! ^^ Finished painting: http://rainbowdoodler209.deviantart.com/art/Purple-girl-641094109?ga_submit_new=10%253A1476931432https://nicecrew.tv/static/streaming-playlists/hls/cfed8ecb-f4d0-4ebd-9943-363ca72ff5ab/7eff140b-e7d3-4f00-b31a-2828716b73bf-master.m3u8https://nicecrew.tv/videos/embed/rFcuJpv6FGosKfNXArbren300002024-12-15T01:42:02.484ZMS Paintcuteanimeanime girlspastelYESDreamy's LoungeNOhttps://nicecrew.tv/w/6M6aJUqhcq5us7irMRCrLAhttps://nicecrew.tv/lazy-static/thumbnails/410366fd-d24c-45c0-9822-729fef974d3e.jpgDrawing Espeony! P1A cute little drawing of Espeony I'll post part two as well! And he wanted me to draw him a profile picture! ^^ Enjoy!https://nicecrew.tv/static/streaming-playlists/hls/2ec95909-43dd-44a3-bfc3-af01d491362e/d3bd23ad-1b40-4218-8ba6-c46e3779cc97-master.m3u8https://nicecrew.tv/videos/embed/6M6aJUqhcq5us7irMRCrLA600002024-12-15T01:42:10.243ZCuteanimeProfile requestMS PaintSpeed paintYESDreamy's LoungeNOhttps://nicecrew.tv/w/s6GP9cH8H8Aqjmpr9iUowzhttps://nicecrew.tv/lazy-static/thumbnails/c7c736e9-e90f-4fa8-a41c-21cc58f4f87d.jpgDrawing peony! P2Here's part two of this drawing video! ^^ Please enjoy everyone and newcomers! Espeony!: http://rainbowdoodler209.deviantart.com/art/Espeony-641251643?ga_submit_new=10%253A1477013260https://nicecrew.tv/static/streaming-playlists/hls/d35979cc-c68e-4e29-86fd-4d60ec7b58f5/bd80afd9-2ac4-47f3-940c-e8d544e7ea4a-master.m3u8https://nicecrew.tv/videos/embed/s6GP9cH8H8Aqjmpr9iUowz237002024-12-15T01:42:01.990ZCuteanime drawingMS Paintpastel colorsYESDreamy's LoungeNOhttps://nicecrew.tv/w/jrL3SRho12zJaAo8ZdeLNxhttps://nicecrew.tv/lazy-static/thumbnails/8592ad05-596c-418d-bb63-5d77bdb336d1.jpgDrawing: гневI'll admit, I kind of liked using Russian text because why not! Please enjoy and stuff! I'm tired... Pastel гнев: http://rainbowdoodler209.deviantart.com/art/Anger-641457713?ga_submit_new=10%253A1477112425https://nicecrew.tv/static/streaming-playlists/hls/955d3c95-b71c-4a64-b2c7-c4553b360ce3/a6e938d5-19e4-4df6-8d28-0b1e85de23b6-master.m3u8https://nicecrew.tv/videos/embed/jrL3SRho12zJaAo8ZdeLNx300002024-12-15T01:42:03.709Zгневrussiananime drawingscutepastel colorsYESDreamy's LoungeNOhttps://nicecrew.tv/w/adcKVoKRr9ZrMqLFbmkFTqhttps://nicecrew.tv/lazy-static/thumbnails/4e0faa47-3c6f-4523-9f85-7d0963c67e39.jpgDrawing: Dispair CliffordA creepy little drawing of Clifford the lovable red dog from childhoods in the USA and elsewhere! Please enjoy this creepy drawing! ^^ Woof woof: http://rainbowdoodler209.deviantart.com/art/Dispair-Clifford-641657196?ga_submit_new=10%253A1477191459https://nicecrew.tv/static/streaming-playlists/hls/4a966b39-5000-413f-8ecd-64519bafb25a/20d744dd-88cc-4b10-bcb8-e1e5c3fdb592-master.m3u8https://nicecrew.tv/videos/embed/adcKVoKRr9ZrMqLFbmkFTq300002024-12-15T01:42:07.596ZCliffordredcreepyhorrorYESDreamy's LoungeNOhttps://nicecrew.tv/w/qanYTbPcFZqarYFJV9D96Hhttps://nicecrew.tv/lazy-static/thumbnails/08828ff3-4ab7-4dcf-aab5-f6b575f0f129.jpgSnail BoyA cute little animation because why not! Snails are cute!https://nicecrew.tv/static/streaming-playlists/hls/c3aa9160-71ab-4958-8bd4-adf4a32a2ad3/c2003f43-b8b2-41c9-aa39-3b4fb865d5c6-master.m3u8https://nicecrew.tv/videos/embed/qanYTbPcFZqarYFJV9D96H18002024-12-15T01:42:02.893ZSnail boycutePaper animationanimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/nGguNaKP8CuR4d4ZTNS6aLhttps://nicecrew.tv/lazy-static/thumbnails/674e5d8a-ee86-44ef-941a-3c8cf6e94011.jpgDrawing: усталаAnother Russian drawing before bed! I'm tired and I'll get more sleep! Finished sleeping: http://rainbowdoodler209.deviantart.com/art/Tired-642052602?ga_submit_new=10%253A1477365056https://nicecrew.tv/static/streaming-playlists/hls/afaf3673-f0ef-4d85-9b52-e1ff1e58093a/02ff9a90-1262-47fe-88a4-e90eff592c9e-master.m3u8https://nicecrew.tv/videos/embed/nGguNaKP8CuR4d4ZTNS6aL226002024-12-15T01:42:07.841ZусталаrussiananimecolorfulpainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/pHZegtc8J5nM6jKqd6Mgbkhttps://nicecrew.tv/lazy-static/thumbnails/9ecccaf9-e5c1-4973-8944-6264d9494b9d.jpgDrawing: Ununpentium P1Sorry I lagged at the end! My touch screen messed up on me and I just reset the screen! I wanted to try to to draw the unspecified Elements that are on the lowest part of the periodic table! Enjoy!https://nicecrew.tv/static/streaming-playlists/hls/c01ef3c4-2371-4cac-8aaf-5473875d6ecb/482a659a-daf6-4f50-8ae5-bf7ca4bbc55b-master.m3u8https://nicecrew.tv/videos/embed/pHZegtc8J5nM6jKqd6Mgbk300002024-12-15T01:42:09.714ZUnunpentiumAnime girlsdull pastelYESDreamy's LoungeNOhttps://nicecrew.tv/w/kuHhYD3kGE3HFEtcdckK2ahttps://nicecrew.tv/lazy-static/thumbnails/ecc0f32b-9ce0-43b5-9bf3-d439ec84b8be.jpgDrawing: Ununpentium P2I hope you guys enjoy this video and stuff! ^^ Finished element: http://rainbowdoodler209.deviantart.com/art/Ununpentium-642216218https://nicecrew.tv/static/streaming-playlists/hls/9ddfe85a-694f-414f-8440-62492d7a89b7/0c548a4b-e739-401e-9759-947a1007228b-master.m3u8https://nicecrew.tv/videos/embed/kuHhYD3kGE3HFEtcdckK2a232002024-12-15T01:42:08.890ZUnunpentiumAnimetwo partercutedull pastelYESDreamy's LoungeNOhttps://nicecrew.tv/w/2EPS8UqkRvDuMPBVZB1wpyhttps://nicecrew.tv/lazy-static/thumbnails/3b2fa87e-5ae6-47e7-8945-737fe83d4f7f.jpgDrawing: Purple Yandere-chanA little bloody yandere drawing for Espeony! Please enjoy this purple blood cover drawing! Finished bloodbath: http://rainbowdoodler209.deviantart.com/art/Purple-Yandere-Chan-642560394?ga_submit_new=10%253A1477624252https://nicecrew.tv/static/streaming-playlists/hls/0d84e640-1f7f-4c45-bbfd-e4b2d8364d1e/3d467190-d340-40c6-a83c-e13dd3c91b7d-master.m3u8https://nicecrew.tv/videos/embed/2EPS8UqkRvDuMPBVZB1wpy300002024-12-15T01:42:15.109ZYandere_ChanPurplebloodyPainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/dWma6eE5w9QUmBjbQATWKNhttps://nicecrew.tv/lazy-static/thumbnails/eaf93344-fea7-4947-bc01-175333fe8bab.jpgDrawing: Praying for hopeA little drawing of Jamna because why not! I'll be moving near my school, I guess I'll like my new home! Please enjoy and stuff! Praying: http://rainbowdoodler209.deviantart.com/art/Praying-for-hope-642743561?ga_submit_new=10%253A1477714777https://nicecrew.tv/static/streaming-playlists/hls/68c43fe0-e3f0-406e-aae5-a180eeffc61c/dc9c179e-9012-4f8b-8094-12ec1428c400-master.m3u8https://nicecrew.tv/videos/embed/dWma6eE5w9QUmBjbQATWKN300002024-12-15T01:42:15.194ZJamnapurpleredpainttool saidarkYESDreamy's LoungeNOhttps://nicecrew.tv/w/tpafcvDgVZkv5FXPpoNSL2https://nicecrew.tv/lazy-static/thumbnails/deaae241-99cb-4ba7-8f1b-70ad076f46d3.jpgDrawing: Anone Black midi V2Another profile drawing request by the lovely Anone Black midi! Please enjoy and I hope you really like it Anone! ^^ Flying in the skies: http://rainbowdoodler209.deviantart.com/art/Anone-Black-midi-V2-642890310?ga_submit_new=10%253A1477783125https://nicecrew.tv/static/streaming-playlists/hls/dde28c3f-4c2f-4492-a90a-6520293dd131/8b73cc14-6039-4e25-b18b-bb9ba4dd71a6-master.m3u8https://nicecrew.tv/videos/embed/tpafcvDgVZkv5FXPpoNSL2300002024-12-15T01:42:16.943ZPiano_angelColorfulAnimeBlack midiPainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/kQnN7LbxEpetT3cU4nnNP5https://nicecrew.tv/lazy-static/thumbnails/edb10283-6847-4367-8337-7c4da2d87669.jpgFluff ball and Turkey girlPlease enjoy this little animation! Happy Halloween everyone!https://nicecrew.tv/static/streaming-playlists/hls/a09ec468-3fa5-40bf-a83e-325f89b7ac1a/082c0202-d0b7-41fe-8a5e-66ad5e87fab8-master.m3u8https://nicecrew.tv/videos/embed/kQnN7LbxEpetT3cU4nnNP536002024-12-15T01:42:10.407ZAnimationcuteoddYESDreamy's LoungeNOhttps://nicecrew.tv/w/5EjvkL9gtpLQnPpVGzUCCphttps://nicecrew.tv/lazy-static/thumbnails/aef1c1f0-fde3-4b0d-b40e-b56227b00677.jpgDrawing/ Fall LucyannaAnother little profile drawing video, please enjoy and have a fantastic night everybody! Sorry if the hair looks a little off! I added some shading to this drawing after recording! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Fall-Lucyanna-643871632?ga_submit_new=10%253A1478238444https://nicecrew.tv/static/streaming-playlists/hls/25be38f9-0c9a-4fa2-b0ab-15be04b5df3f/b214d8e7-34cc-4884-b11e-9d4e6ac3532c-master.m3u8https://nicecrew.tv/videos/embed/5EjvkL9gtpLQnPpVGzUCCp300002024-12-15T01:42:17.106ZLucyanna KimselPainttoolsaicuteAutumn colorsanimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/ktFGe4jqLHr1QZyvyPFqQ3https://nicecrew.tv/lazy-static/thumbnails/36e5b02c-e097-4f75-8fa9-8851c6daf1a8.jpgDrawing/ Racism P1A little political cartoon basically about two cats hurting each other over their fur color! I hope you enjoy part 1 everyone!https://nicecrew.tv/static/streaming-playlists/hls/9dbb2da7-bf90-4843-b65e-d4fbff74328a/68d5cf09-266f-4952-bf36-7db11dfdbacc-master.m3u8https://nicecrew.tv/videos/embed/ktFGe4jqLHr1QZyvyPFqQ3300002024-12-15T01:42:23.579ZPolitical cartoonscutebloodyYESDreamy's LoungeNOhttps://nicecrew.tv/w/vX42aWRJPnBHuqenbhnBkUhttps://nicecrew.tv/lazy-static/thumbnails/9a126129-9910-485f-bb99-a27b8647cac4.jpgDrawing/ Racism P2I hope you guys enjoy this little drawing videos! Even if their two parter and stuff! Hiss Meow: http://rainbowdoodler209.deviantart.com/art/Racism-644045792https://nicecrew.tv/static/streaming-playlists/hls/f288ca2d-3cfb-4369-9b22-7a15e36ae6b6/f2d1239f-ac61-469c-b210-da13cf526f11-master.m3u8https://nicecrew.tv/videos/embed/vX42aWRJPnBHuqenbhnBkU300002024-12-15T01:42:25.341ZPoliticalanimecatscutebloodyYESDreamy's LoungeNOhttps://nicecrew.tv/w/wjFXr6RSUxWaisMULVWgSShttps://nicecrew.tv/lazy-static/thumbnails/ee947b16-4912-4543-b82a-d3cd12308bba.jpgDrawing/ I'm not blushing!Another devil drawing because they're pretty fun to make! And I hope you enjoy and stuff! I did the rest of the drawing off camera so yeah! I'm not upset: http://rainbowdoodler209.deviantart.com/art/I-m-not-blushing-644238266?ga_submit_new=10%253A1478403311https://nicecrew.tv/static/streaming-playlists/hls/f58e2bd7-8d5d-485d-83b9-29482b8d7662/5cd7fe6d-5ef7-4901-a87d-f012b9124bd0-master.m3u8https://nicecrew.tv/videos/embed/wjFXr6RSUxWaisMULVWgSS150002024-12-15T01:42:17.203ZDevilsAnime girlsAnime devilsHellPainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/1UbLsyizsHugpioQccUvf9https://nicecrew.tv/lazy-static/thumbnails/a22533ac-c29e-40bf-8b87-eb75812c8323.jpgDrawing/ Angry EyegirlA cute little drawing of a monster named Eyegirl! She is basically inspired by PonPonPon! I like using emotions on my characters! Enjoy everyone! I did the rest of the drawing off camera again so yeah! Eyegirl is not happy: http://rainbowdoodler209.deviantart.com/art/Angry-Eyegirl-644423493?ga_submit_new=10%253A1478480370https://nicecrew.tv/static/streaming-playlists/hls/07494fa6-eab3-42e4-afd8-af31178013f8/9e61854a-c36a-4398-a5d6-24950eac0363-master.m3u8https://nicecrew.tv/videos/embed/1UbLsyizsHugpioQccUvf9150002024-12-15T01:42:26.533ZEyegirlcuteanimepastelEmotional drawingYESDreamy's LoungeNOhttps://nicecrew.tv/w/w7T92hr2uiZ7cUR5FRkw5Hhttps://nicecrew.tv/lazy-static/thumbnails/e9c39e32-b8b3-4677-8f34-80af00cb3ed0.jpgDrawing: Pony Girl!I know I need to change my art style at some point! I'm sorry! But I hope you guys enjoy this little drawing video! Neigh neigh: http://rainbowdoodler209.deviantart.com/art/Pony-girl-644802387https://nicecrew.tv/static/streaming-playlists/hls/f3e82334-ce80-4285-ad42-8d1f9171a531/e14d443a-590b-45b8-b599-7e61562c885d-master.m3u8https://nicecrew.tv/videos/embed/w7T92hr2uiZ7cUR5FRkw5H150002024-12-15T01:42:24.930ZPonyanimepastelbordemYESDreamy's LoungeNOhttps://nicecrew.tv/w/m9EKEKTL4qJmwUHv48vWVdhttps://nicecrew.tv/lazy-static/thumbnails/1babddf4-f262-4244-bf52-a210b8db9ade.jpgMeet Agitated! P1A little drawing one of my subscribers! I hope you like it everyone! Requests are open as well if you wan to tell me some!https://nicecrew.tv/static/streaming-playlists/hls/a32c9b0e-0d79-4468-b57a-1a24f0dd683e/bcd821d2-99eb-47e9-ac73-4f411ad78038-master.m3u8https://nicecrew.tv/videos/embed/m9EKEKTL4qJmwUHv48vWVd150002024-12-15T01:42:27.028ZColorfulrobotmaskedpainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/gSDsAQWg1kjyYXickYF92dhttps://nicecrew.tv/lazy-static/thumbnails/f6293f4d-0a78-4e3f-b70f-dfe37d269226.jpgMeet Agitated! P2Just wanted to upload part two real quick, please enjoy and like, comment and sub to my channel for more art and stuff!https://nicecrew.tv/static/streaming-playlists/hls/808b5a64-f62c-4739-a263-c46895cdda1e/a103b4f7-6f9c-4815-896e-6b5c8a3cc4ad-master.m3u8https://nicecrew.tv/videos/embed/gSDsAQWg1kjyYXickYF92d600002024-12-15T01:43:25.065ZcreepyhorrorAgitatedcolofulYESDreamy's LoungeNOhttps://nicecrew.tv/w/7BhfpEdRPzp2KcR9E9aus8https://nicecrew.tv/lazy-static/thumbnails/ef5e151c-68df-458f-868c-6c1cc3021921.jpgDrawing: FlightlessMy cute fallen angel named Sparkine, I wanted to draw her because she's so fun to draw! Please enjoy and stuff! ^^ Struggling to fly: http://rainbowdoodler209.deviantart.com/art/Flightless-645342905?ga_submit_new=10%253A1478933192https://nicecrew.tv/static/streaming-playlists/hls/3583e099-ff09-4085-8eb4-c161a434c903/dbfbfe37-e9c5-419a-842b-b181c4c0c72b-master.m3u8https://nicecrew.tv/videos/embed/7BhfpEdRPzp2KcR9E9aus8150002024-12-15T01:42:28.630ZAngelsFallen angelscutePainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/sTVvRf7Rruzn5LzBShp8Cyhttps://nicecrew.tv/lazy-static/thumbnails/077c8986-4b52-4bde-a4e8-246d707b90b9.jpgDrawing: Color GirlA cute little girl that lives in a strange surreal world of colors and nothingness! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Color-girl-645544601?ga_submit_new=10%253A1479014243https://nicecrew.tv/static/streaming-playlists/hls/d9cd8459-f0b9-41d6-9d99-afbd745b2d5c/6cfb377d-98dc-4929-852a-aaa507dbd9e3-master.m3u8https://nicecrew.tv/videos/embed/sTVvRf7Rruzn5LzBShp8Cy150002024-12-15T01:42:30.196ZColorfulanimePainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/rbbuuDJEDQnhScgwuvjtY2https://nicecrew.tv/lazy-static/thumbnails/cdd21ff3-eb96-4b4a-9cea-3f3ccdc9ea7a.jpgDumpling Boy (Animation)A cute little animation of a cute dumpling boy I made for fun! and I love dumplings so much!https://nicecrew.tv/static/streaming-playlists/hls/cbe05ea3-36c6-408d-8ca9-1649bcfede9d/5a59eedf-7340-4de2-b500-6a46c72548c6-master.m3u8https://nicecrew.tv/videos/embed/rbbuuDJEDQnhScgwuvjtY237002024-12-15T01:42:28.110ZCuteAnime boyPaper animationsshortloopedYESDreamy's LoungeNOhttps://nicecrew.tv/w/ikc1ZjUp2WtaMGkAF9eWKChttps://nicecrew.tv/lazy-static/thumbnails/d3a66f73-7e62-4916-8b97-d8fb6232863f.jpgDrawing/ Impatient AngelA drawing of an angel of negativity, waiting for someone to die! Please enjoy this video and sub and like my channel! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Impatient-Angel-645746312?ga_submit_new=10%253A1479094591https://nicecrew.tv/static/streaming-playlists/hls/8c594741-7551-4d68-91ed-27b6b11b2962/3423de2d-fcb5-47b2-9dfd-164866ffe089-master.m3u8https://nicecrew.tv/videos/embed/ikc1ZjUp2WtaMGkAF9eWKC150002024-12-15T01:42:31.078ZAngelsanimeredMonochromaticYESDreamy's LoungeNOhttps://nicecrew.tv/w/n9J89TT2ozqcd3TtuGnxsBhttps://nicecrew.tv/lazy-static/thumbnails/bc96bd39-3c74-4915-ad8a-dc329e0b0835.jpgStompingA little animation of a monster stomping his feet to music!https://nicecrew.tv/static/streaming-playlists/hls/ab47d24a-516e-4004-b6b4-4a1befd560eb/5a605c54-bfc1-4706-89c4-a5748265ed0a-master.m3u8https://nicecrew.tv/videos/embed/n9J89TT2ozqcd3TtuGnxsB23002024-12-15T01:42:29.544ZCutemonstersanimationsYESDreamy's LoungeNOhttps://nicecrew.tv/w/fNMuhULbf4DFCsdVvgCPMPhttps://nicecrew.tv/lazy-static/thumbnails/4ce8e090-a9a5-4509-8d80-e827a2d1e4b1.jpgDrawing/ Jetfreeze P1A drawing of Jetfreeze from my old comic I made called "Attack of the Killer Clams" Please enjoy!https://nicecrew.tv/static/streaming-playlists/hls/77e83000-3b7a-4028-82f9-5d2ec97b77ed/ba86bd73-411e-41fb-bc29-b9cf6832d533-master.m3u8https://nicecrew.tv/videos/embed/fNMuhULbf4DFCsdVvgCPMP150002024-12-15T01:42:35.984ZJetfreeze BotcreepyYESDreamy's LoungeNOhttps://nicecrew.tv/w/h63e9aWV1tR652dw7hGcAJhttps://nicecrew.tv/lazy-static/thumbnails/17ca540d-35bc-409d-90a1-e5e94d3d1042.jpgDrawing Jetfreeze P2I hope you guys like this video and stuff! Enjoy! Finished robot: http://rainbowdoodler209.deviantart.com/art/JetFreeze-646071159?ga_submit_new=10%253A1479256308https://nicecrew.tv/static/streaming-playlists/hls/82464f40-ab28-4f09-81b2-4973fce18fea/c0450c69-d432-4b86-bce5-2f5685f1c569-master.m3u8https://nicecrew.tv/videos/embed/h63e9aWV1tR652dw7hGcAJ150002024-12-15T01:42:37.616ZRobotsheadJetfreezeYESDreamy's LoungeNOhttps://nicecrew.tv/w/6buLEQT5V2iEgVaBTVFa1Rhttps://nicecrew.tv/lazy-static/thumbnails/d4931bf2-e518-4b33-9538-f46a11ee111a.jpg//Bloody Maiden//A little bloody neko maiden before bedtime! Enjoy~ Nya~:http://rainbowdoodler209.deviantart.com/art/Bloody-maiden-646280788?ga_submit_new=10%253A1479356696https://nicecrew.tv/static/streaming-playlists/hls/29f4dc7a-95e0-4c4a-bb1a-4a94f6e979fd/642b16ed-0c5c-4f47-bcc7-1b20042b5f82-master.m3u8https://nicecrew.tv/videos/embed/6buLEQT5V2iEgVaBTVFa1R281002024-12-15T01:42:58.665ZHorrorcreepyYESDreamy's LoungeNOhttps://nicecrew.tv/w/uwhkmRAyfarkAH9fwxriGihttps://nicecrew.tv/lazy-static/thumbnails/03334a32-00ab-4087-bfd3-4da24b1b4809.jpg//Odd boy//A strange boy with monster coming of his head full of dreams and nightmares! I dunno what else to say here! Please enjoy guys! Strange ears?:http://rainbowdoodler209.deviantart.com/art/Odd-Boy-646441366?ga_submit_new=10%253A1479440121https://nicecrew.tv/static/streaming-playlists/hls/e6fa42fa-5dbd-4ac4-b9ad-5b8d629c609d/5437bf27-4b4a-4aa6-a116-aa4ebcc9fcba-master.m3u8https://nicecrew.tv/videos/embed/uwhkmRAyfarkAH9fwxriGi273002024-12-15T01:42:58.577ZColorfulstrangeweirddreamlikesurrealYESDreamy's LoungeNOhttps://nicecrew.tv/w/vRJjbzT9KC9NcDfMtvwxvhhttps://nicecrew.tv/lazy-static/thumbnails/d70745c8-53ba-4e8b-b963-28f8cf96fa0c.jpgDrawing/ Crayon DogSorry I wasn't uploading earlier, was tired out from school! I hope you guys enjoy this drawing! Bork Bork: http://www.furaffinity.net/view/21761259/https://nicecrew.tv/static/streaming-playlists/hls/f1ca8ae0-4dd6-4922-8735-3c9df15d189e/a860c617-cecf-407d-8c3b-dae276c5b17a-master.m3u8https://nicecrew.tv/videos/embed/vRJjbzT9KC9NcDfMtvwxvh276002024-12-15T01:43:01.881ZNick WcolorfulAnimeboyYESDreamy's LoungeNOhttps://nicecrew.tv/w/bcsZeLKD6zH9AUyCGiz8i3https://nicecrew.tv/lazy-static/thumbnails/0aa3c735-0e6f-4eec-9cc7-fc9b4ebfd694.jpgSpeed drawing: Robot girl-5767I wanted to use colored pencils again! Please enjoy this cute robot girl drawing! Bleep bloop: http://rainbowdoodler209.deviantart.com/art/Robot-girl-5767-646783589https://nicecrew.tv/static/streaming-playlists/hls/52953305-e3cf-4436-adef-7f609c628f10/6d382613-84a9-49b4-86d9-fd326d436a82-master.m3u8https://nicecrew.tv/videos/embed/bcsZeLKD6zH9AUyCGiz8i336002024-12-15T01:42:39.493ZColored-pencilscuteanimerobot girlsspeed drawingsYESDreamy's LoungeNOhttps://nicecrew.tv/w/d8nRejSk3LiA2EJ7GwryC1https://nicecrew.tv/lazy-static/thumbnails/103593aa-b437-4774-9439-594576b4b75f.jpgDrawing Baddy and Moody P1A request from my subs "Allen/CarlosCP" I hope you enjoy this drawing request! Like, sub and comment more requests and stuff!https://nicecrew.tv/static/streaming-playlists/hls/623555c9-65e7-463e-bbbb-1461852d31f0/1497673d-1e16-4c5d-a1ee-c253be1c6947-master.m3u8https://nicecrew.tv/videos/embed/d8nRejSk3LiA2EJ7GwryC1150002024-12-15T01:42:57.046ZCuteBaddy & MoodycolorfulanimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/5potSNz5NN8DyAshVoCv4Rhttps://nicecrew.tv/lazy-static/thumbnails/6010a49f-7fdc-4ef2-8b23-e78300422534.jpgDrawing Baddy and Moody P2Part two of Allen/CarlosCP's rerquest! Please enjoy and stuff! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Baddy-Moody-647160475https://nicecrew.tv/static/streaming-playlists/hls/23a883f9-5db2-4d40-8e09-752d3ecbe813/800f0d14-a9cf-49ac-892e-fb071f9a3527-master.m3u8https://nicecrew.tv/videos/embed/5potSNz5NN8DyAshVoCv4R150002024-12-15T01:43:00.187ZPastelcuteanimespeeddrawinggirlsYESDreamy's LoungeNOhttps://nicecrew.tv/w/2fQPSjVq2xcBichJ7J4NEihttps://nicecrew.tv/lazy-static/thumbnails/6dba35d5-2e2b-446f-8141-3cb6ee1aae8e.jpgDrawing: 嫦娥A request by my Manderin Teacher! I finished the full drawing off camera so yeah! Please enjoy the video and stuff! Finished moon: http://rainbowdoodler209.deviantart.com/art/Chang-E-647352839https://nicecrew.tv/static/streaming-playlists/hls/0a2ba41f-5924-4274-803b-f1d94e2c217d/98c6497b-57ee-444c-aa41-1ac86e1db823-master.m3u8https://nicecrew.tv/videos/embed/2fQPSjVq2xcBichJ7J4NEi150002024-12-15T01:43:00.423ZChang eChineseAnime chineseYESDreamy's LoungeNOhttps://nicecrew.tv/w/39bBEyyTM4HmopFSPZPHQ2https://nicecrew.tv/lazy-static/thumbnails/1c533ab2-0486-4139-9374-99d59c103372.jpgDrawing/ GengarAnother request by my lovely subscribers! Finished Gengar: http://rainbowdoodler209.deviantart.com/art/Gengar-647460189https://nicecrew.tv/static/streaming-playlists/hls/1156c4e7-1c6f-4de7-97e8-f479aa7f20ed/3ccab265-d492-455a-bbab-e669ddc031b8-master.m3u8https://nicecrew.tv/videos/embed/39bBEyyTM4HmopFSPZPHQ2150002024-12-15T01:43:19.602ZPokemonpurplecreepyspeedpaintanimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/r3xyaEmbpVAYd1CxCgnL3khttps://nicecrew.tv/lazy-static/thumbnails/10bbf7cc-9e57-44fa-918f-a76142447abd.jpgDrawing/ Vaporwave RandelA little vaporwave based drawing! I made this because of bordem! Please enjoy this drawing video! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Vaporwave-Randel-648065030?ga_submit_new=10%253A1480219339https://nicecrew.tv/static/streaming-playlists/hls/cacf6676-d0fb-4d6a-b840-ad8aa9f62a2f/864f7c65-b980-427d-97ed-a8742a1a1f6e-master.m3u8https://nicecrew.tv/videos/embed/r3xyaEmbpVAYd1CxCgnL3k150002024-12-15T01:43:08.600ZVaporwavepinkpurpleyellowYESDreamy's LoungeNOhttps://nicecrew.tv/w/9cQJmnNd4PvwBch2eMynzhhttps://nicecrew.tv/lazy-static/thumbnails/66edd0cd-f0de-4cbd-996d-77ce8509266e.jpgUtau Clarina Winter Breeze (Repost)Sorry that the last upload of this video have no sound! I'm sorry for the slip up! 0////0 Anyways, please enjoy this UTAU video! Edit: That was really embarrassing! -_-https://nicecrew.tv/static/streaming-playlists/hls/42705261-74eb-4791-a3c9-dab0a8c37cae/04ce4c8b-66b8-46bc-b663-39e84754bc14-master.m3u8https://nicecrew.tv/videos/embed/9cQJmnNd4PvwBch2eMynzh44002024-12-15T01:43:01.956ZUTAUUtau Clarinawinter themeYESDreamy's LoungeNOhttps://nicecrew.tv/w/qxPfbNnZdypARQYmFXbgSKhttps://nicecrew.tv/lazy-static/thumbnails/20d13128-04a5-4d5b-9bb9-45d2ed7fe522.jpgDrawing: Blank SkylarkA drawing of Skylark Nonnel before he has emotions. In his society you can't use any emotions and make everything you make boring and bland! I hope you guys enjoy this video! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Blank-Skylark-648268302?ga_submit_new=10%253A1480304656https://nicecrew.tv/static/streaming-playlists/hls/c6cc800e-96cb-4cb8-880b-a5df372362fb/6e839148-fe5c-46b3-9cd6-ed64cbc3e2dc-master.m3u8https://nicecrew.tv/videos/embed/qxPfbNnZdypARQYmFXbgSK150002024-12-15T01:43:21.872ZColorfulSkylark NonnelcuteVaporwavePainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/ecAGzHg1D96epaFagUPV6thttps://nicecrew.tv/lazy-static/thumbnails/c7fd9b80-033d-4790-96f0-8791e63edfe2.jpgSpeed drawing: Anon Girl (?)A little anon Girl doodle before bed! Please enjoy this short video! :)https://nicecrew.tv/static/streaming-playlists/hls/6ae55e55-0c59-48d9-acb0-6fd0207a1f69/3704a695-19cd-4517-b662-993e4bad0226-master.m3u8https://nicecrew.tv/videos/embed/ecAGzHg1D96epaFagUPV6t22002024-12-15T01:43:06.988ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/ax52XCDgZ6eHGRTmtX22A5https://nicecrew.tv/lazy-static/thumbnails/8b7ed123-75e9-4633-8629-2659b044a421.jpgI talk about: Yumai Nikki, STPAO, Pluffnub, and other stuffAnother I talk about video! Sorry if I haven't made one in a long time! I wanted to talk to you guys about some topics again! I won't blame you for liking my talking voice! ^\\\^ Anyways enjoy this video and stuff!https://nicecrew.tv/static/streaming-playlists/hls/4d38ca6c-4214-4dd7-8d4f-abc3adae36d4/23059e05-d1a0-4892-99c7-a43b35fcc83e-master.m3u8https://nicecrew.tv/videos/embed/ax52XCDgZ6eHGRTmtX22A5783002024-12-15T01:44:47.949ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/dN32eCqBCpw25ufuGYBLRShttps://nicecrew.tv/lazy-static/thumbnails/9f02ec0d-d7da-4607-94e3-94fc9860b500.jpgA L I V EA quick little doodle drawing before bed! Please enjoy and I'll post it on DA Tommorrow! Finished drawing: http://rainbowdoodler209.deviantart.com/art/A-L-I-V-E-649141698https://nicecrew.tv/static/streaming-playlists/hls/679b1f7d-4c0b-452a-a63a-2bf0de79c774/49fbf6fd-7bdc-4718-b02b-8da39a852f83-master.m3u8https://nicecrew.tv/videos/embed/dN32eCqBCpw25ufuGYBLRS231002024-12-15T01:43:25.866ZVaporwavecolorfulpinkblueA L I V EYESDreamy's LoungeNOhttps://nicecrew.tv/w/6NGQBkiVkPHRkE4eiXwzxrhttps://nicecrew.tv/lazy-static/thumbnails/b92cf8fe-0cca-4d21-a4b0-4ca0b72173dc.jpgT I R E DI'm pretty tired, had a long day! And please enjoy and stuff! Finished drawing: http://rainbowdoodler209.deviantart.com/art/T-I-R-E-D-649141960https://nicecrew.tv/static/streaming-playlists/hls/2f0312f7-59d3-493e-9b7f-453c38930843/4c5a0f43-8818-48e0-9cc0-cd224e7145c5-master.m3u8https://nicecrew.tv/videos/embed/6NGQBkiVkPHRkE4eiXwzxr211002024-12-15T01:43:24.237ZPastelVaporwavecuteanimegirlYESDreamy's LoungeNOhttps://nicecrew.tv/w/uMJi9ApaupwYxKTv6fXaiFhttps://nicecrew.tv/lazy-static/thumbnails/ad21a007-7b96-40ca-a25f-8f71e840a679.jpg3Ds Drawing: ....?!A little alien girl drawing I made yesterday, I was busy last night, so I'm sorry!https://nicecrew.tv/static/streaming-playlists/hls/e9226af1-fd9b-4eab-bd87-8532ec3c199d/99e68936-8fca-45ef-9c81-a04d637c7de2-master.m3u8https://nicecrew.tv/videos/embed/uMJi9ApaupwYxKTv6fXaiF104002024-12-15T01:43:23.578ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/6Sn2RoU45oiwE5pu92kaa4https://nicecrew.tv/lazy-static/thumbnails/b54bcf11-c3a2-4997-b8e5-28223342d6dc.jpgTwo friendsA cute drawing video of two loving monster! I finished this drawing off camera! I usually make B/W drawings on the 3Ds! Please enjoy! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Two-friends-649322260?ga_submit_new=10%253A1480827763https://nicecrew.tv/static/streaming-playlists/hls/2f85d7da-e962-435a-88dd-9185775903d9/dca3e665-b99c-4265-9a7c-debcebd63ada-master.m3u8https://nicecrew.tv/videos/embed/6Sn2RoU45oiwE5pu92kaa4150002024-12-15T01:43:25.355ZMonochromecuteanimalsmonstersYESDreamy's LoungeNOhttps://nicecrew.tv/w/vXoL4Pyz9Z85rFFyKHWVyyhttps://nicecrew.tv/lazy-static/thumbnails/e71e58e1-0a72-4c10-bd5f-9ffded629392.jpg180+sub special: Magical FishcatA little drawing of one of my lovely subscribers: Magical Fishcat! Please enjoy and I hope you enjoy and stuff! I'm glad you enjoy! Blub Blub:https://nicecrew.tv/static/streaming-playlists/hls/f294f466-6be1-4a36-ba47-bdf23039e834/4b033f6d-ec4e-4f99-acf9-1bb660c95f82-master.m3u8https://nicecrew.tv/videos/embed/vXoL4Pyz9Z85rFFyKHWVyy150002024-12-15T01:43:26.579ZMagical FishcatSub speicalDrawing videocutepurpleYESDreamy's LoungeNOhttps://nicecrew.tv/w/4seP7E2s4F2RRdey1E7XGyhttps://nicecrew.tv/lazy-static/thumbnails/15bb5084-aba6-4f31-905a-83d5655c1311.jpgDrawing: Strict LucyannaA drawing of Lucyanna as the dictator of unhappiness! Man this sounds dark! This'll be my profile picture for this month! Please enjoy! Hail Lucyanna: http://rainbowdoodler209.deviantart.com/art/Strict-Lucyanna-649862123?ga_submit_new=10%253A1481082593https://nicecrew.tv/static/streaming-playlists/hls/1bf54422-2fb6-4aae-b6d3-aaff8d779bbc/02a9951e-0982-4071-9fd5-7d27ede1583c-master.m3u8https://nicecrew.tv/videos/embed/4seP7E2s4F2RRdey1E7XGy150002024-12-15T01:43:26.882ZLucyanna KimseldictatorYESDreamy's LoungeNOhttps://nicecrew.tv/w/voZRdZBiYCrGAzWzyoDTx9https://nicecrew.tv/lazy-static/thumbnails/2c53a1eb-8bb1-49c8-9abd-fab237e21835.jpgDrawing: Slime MalekaA little doodle of Maleka as a little slime monster! Enjoy this little doodle! Maleka blob: http://rainbowdoodler209.deviantart.com/art/Slime-Maleka-650032350?ga_submit_new=10%253A1481168984https://nicecrew.tv/static/streaming-playlists/hls/ee0f08db-a683-4f30-a0fd-bf29ce3cc2a2/9075711a-f45c-4631-8f32-1c0781a08215-master.m3u8https://nicecrew.tv/videos/embed/voZRdZBiYCrGAzWzyoDTx9150002024-12-15T01:43:27.381ZMalekacuteanimebluePainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/1rq63qDNX55cgdNv89fMDhhttps://nicecrew.tv/lazy-static/thumbnails/c925add5-c373-4c90-8c28-eab150d6bca0.jpgDrawing: Sulfuric AcidI was originally making this girl a monster but, this design seems kind of fitting to be honest! Anyways the finished drawing is down below and enjoy! DO NOT TOUCH!: http://rainbowdoodler209.deviantart.com/art/Sulfuric-Acid-650194069?ga_submit_new=10%253A1481253221https://nicecrew.tv/static/streaming-playlists/hls/038c7037-7c8b-4f46-9f54-2d507255dc16/dab6c728-8b28-47d6-a6c4-799bd5f94d34-master.m3u8https://nicecrew.tv/videos/embed/1rq63qDNX55cgdNv89fMDh150002024-12-15T01:43:30.114ZH2SO4Sulfuric Acidanime elementcutecreepyYESDreamy's LoungeNOhttps://nicecrew.tv/w/mKb76tfzxSnDScycVzacykhttps://nicecrew.tv/lazy-static/thumbnails/2b204d73-909e-411d-a5e2-2806d9fddc24.jpgDrawing: Winter DevilI wanted to make a winter themed devil girl! This was pretty fun to make to be honest! Please enjoy and stuff! Cute winter devil: http://rainbowdoodler209.deviantart.com/art/Winter-Devil-650583170?ga_submit_new=10%253A1481432009https://nicecrew.tv/static/streaming-playlists/hls/a7fdfb97-abb9-4e14-be29-b1b7ddd43c37/9c5c8783-9cb0-4cc1-8a0b-61ef740a7c9d-master.m3u8https://nicecrew.tv/videos/embed/mKb76tfzxSnDScycVzacyk600002024-12-15T01:43:43.384ZDevilsanimespeedpaintdigital artcold colorsYESDreamy's LoungeNOhttps://nicecrew.tv/w/3eUpSGE7VLrnhLSB9YFNufhttps://nicecrew.tv/lazy-static/thumbnails/db4311cb-4cf8-44e0-989e-95588f115d6f.jpgDrawing/ Pastel Mystic girlAnother drawing request by my lovely subscribers! Please enjoy and stuff! ^^ Sad mystic!: http://rainbowdoodler209.deviantart.com/art/Pastel-Mystic-girl-650772746?ga_submit_new=10%253A1481512130https://nicecrew.tv/static/streaming-playlists/hls/12233f03-106f-46a5-9e30-6fc5d29a9736/998cc621-36cc-4c98-b257-503bd57dbfee-master.m3u8https://nicecrew.tv/videos/embed/3eUpSGE7VLrnhLSB9YFNuf150002024-12-15T01:43:30.545ZcutepastelanimemysticcolorfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/ooYCNeWqMVkL6rCkDFdtqihttps://nicecrew.tv/lazy-static/thumbnails/d29e8de6-c738-48b2-9833-1ec335bef247.jpgDrawing: Umbreon Boy (Request)Another profile drawing request of one of my Subs! Please enjoy and stuff! Have a great night! Num num num: http://rainbowdoodler209.deviantart.com/art/Umbreon-Boy-651125933?ga_submit_new=10%253A1481686267https://nicecrew.tv/static/streaming-playlists/hls/b55e50cf-c9ed-4b5a-b7c8-f745a740c37d/4eae75e0-5d5d-4ddc-b820-6d8be75fe13c-master.m3u8https://nicecrew.tv/videos/embed/ooYCNeWqMVkL6rCkDFdtqi150002024-12-15T01:43:38.112ZUmbreonpokemonanime boysrequestcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/ard9F72iwqrFTpZUYEYCmjhttps://nicecrew.tv/lazy-static/thumbnails/361b4a3e-c16d-4d23-a463-69cff1437449.jpgDrawing: Annoyed Neko maidAnother little Safina drawing! I hope you guys enjoy this cute little drawing video and stuff! I promise I'll draw something interesting tomorrow! Enjoy and sub to my channel for the newcomers! ^^ Finished drawing: http://rainbowdoodler209.deviantart.com/art/Annoyed-neko-Maid-651299233?ga_submit_new=10%253A1481774434https://nicecrew.tv/static/streaming-playlists/hls/4c675461-ef07-45e0-bbad-f3ceca80664a/982ab0c8-84a9-448d-afc8-c0e0f087ab91-master.m3u8https://nicecrew.tv/videos/embed/ard9F72iwqrFTpZUYEYCmj150002024-12-15T01:43:41.085ZCuteanimeneko maidspeed drawingcolorfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/c6jrP4M8229gF4EPyGoYjRhttps://nicecrew.tv/lazy-static/thumbnails/757d22a4-879d-4e54-8c2b-e387bbb5ff6e.jpgDrawing Maji SanHere's a cute drawing of the 4chan fanatic Maji-san! Please enjoy the video and stuff and send me some critique as well too! The 4chan shield: http://rainbowdoodler209.deviantart.com/art/Maji-San-651461271?ga_submit_new=10%253A1481857432https://nicecrew.tv/static/streaming-playlists/hls/59d29c7b-9345-48e5-821e-152380bcbbd5/ad253293-cf1c-4ad6-8fba-911b228d5ff2-master.m3u8https://nicecrew.tv/videos/embed/c6jrP4M8229gF4EPyGoYjR300012024-12-15T01:43:54.205ZMaji-sangreenanime girlspainttoolsai4chanYESDreamy's LoungeNOhttps://nicecrew.tv/w/htzb7CgSBiuAk1ZVRqttvXhttps://nicecrew.tv/lazy-static/thumbnails/70efda75-dd6f-40aa-b57e-a9ed3b2343a2.jpgUTAU Clarina: Fed upAnother UTAU video beucause why not, I haven't made one in a whiloe so yeah! Give me some ideas for more songs as well if you want! I wanna hear them! :3https://nicecrew.tv/static/streaming-playlists/hls/856bbeaa-8d95-43b1-9185-2432073b50ad/81c6f9dd-2898-42af-8c78-3d40dfce253d-master.m3u8https://nicecrew.tv/videos/embed/htzb7CgSBiuAk1ZVRqttvX41002024-12-15T01:43:35.928ZClarinaUTAU ClarinacreepyunsettlingYESDreamy's LoungeNOhttps://nicecrew.tv/w/tMJ6jxnHWdHrbKMX1nv3Kehttps://nicecrew.tv/lazy-static/thumbnails/77ccfe74-a796-4df9-bdac-be7687f9ab1b.jpgDrawing HeliumAnother element girl drawing! Please enjoy! Sorry I clicked on my other drawings! My bad! Oh boy! He: http://rainbowdoodler209.deviantart.com/art/Helium-651823550?ga_submit_new=10%253A1482029933https://nicecrew.tv/static/streaming-playlists/hls/e1092746-10e5-4493-b546-eade1967582b/c3ac5768-24dd-47f0-a233-91b876d900b6-master.m3u8https://nicecrew.tv/videos/embed/tMJ6jxnHWdHrbKMX1nv3Ke150002024-12-15T01:43:41.533ZCuteHeliumanime girlselementspastel colorsYESDreamy's LoungeNOhttps://nicecrew.tv/w/qs2MixBrEvaJsWU4Sii4nLhttps://nicecrew.tv/lazy-static/thumbnails/e51d0766-dfa0-45cc-8507-b6211d32a3fa.jpgSpeed doodling: Monsters and hijabsA little video of some doodles I made when I'm running out of ideas! Pretty much a new little series! Please enjoy! Doodlefest 1: http://rainbowdoodler209.deviantart.com/art/Doodlefest-652031267?ga_submit_new=10%253A1482117517https://nicecrew.tv/static/streaming-playlists/hls/c5fdc373-efc3-46ff-b098-eedd09d6cf12/27d56535-ca20-4029-8495-9a413acd010e-master.m3u8https://nicecrew.tv/videos/embed/qs2MixBrEvaJsWU4Sii4nL300002024-12-15T01:44:09.435ZDoodlescuteanime girlsmonsterspastelYESDreamy's LoungeNOhttps://nicecrew.tv/w/9ptLjce8LjqFZK1PVsBP6Whttps://nicecrew.tv/lazy-static/thumbnails/a8247742-cf6c-4e84-a241-b2f318433b88.jpgDrawing: Smiling MuslimahA quick little Muslimah girl I drew before I go to bed! I hope you guys enjoy and stuff! Cute little muslimah: http://rainbowdoodler209.deviantart.com/art/Smiling-Muslimah-652409545?ga_submit_new=10%253A1482293418https://nicecrew.tv/static/streaming-playlists/hls/44105380-945b-4751-bfaa-7045604b22ec/a9f5235a-72fd-49b1-b8e7-846ea76a6385-master.m3u8https://nicecrew.tv/videos/embed/9ptLjce8LjqFZK1PVsBP6W150002024-12-15T01:44:07.691ZMuslimahcuteanimepastelflowerYESDreamy's LoungeNOhttps://nicecrew.tv/w/vLMyN6jSRiBQBbrXkF8sRfhttps://nicecrew.tv/lazy-static/thumbnails/18d4bf2c-1735-44b1-b62b-ebe025f272af.jpgDrawing: Polar GirlAnother cute little anthro drawing but based off of a gift I got from a school club! I wanted to draw her since it's a nice winter theme to it! Merry early Christmas: http://rainbowdoodler209.deviantart.com/art/Polar-girl-652583785?ga_submit_new=10%253A1482374171https://nicecrew.tv/static/streaming-playlists/hls/f119d3e4-dd60-4b08-8b5a-86a22c86ce78/0233c274-cc81-4de8-86fa-5736e14a65c2-master.m3u8https://nicecrew.tv/videos/embed/vLMyN6jSRiBQBbrXkF8sRf150002024-12-15T01:43:57.358ZPolar bearscutewintersnowblueYESDreamy's LoungeNOhttps://nicecrew.tv/w/q22fXiKKjCD7uciYBHjvVhhttps://nicecrew.tv/lazy-static/thumbnails/f77dbc9f-a76b-497d-91a3-d614b189bc1a.jpgJingle AngelA little angel animation, basically about an angel singings the songs of jingle bells! Please enjoy!https://nicecrew.tv/static/streaming-playlists/hls/c27fd8c5-d6e3-4992-9491-b0a325967fe6/b41e4550-2d11-452e-af85-07555fd645d8-master.m3u8https://nicecrew.tv/videos/embed/q22fXiKKjCD7uciYBHjvVh22002024-12-15T01:43:44.890ZAnimationscuteshortblack and whitepaper animationsYESDreamy's LoungeNOhttps://nicecrew.tv/w/trMGjnjtYc78RM3gkvu8gfhttps://nicecrew.tv/lazy-static/thumbnails/226cadab-03a8-4f7b-966a-a4828d79e17d.jpgDrawing Winter MuslimahAnother cute muslimah girl! Please enjoy this cute hijab girl drawing! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Winter-Muslimah-653166455?ga_submit_new=10%253A1482624557https://nicecrew.tv/static/streaming-playlists/hls/de407fa9-d23f-4242-9096-9a66bc936740/72f0f8ca-8bb2-4d9b-b094-527cf5bd2303-master.m3u8https://nicecrew.tv/videos/embed/trMGjnjtYc78RM3gkvu8gf150002024-12-15T01:44:28.671ZWinter themecuteanimemuslimahYESDreamy's LoungeNOhttps://nicecrew.tv/w/6dca2ZyyhCXdMxa9zYSUgphttps://nicecrew.tv/lazy-static/thumbnails/38d3fe15-9c76-40ed-a4e8-4dcb1cb17a0c.jpgDrawing: BorginaAnother MS paint speed drawing because why not! I hope you guys enjoy this little drawing video! :) Bleep bloop: http://rainbowdoodler209.deviantart.com/art/Borgina-653386565?ga_submit_new=10%253A1482724939https://nicecrew.tv/static/streaming-playlists/hls/2a317e57-9a47-4e16-a4ca-e7015b49f93d/8fc0cf71-9ab3-431c-ba1e-0e9f008e120e-master.m3u8https://nicecrew.tv/videos/embed/6dca2ZyyhCXdMxa9zYSUgp150002024-12-15T01:44:30.553ZRobot girlcutecartoonsMSpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/hbxUKjrRWricSdi7xJYbX1https://nicecrew.tv/lazy-static/thumbnails/df2732d0-087e-4052-a458-d01d74cecd5e.jpgSpeed drawing: RoboGirl 136Another cute RoboGirl drawing! I wanted to make another robot girl since they're fun to draw, but drawing in general for me is pretty fun! Please enjoy this video! :)https://nicecrew.tv/static/streaming-playlists/hls/830b5236-7d5f-4c6d-beb7-e135b195879e/2ef3512d-bb5c-4ac7-8b8c-d09e249aaed5-master.m3u8https://nicecrew.tv/videos/embed/hbxUKjrRWricSdi7xJYbX123002024-12-15T01:44:38.242ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/oUx4QCLbhQF7Vnf8JWBDmNhttps://nicecrew.tv/lazy-static/thumbnails/ec8eabf2-c54e-45e1-8262-1c818fd0f337.jpgDrawing Summer MuslimahA video that I made yesterday when the internet connection was being funny! Please enjoy this drawing video! :) Finished drawing: http://rainbowdoodler209.deviantart.com/art/Summer-Muslimah-653872079?ga_submit_new=10%253A1482946221https://nicecrew.tv/static/streaming-playlists/hls/b97edf2c-9832-4d27-8b64-f866f124b1c2/8599d292-db45-44ed-8ed6-6d938b095223-master.m3u8https://nicecrew.tv/videos/embed/oUx4QCLbhQF7Vnf8JWBDmN150002024-12-15T01:44:51.900ZMuslimahseasonscutepainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/oFAW4ueVkJ24XQ7WXN1SDchttps://nicecrew.tv/lazy-static/thumbnails/4153e4ee-ccde-4e6a-b391-16b5f03deeb2.jpgDrawing Pastel school girl 2Another anime school girl drawing because why not! I hope you guys enjoy this little video!... trying to smile: http://rainbowdoodler209.deviantart.com/art/Pastel-school-girl-2-653988187?ga_submit_new=10%253A1482985233https://nicecrew.tv/static/streaming-playlists/hls/b7b095cf-e406-4b50-81ea-e27442ba0235/d9f18ce1-9b98-4d83-ac21-4dbfa7288491-master.m3u8https://nicecrew.tv/videos/embed/oFAW4ueVkJ24XQ7WXN1SDc150002024-12-15T01:45:02.264ZAnime girlpastel drawingsanime school girlcutepainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/o4ehV33KYT4h2eDr24D6TKhttps://nicecrew.tv/lazy-static/thumbnails/3a51ed99-18a9-4c5a-a95e-e9b7073a91e7.jpgDrawing HifarAnother little MS paint drawing because why not! I hope you guys enjoy and like, comment and sub to my channel and my second channel! Please enjoy the video! http://rainbowdoodler209.deviantart.com/art/Hifar-654182966?ga_submit_new=10%253A1483065607:حفارhttps://nicecrew.tv/static/streaming-playlists/hls/b29c791c-2f68-4644-92f9-c5ab350961c5/2717e863-5866-4bb2-9c32-15a1f3dbc280-master.m3u8https://nicecrew.tv/videos/embed/o4ehV33KYT4h2eDr24D6TK150002024-12-15T01:45:04.013ZحفارcuteanimemuslimahMS paintYESDreamy's LoungeNOhttps://nicecrew.tv/w/btBqXNovSHovfJmw1MGCnphttps://nicecrew.tv/lazy-static/thumbnails/541c1c0b-0af7-4f2b-9a95-edfccc5b9228.jpgFarewell 2016This is a little slideshow that was made on my ipad in the last three months! I know I should've have more videos but I don't wanna lose space sadly! I hope you guys enjoy this little video! I know it's not an original drawing video but yeah! Happy New Years Eve everyone! I'm ready for 2017!https://nicecrew.tv/static/streaming-playlists/hls/54d64d9a-6d97-4eb4-853e-b05c30085779/3699bdbb-f1a5-43e1-92cd-4144a55efb5e-master.m3u8https://nicecrew.tv/videos/embed/btBqXNovSHovfJmw1MGCnp16002024-12-15T01:44:53.415ZAnimeDrawingMemoriesRandomBye2016YESDreamy's LoungeNOhttps://nicecrew.tv/w/gTUq4cpBrmkiuVwLaRXhxYhttps://nicecrew.tv/lazy-static/thumbnails/266ffe78-f0de-4063-a9fe-3e7e5ccade51.jpgDrawing: Secret eating demonA little demon girl that eats people's lie, rumors and awful terrible secrets behind any human's back! Sorry if the drawing looks messy! But I hope you guys enjoy and critique and requests are open! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Secret-Eater-654653315?ga_submit_new=10%253A1483246247https://nicecrew.tv/static/streaming-playlists/hls/80b8505b-f496-469b-a83b-77fb17a6d1c6/9d5bd4bc-dc63-4a52-89fd-ffc66ffbe153-master.m3u8https://nicecrew.tv/videos/embed/gTUq4cpBrmkiuVwLaRXhxY150002024-12-15T01:45:24.416ZSpeed drawingdemons in human formanimescaredYESDreamy's LoungeNOhttps://nicecrew.tv/w/1ifjKM2RPNSzfxYcr5Jkgphttps://nicecrew.tv/lazy-static/thumbnails/3ea494e1-2ceb-420a-9053-024692a25294.jpgSoft MorningA song about the sunny soft morning that happens when the Windows illuminate the walls...https://nicecrew.tv/static/streaming-playlists/hls/0268789e-cb73-48a6-ab63-48872b750859/fbcf744a-212e-4a70-b943-3b8198ebe6f6-master.m3u8https://nicecrew.tv/videos/embed/1ifjKM2RPNSzfxYcr5Jkgp123002024-12-15T01:45:00.117ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/6esqnsKF7gtKs8jXxcnUFjhttps://nicecrew.tv/lazy-static/thumbnails/698850ad-b57e-4d2f-8bce-c9b914d97f03.jpgAisa's dream dressA little cute drawing of a loli girl named Aisa wearing her dream dress! I first drew her on Colors3d! Please enjoy this little drawing video! Finished dream: http://rainbowdoodler209.deviantart.com/art/Aisa-s-dream-dress-655288681?ga_submit_new=10%253A1483496774https://nicecrew.tv/static/streaming-playlists/hls/2a5ea4f2-26b8-4f73-8bd2-0c4500a9db50/b98e9825-c440-464a-8ef2-228d2139f31e-master.m3u8https://nicecrew.tv/videos/embed/6esqnsKF7gtKs8jXxcnUFj150012024-12-15T01:45:26.755ZAisalolitalolianime girlcildYESDreamy's LoungeNOhttps://nicecrew.tv/w/sJvnugpsuoJNSpWQr9TaYPhttps://nicecrew.tv/lazy-static/thumbnails/bec38def-292f-43c6-a550-40ddff533949.jpgDrawing Cat muslimahAnother hijab girl but with little cat ears! Please enjoy this cute muslimah girl and stuff! I made a new version since I forgot to add a background and sai screwed up again and won't save, I'll start over! *Deep sigh* Finished drawing 2.0: http://rainbowdoodler209.deviantart.com/art/Cat-muslimah-655680528?ga_submit_new=10%253A1483671441https://nicecrew.tv/static/streaming-playlists/hls/d87cf196-0c13-4e5b-a075-1b6a6351543b/f67fd39e-7dd4-4927-8cfd-0f34da648532-master.m3u8https://nicecrew.tv/videos/embed/sJvnugpsuoJNSpWQr9TaYP150002024-12-15T01:45:39.476ZCatmuslimahcutepastelYESDreamy's LoungeNOhttps://nicecrew.tv/w/v6umCQUWs8uob2GEWwsd4Thttps://nicecrew.tv/lazy-static/thumbnails/6963052a-4f99-4a29-b7bd-af7b5c8166d4.jpgSpeed drawing: Thick HijabA little painting of a girl with a big hijab, which can happen at some point! Please enjoy and stuff, I miss painting on Paint tool sai so yeah! Enjoy everyone! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Thick-Hijab-655905895?ga_submit_new=10%253A1483766646https://nicecrew.tv/static/streaming-playlists/hls/eb9d3701-0ee1-4a98-ada7-234c7adefcc1/f173a847-dd36-40be-a22f-e363f7613008-master.m3u8https://nicecrew.tv/videos/embed/v6umCQUWs8uob2GEWwsd4T150002024-12-15T01:45:57.923ZSpeed painthijabmuslimahcutepastelYESDreamy's LoungeNOhttps://nicecrew.tv/w/4cqrRakbKs6Xr6YBa32dofhttps://nicecrew.tv/lazy-static/thumbnails/e9089f16-ad7e-4eb2-9bfa-dfdd74eca4dc.jpgDrawing Peony MuslimahA muslimah girl dressed as a peony flower! Please enjoy and sub to my channel! ^^ Peony muslimah: http://rainbowdoodler209.deviantart.com/art/Peony-Muslimah-656118142?ga_submit_new=10%253A1483851073https://nicecrew.tv/static/streaming-playlists/hls/19e3a9a1-33d6-4871-a475-1f2b89adf362/1fc5f1f6-acd8-4c73-b33e-427287792995-master.m3u8https://nicecrew.tv/videos/embed/4cqrRakbKs6Xr6YBa32dof150002024-12-15T01:45:52.391ZpinkcutepastelmuslimahhijabYESDreamy's LoungeNOhttps://nicecrew.tv/w/ukfAsGfEA7ZtFn3nfGSaD3https://nicecrew.tv/lazy-static/thumbnails/502da2b9-0e11-4dc5-80fe-79495f7db1b5.jpgDrawing: XAnother little self drawing because why not! Please enjoy this little drawing video! Have a great night! X: http://rainbowdoodler209.deviantart.com/art/X-656330116?ga_submit_new=10%253A1483932991https://nicecrew.tv/static/streaming-playlists/hls/e5700210-d4c7-4d9c-b9a6-22e80af5eaf8/acc5dd1a-15fe-4ddc-941e-1ec0c4963c3e-master.m3u8https://nicecrew.tv/videos/embed/ukfAsGfEA7ZtFn3nfGSaD3150002024-12-15T01:45:54.039ZAnime artanime girlself protraitcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/ioesDj4c6fMPF8bvfc8HCqhttps://nicecrew.tv/lazy-static/thumbnails/d2f73d6f-b6a2-4866-8b4a-6490d46b3454.jpgBassoon man C minorA little Basson song about the Bassoon man, who can be very hyper a times! Please enjoy! 🖤https://nicecrew.tv/static/streaming-playlists/hls/8cc603c9-3fcc-4e8c-adbd-10832dd1b7cc/5f0d6f4b-1684-4a0c-ae00-de6aa8b3a6d6-master.m3u8https://nicecrew.tv/videos/embed/ioesDj4c6fMPF8bvfc8HCq95002024-12-15T01:45:49.496ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/2dsZoqjG41rbevVJCVkEqphttps://nicecrew.tv/lazy-static/thumbnails/0b5c0eb4-2530-4263-b8a7-e1e05764ed1a.jpgDrawing: Crazy Limbo DogA Little demented drawing of a limbo dog...thing! I made this because I miss making bloody cartoons! Please enjoy! Finished insanity: http://rainbowdoodler209.deviantart.com/art/Crazy-Limo-Dog-656884614https://nicecrew.tv/static/streaming-playlists/hls/09d6b25c-6f82-4377-a852-10ef73051aa7/43da9288-e64d-4cf6-b8ec-fb0a4b237409-master.m3u8https://nicecrew.tv/videos/embed/2dsZoqjG41rbevVJCVkEqp150512024-12-15T01:46:01.346ZCrazy limo dogcarscartoonsmonsteranimalsYESDreamy's LoungeNOhttps://nicecrew.tv/w/951ozMxT4rcgPNsU46Lkv3https://nicecrew.tv/lazy-static/thumbnails/7b840cf3-a395-4b98-a568-05e506b5ce71.jpgDrawing: Singing MuslimahI just wanted to draw more Arabic again because why not! Please enjoy this pink and puffy hijabi girl! Please enjoy and stuff! ^^ Finished drawing: http://rainbowdoodler209.deviantart.com/art/Singing-Muslimah-657072668?ga_submit_new=10%253A1484278862https://nicecrew.tv/static/streaming-playlists/hls/41585305-d209-4c84-bb57-ee14595b6f50/210bc347-f7fb-40f1-a57c-1f697b16d257-master.m3u8https://nicecrew.tv/videos/embed/951ozMxT4rcgPNsU46Lkv3150002024-12-15T01:46:03.601Zhijabanimemuslimahgirlspeed paintYESDreamy's LoungeNOhttps://nicecrew.tv/w/nsAGTJg6hbRZFN5C4hc4h7https://nicecrew.tv/lazy-static/thumbnails/8f96fcea-b1df-4281-8573-3ea8da8e126e.jpgDrawing: Hijabi catA cute drawing of a fluffy hijabi kitty! Please enjoy this little cartoon! ^^ http://www.furaffinity.net/view/22284634/https://nicecrew.tv/static/streaming-playlists/hls/adc6a33a-caa3-4c7a-8308-6aa621ec77aa/dc7830a7-e0f0-428e-bb0b-8e0ba7284e9e-master.m3u8https://nicecrew.tv/videos/embed/nsAGTJg6hbRZFN5C4hc4h7150002024-12-15T01:46:23.430ZhijabcatspainttoolsaianimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/kcA8LUjPCjeyccJ9CbxgxWhttps://nicecrew.tv/lazy-static/thumbnails/48ce586f-41ba-4d40-93e6-b764d1e530d1.jpgSpeed doodling: Ahlam Ria doodlea cute little muslimah girl doodle because why not! If anyone got auto unsubbed sub back to me if that happened to you! Have a great night everyone! Hmm?: http://rainbowdoodler209.deviantart.com/art/Ahlam-Ria-doodle-657486214?ga_submit_new=10%253A1484454974https://nicecrew.tv/static/streaming-playlists/hls/9b7bda13-5aa3-4a9f-a2bc-7fa7cda4a050/927b8e9b-eba9-41cb-a845-5755d19fb1ae-master.m3u8https://nicecrew.tv/videos/embed/kcA8LUjPCjeyccJ9CbxgxW150002024-12-15T01:46:25.561ZmuslimahcutedoodleanimedoodlingYESDreamy's LoungeNOhttps://nicecrew.tv/w/bJ4s2xU74aYmTwKepmkQSGhttps://nicecrew.tv/lazy-static/thumbnails/cd63b012-9d10-48a4-973c-f2e84fbe7237.jpgDrawing: JiaoShiAnother cute robot girl, please enjoy this cute little cartoon! :) Jiaoshi is loaded: http://rainbowdoodler209.deviantart.com/art/jiaoShi-657678260https://nicecrew.tv/static/streaming-playlists/hls/56dac013-9e11-42e4-b2ef-10506b48aa94/e953a616-32d6-4546-999b-0c6da54f9d3d-master.m3u8https://nicecrew.tv/videos/embed/bJ4s2xU74aYmTwKepmkQSG150002024-12-15T01:46:42.635Zrobotlolianime girlpainttoolsaipastelYESDreamy's LoungeNOhttps://nicecrew.tv/w/gyLExfPHUBuE1p6cqZpawYhttps://nicecrew.tv/lazy-static/thumbnails/a0ebbabc-337e-44fa-95b2-6acf34c34fad.jpgDrawing: Loli NekoA cute little request from one of my followers! Please enjoy and sub to my channel! :) Nya nya: http://rainbowdoodler209.deviantart.com/art/Loli-Neko-658092830?ga_submit_new=10%253A1484705915https://nicecrew.tv/static/streaming-playlists/hls/7e0c67ef-3115-4a75-8c26-d5929ffc1eb0/244826a4-e6c2-4db8-8196-4534f86f4e63-master.m3u8https://nicecrew.tv/videos/embed/gyLExfPHUBuE1p6cqZpawY150012024-12-15T01:46:52.588ZlolianimecutepinkpastelYESDreamy's LoungeNOhttps://nicecrew.tv/w/wmivXMTaeJTbGtU7EyCNd5https://nicecrew.tv/lazy-static/thumbnails/a3d5b557-1a7c-40c4-b9b4-739d5398a635.jpgDrawing: SisiAnother cute little girl drawing! I like drawing girls, they're so fun to draw as well! ^^ Please enjoy and sub! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Sisi-658292323?ga_submit_new=10%253A1484797696https://nicecrew.tv/static/streaming-playlists/hls/f5c7d486-953a-4179-b65b-3ef3d5449714/7a1b3607-a860-4fcd-94df-a5b7e2153cd3-master.m3u8https://nicecrew.tv/videos/embed/wmivXMTaeJTbGtU7EyCNd5150002024-12-15T01:46:58.001ZloliSisicuteanimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/6TVZWMiWu8ZShZe2aixsKvhttps://nicecrew.tv/lazy-static/thumbnails/4b08ad8b-1d2f-4c11-bd59-d996a63330aa.jpgDrawing: Lavender hijabAnother cute anime muslimah girl except with purple shades, I hope everyon enjoys~! I hope you guys don't mind me drawing a lot here! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Lavender-hijab-658468174?ga_submit_new=10%253A1484883556https://nicecrew.tv/static/streaming-playlists/hls/2fbde756-6fee-4e65-ac61-23ecd30032cb/9c648a72-810a-4298-b416-ddb2f207c57d-master.m3u8https://nicecrew.tv/videos/embed/6TVZWMiWu8ZShZe2aixsKv150002024-12-15T01:46:48.897ZlavenderanimecutemuslimahhijabYESDreamy's LoungeNOhttps://nicecrew.tv/w/1SbEwW1u5ZA9paNdRkN5i9https://nicecrew.tv/lazy-static/thumbnails/c7882736-2d43-40f1-ad2e-940ec272d7c0.jpgDrawing: purple pegasus P1a cute little Pegasus drawing! just wanted to draw a horsey!https://nicecrew.tv/static/streaming-playlists/hls/0701c2b9-f195-4271-bd1e-32ef7eacd472/6e30fedc-2ab7-4766-8acf-43e5b9c17345-master.m3u8https://nicecrew.tv/videos/embed/1SbEwW1u5ZA9paNdRkN5i9150002024-12-15T01:47:01.195Zpurpletwo partercuteanimeponyYESDreamy's LoungeNOhttps://nicecrew.tv/w/3zLNfEWeD3UzrtrKm6a36Rhttps://nicecrew.tv/lazy-static/thumbnails/0f6acafa-90a4-419b-8e73-52994d7674a8.jpgDrawing: Purple Pegasus P2Final part for this video sice I don't wanna leave you guys hanging! Please enjoy and stuff! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Purple-pegasus-658690488?ga_submit_new=10%253A1484984009https://nicecrew.tv/static/streaming-playlists/hls/14e96ddc-ad46-49bf-8fbb-1bfd377b3513/97238bea-1c20-4869-ad0b-6db295ac2dd3-master.m3u8https://nicecrew.tv/videos/embed/3zLNfEWeD3UzrtrKm6a36R150002024-12-15T01:47:03.316ZpurplecutepegasushorsewingsYESDreamy's LoungeNOhttps://nicecrew.tv/w/mrjpKXhurrhbRCXmbETbRQhttps://nicecrew.tv/lazy-static/thumbnails/bea3fe69-04ab-4c96-82b6-84d1062659ea.jpgDrawing: GingyAnother drawing based off of the midi publisher Gingeas! Please enjoy this little midi angel drawing! finished drawing: http://rainbowdoodler209.deviantart.com/art/Gingy-658836907?ga_submit_new=10%253A1485043757https://nicecrew.tv/static/streaming-playlists/hls/a57fb678-ba38-4f4e-8dcc-e1eefdebe1ca/fb95e79c-5520-419a-844f-5448df493379-master.m3u8https://nicecrew.tv/videos/embed/mrjpKXhurrhbRCXmbETbRQ150002024-12-15T01:47:01.584Zmidi angelsblack midiGingeascutecolorfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/9rurc2T9m5LpmkgdUcU1dShttps://nicecrew.tv/lazy-static/thumbnails/81c44938-8421-49e5-8172-a8999722d977.jpgDrawing: Shinig beautyI wanted to draw another drawing based off of the muslimah girl in "Smling muslimah" drawing, because why not! I might've switched the colors by mistake! Oh well, please enjoy this drawing video! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Shining-beauty-659092238?ga_submit_new=10%253A1485138867https://nicecrew.tv/static/streaming-playlists/hls/44583a0f-784c-4cdf-8013-ec866d6446ba/388d743e-64ce-4839-afa3-d52dc9cc7a73-master.m3u8https://nicecrew.tv/videos/embed/9rurc2T9m5LpmkgdUcU1dS150002024-12-15T01:47:22.302ZmuslimahcutehijabipainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/cquzpDmqAP1vfUxWjjQiEdhttps://nicecrew.tv/lazy-static/thumbnails/5f1e34bb-7cef-40fb-8717-3dab0bf46862.jpgDrawing/ Loving saintA cute little chirstian girl in a blue dress holding a shining cross! Please enjoy and have a great night! Pray to him: http://rainbowdoodler209.deviantart.com/art/Loving-saint-659469494?ga_submit_new=10%253A1485311278https://nicecrew.tv/static/streaming-playlists/hls/5c7ffc7f-980d-4a04-8ff4-ba15a03d9aec/d9d39fd4-1cd5-4ac9-a6a1-549e9ad2c1fa-master.m3u8https://nicecrew.tv/videos/embed/cquzpDmqAP1vfUxWjjQiEd150002024-12-15T01:47:39.024Zchristiancuteanime artpastelpainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/b59nVeqe9e7ZqzmjRiqBRDhttps://nicecrew.tv/lazy-static/thumbnails/af40db42-0918-4782-8902-4cb6d019b639.jpgFluffy bunniesA quick little animation before bedtime! Please enjoy!https://nicecrew.tv/static/streaming-playlists/hls/518f8655-5873-4067-a794-c7a1dc87c41b/80440b16-fbbf-4c96-8acc-48555669924c-master.m3u8https://nicecrew.tv/videos/embed/b59nVeqe9e7ZqzmjRiqBRD50002024-12-15T01:47:20.172Zcutebunniesanimationspaper animations/bunniesYESDreamy's LoungeNOhttps://nicecrew.tv/w/ihCZJbnnVsJ4EKaHxHtyDvhttps://nicecrew.tv/lazy-static/thumbnails/25f04133-5829-4c9a-b1ad-9baaacacc4b2.jpgDoodling: Hair testI wanted to goof around with the 10% water brush! Please enjoy! Finished doodle: http://rainbowdoodler209.deviantart.com/art/Hair-test-659839739?ga_submit_new=10%3A1485488931https://nicecrew.tv/static/streaming-playlists/hls/8bfe0e83-fef1-4069-9f95-41c2c32986e7/a0eb28ea-8117-49e4-b3b6-f2a74fba64ac-master.m3u8https://nicecrew.tv/videos/embed/ihCZJbnnVsJ4EKaHxHtyDv150002024-12-15T01:47:47.095ZtestcuteanimeLoliYESDreamy's LoungeNOhttps://nicecrew.tv/w/g75HUK7sk2DvhsdAqPpG9yhttps://nicecrew.tv/lazy-static/thumbnails/5f8981f0-afd8-41bd-bc11-880fa898afdb.jpgDrawing: Sweet pea muslimahAnother flower based muslimah girl for fun! I might make another video tonight! Please enjoy! Finished bloom: http://rainbowdoodler209.deviantart.com/art/Sweet-pea-muslimah-660037372?ga_submit_new=10%3A1485576206https://nicecrew.tv/static/streaming-playlists/hls/7a5273f1-ed75-4d78-b419-90b18ae92e98/3ac20a0c-ddf2-48a8-891f-b7cb4a509148-master.m3u8https://nicecrew.tv/videos/embed/g75HUK7sk2DvhsdAqPpG9y150002024-12-15T01:47:49.253ZmuslimahfloweranimepainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/hdhJKvkUJWkAvAki336u4Dhttps://nicecrew.tv/lazy-static/thumbnails/0eca3d53-1ae0-4b15-98c1-1c796d5d598c.jpgJiaoshi Utau: we are number oneA little we are number one video but with bad timing! Please enjoy this utau video!https://nicecrew.tv/static/streaming-playlists/hls/83497558-cb57-40b6-86cf-04f902055eab/1cd66207-907c-406b-a0b4-d93476429860-master.m3u8https://nicecrew.tv/videos/embed/hdhJKvkUJWkAvAki336u4D51002024-12-15T01:47:33.103ZUTAU JiaoshiutauWe are number oneWe are number one MEMEUtau coverYESDreamy's LoungeNOhttps://nicecrew.tv/w/gf7qFNZa6RuiiJKUdERLKthttps://nicecrew.tv/lazy-static/thumbnails/39f09af6-78b3-4ed1-893a-39f937aed9a5.jpgDrawing: Cute petAnother self drawing because why not! I can be pretty "petty" sometimes! I'm sorry for the pun! And I also have a discord as well! I'll have to send the link at some point! Please enjoy! Finished drawing: http://www.deviantart.com/notifications/#view=feedback Discord: https://discordapp.com/channels/@mehttps://nicecrew.tv/static/streaming-playlists/hls/7b7173de-77a3-4139-b4df-1a2491be8211/c5bdc7cf-11f1-47dd-a592-f12175944cba-master.m3u8https://nicecrew.tv/videos/embed/gf7qFNZa6RuiiJKUdERLKt150002024-12-15T01:47:48.662Zpetanime girlself drawingcutepastelYESDreamy's LoungeNOhttps://nicecrew.tv/w/aCKAjNXo9soG3bYsso524Zhttps://nicecrew.tv/lazy-static/thumbnails/31b32bbe-5d1a-49fd-94f1-16c6b63a8506.jpgDrawing: Safina and the Brown WolfA request from my crush since we talked! I hope you guys enjoy this drawing video! It was pretty fun to make to be honest! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Safina-and-the-brown-wolf-660838672?ga_submit_new=10%3A1485918018https://nicecrew.tv/static/streaming-playlists/hls/4e03e357-e886-47ff-b205-98c6106764cb/b21cf8ba-ea33-4433-b5c5-be53c6124501-master.m3u8https://nicecrew.tv/videos/embed/aCKAjNXo9soG3bYsso524Z150002024-12-15T01:47:51.456ZrainydullSafina the catcuteanthroYESDreamy's LoungeNOhttps://nicecrew.tv/w/4htJAoena3UqzU6HytnZRuhttps://nicecrew.tv/lazy-static/thumbnails/f4417514-e37b-45ad-9b41-0b93b322e56f.jpgDrawing: Sofie Sargent LucyMy new profile picture! Please enjoy this drawing! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Sofie-Sargent-Lucy-661039464?ga_submit_new=10%3A1486008792https://nicecrew.tv/static/streaming-playlists/hls/1a986880-2ec7-422f-ba1e-69ae5a2c54f2/f53f0a4a-557d-471d-b712-94b625f26aa1-master.m3u8https://nicecrew.tv/videos/embed/4htJAoena3UqzU6HytnZRu150002024-12-15T01:47:53.502ZLucyanna Kimselcuteanime girlsoftie sargentspeed paintYESDreamy's LoungeNOhttps://nicecrew.tv/w/e5MyQqxz7CpS29pJabNYnshttps://nicecrew.tv/lazy-static/thumbnails/0f32d170-8c01-42d0-9df1-4b930371cf2c.jpgDrawing: Three nunsA little nun drawing I made because I wanted to draw three nuns blessing a dead angel! (Even though Angels are already dead soo) Please enjoy everyone! Three nuns: http://rainbowdoodler209.deviantart.com/art/Three-nuns-661223397?ga_submit_new=10%3A1486093411https://nicecrew.tv/static/streaming-playlists/hls/69f1dbd8-e3c7-4558-b1d0-461bbae8f72c/58dcb700-241d-4b70-a45e-77b6d1f71b14-master.m3u8https://nicecrew.tv/videos/embed/e5MyQqxz7CpS29pJabNYns150002024-12-15T01:47:52.668Znunsanime girlspainttoolsaibloodyangelsYESDreamy's LoungeNOhttps://nicecrew.tv/w/6pbZzrxNk5B4BeZv89vVZBhttps://nicecrew.tv/lazy-static/thumbnails/85c5947b-10d6-4921-9aae-5d1dd403f50f.jpgDrawing: 猫 ブランドちゃんAnother cute little neko girl but Burando chan as a fluffy Persian! Please enjoy and stuff! Nya?: http://rainbowdoodler209.deviantart.com/art/Neko-Burando-chan-661639573?ga_submit_new=10%3A1486268544https://nicecrew.tv/static/streaming-playlists/hls/2bba9312-895b-45e7-a3ad-7ce61bf8a6a9/5cf5d364-43a7-4191-8c1d-87c11c05bb04-master.m3u8https://nicecrew.tv/videos/embed/6pbZzrxNk5B4BeZv89vVZB150002024-12-15T01:47:56.271ZブランドちゃんcutepainttoolsaimonochromenekogirlYESDreamy's LoungeNOhttps://nicecrew.tv/w/cVX5w7CKwNGeRp3om3KY8Hhttps://nicecrew.tv/lazy-static/thumbnails/85c30afd-7fd6-4822-9df8-e4e2a9440bcd.jpgDrawing: Pastel Safina (MS paint)Another little MS paint drawing because why not! I'll make another creepy drawing since I haven't made on in a long time! Safina: http://rainbowdoodler209.deviantart.com/art/Pastel-Safina-661847525?ga_submit_new=10%3A1486349487https://nicecrew.tv/static/streaming-playlists/hls/609ce356-c155-4a1d-bd80-cfbb3870d477/0d1d65a1-f5d3-44a6-ad1f-152674cfe7f8-master.m3u8https://nicecrew.tv/videos/embed/cVX5w7CKwNGeRp3om3KY8H150002024-12-15T01:47:55.883Zmspaintcutepasteldoodlesafina the catYESDreamy's LoungeNOhttps://nicecrew.tv/w/qWjrkm8MJh5CCqBsYkNZz7https://nicecrew.tv/lazy-static/thumbnails/5609d5c6-30f5-42f5-bb88-7bdd93c934a1.jpgDrawing: Sweet princess (P1)A cute pastel drawing of a princess that's really spoiled! Please enjoy!https://nicecrew.tv/static/streaming-playlists/hls/c9f0da7e-7e33-4e1b-889d-f1b190a99ce4/07adf83c-e536-49f6-973c-615c24397f41-master.m3u8https://nicecrew.tv/videos/embed/qWjrkm8MJh5CCqBsYkNZz7150002024-12-15T01:47:57.931ZprincessYESDreamy's LoungeNOhttps://nicecrew.tv/w/hwX4tJvoqZXjp28N1hUkKBhttps://nicecrew.tv/lazy-static/thumbnails/0f9d5e3c-ebf3-4e5a-aa6e-07fb6f12094e.jpgDrawing: Sweet Princess (P2)I dunno what else to talk about here...hmm Finished drawing: http://rainbowdoodler209.deviantart.com/art/Sweet-Princess-662224375https://nicecrew.tv/static/streaming-playlists/hls/85e476ac-93ca-4aac-849a-e49acd5a74ad/197dc80f-c566-441b-b606-36cdd2ffadf0-master.m3u8https://nicecrew.tv/videos/embed/hwX4tJvoqZXjp28N1hUkKB150002024-12-15T01:48:15.474ZPrincesscutepastelanime girlYESDreamy's LoungeNOhttps://nicecrew.tv/w/fd1JQFgGNT8kpPk6CeKqdghttps://nicecrew.tv/lazy-static/thumbnails/ad801e4a-1749-42c6-a54d-efd4c08ea8ed.jpgSpeed doodling: Twister LoliA quick loli drawing! Please enjoy and stuff! Twist twist twist: http://rainbowdoodler209.deviantart.com/art/Twister-Loli-662420511?ga_submit_new=10%3A1486612240https://nicecrew.tv/static/streaming-playlists/hls/730d5258-8446-4c5c-b96b-f997a02c36ef/2fcee3f7-7065-48e8-a3ed-7c11709b5ccb-master.m3u8https://nicecrew.tv/videos/embed/fd1JQFgGNT8kpPk6CeKqdg150002024-12-15T01:48:26.482Ztwistercuteanime loliYESDreamy's LoungeNOhttps://nicecrew.tv/w/g98st9Hsuy5PxjLJynpsi3https://nicecrew.tv/lazy-static/thumbnails/cb3187ec-9b2b-4892-bfa1-33e04514e07d.jpgSpeed doodle: Pastel Neko 2Another cute pastel neko doodle to make you smile! Please enjoy this little doodle video! Nya: http://rainbowdoodler209.deviantart.com/art/Pastel-Neko-2-662602930?ga_submit_new=10%3A1486697912https://nicecrew.tv/static/streaming-playlists/hls/7a9ba00c-e4ee-4e0f-a8c4-3f61dd0aa1ec/f8661614-2105-46e5-b9a2-fccb0bb94e3c-master.m3u8https://nicecrew.tv/videos/embed/g98st9Hsuy5PxjLJynpsi3150002024-12-15T01:48:29.791ZnekocutegirlanimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/wRt67yUVzpL3TxTu4smQ4thttps://nicecrew.tv/lazy-static/thumbnails/26d888c4-cab0-4df5-bce3-2fca86d8ca04.jpgDrawing: Sun hijabAnother cute hijab girl but was born under the sun, ans sometimes called sun child! Sun child fall down: http://rainbowdoodler209.deviantart.com/art/Sun-Hijabi-662844822https://nicecrew.tv/static/streaming-playlists/hls/f9da4c56-e4d2-43a9-9865-adbd5784a2a9/7e305767-1628-4ce9-b7e1-4407a0c77c6a-master.m3u8https://nicecrew.tv/videos/embed/wRt67yUVzpL3TxTu4smQ4t600002024-12-15T01:48:48.599Zsunchildcutehijab animeanimemuslimahYESDreamy's LoungeNOhttps://nicecrew.tv/w/eS7hkartUXQRNqErxAr9Dkhttps://nicecrew.tv/lazy-static/thumbnails/30b9453c-f153-40b6-8665-b1809e4bcd8f.jpgDrawing: Smiling beautyAnother cute muslimah girl before bed! Please enjoy and have a great night! Smiling happily: http://rainbowdoodler209.deviantart.com/art/Smiling-beauty-663255690?ga_submit_new=10%3A1486960901https://nicecrew.tv/static/streaming-playlists/hls/7045dcba-f63e-4292-8928-0c8ceca67d3d/c4f2be06-2846-469e-9b8b-1833ab5b6522-master.m3u8https://nicecrew.tv/videos/embed/eS7hkartUXQRNqErxAr9Dk240002024-12-15T01:48:34.148ZmuslimahcuteanimepasteldoodleYESDreamy's LoungeNOhttps://nicecrew.tv/w/jxHn5C6eyiE6M39AfkKpWBhttps://nicecrew.tv/lazy-static/thumbnails/469d7d07-4a0f-44c5-a2cc-2d8442a26d6a.jpgDrawing: Loving SoulI hope you guys don't mind me drawing more hijab girls! I hope you guys had a great Valentine's Day! Please enjoy the video tonight guys! Finished drawing of Love: http://rainbowdoodler209.deviantart.com/art/Loving-soul-663631710?ga_submit_new=10%3A1487126954https://nicecrew.tv/static/streaming-playlists/hls/96320b3b-8a57-4fc5-b0df-173a0f0c16c3/217a616e-6cf0-46e4-ab30-4474a951ed1d-master.m3u8https://nicecrew.tv/videos/embed/jxHn5C6eyiE6M39AfkKpWB481002024-12-15T01:48:42.457ZSpeedpainthijabmuslimahcutepainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/8YUpu6kUDqcNGszN7ZuwJVhttps://nicecrew.tv/lazy-static/thumbnails/f05a75e0-9a37-4bf6-9479-11924bbb8b8b.jpgSpeed drawing: Spider girl (Reupload)A weird spider girl drawing, please enjoy and stuff! And have a great night everyone! And I just wanted to fix this upload so sorry for the tiny video that I mistakenly put out! Spiders are crawling: http://rainbowdoodler209.deviantart.com/art/Spider-Girl-663995301?ga_submit_new=10%3A1487298683https://nicecrew.tv/static/streaming-playlists/hls/40a1eadb-4a07-46a7-93e4-ba28b3144ea1/92046a6d-67e8-49a3-834c-d84ed74ef851-master.m3u8https://nicecrew.tv/videos/embed/8YUpu6kUDqcNGszN7ZuwJV2337002024-12-15T01:51:26.047ZspidergirlsanimepainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/vCPyJ95SrgPBGChRv6PCFNhttps://nicecrew.tv/lazy-static/thumbnails/1d617e6a-a78f-4b3d-a3d0-159f088f8a6d.jpgSpeed drawing: Four EyesA cute little four eyed little girl! Please enjoy and stuff! Little four eyes: http://rainbowdoodler209.deviantart.com/art/Four-eyes-664300436?ga_submit_new=10%3A1487441080https://nicecrew.tv/static/streaming-playlists/hls/effd1bff-b762-4958-a7f8-89de8928c61c/fa21871f-97e8-486d-ad45-ccedb4e060a6-master.m3u8https://nicecrew.tv/videos/embed/vCPyJ95SrgPBGChRv6PCFN561002024-12-15T01:48:53.585ZcutedoodledrawingcolorfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/fzXs8DDVgk8BVwirf5YNpghttps://nicecrew.tv/lazy-static/thumbnails/bf4a7b0e-a614-47c8-ae6d-a75ad8b79725.jpgDrawing: Quiet morningMy attempt at making a water color painting type drawing! I hope you guys enjoy and stuff! calming Nun: http://rainbowdoodler209.deviantart.com/art/Quiet-morning-664443216?ga_submit_new=10%3A1487491655https://nicecrew.tv/static/streaming-playlists/hls/761da884-12ad-41d4-a840-cc1419c4c03d/5d848289-f0f0-4c27-8e01-0937f6e5eb2b-master.m3u8https://nicecrew.tv/videos/embed/fzXs8DDVgk8BVwirf5YNpg571002024-12-15T01:48:59.212ZcuteNunpasteldigital paintwatercolorYESDreamy's LoungeNOhttps://nicecrew.tv/w/8G2KQnopCMi1m3JUZxUAaKhttps://nicecrew.tv/lazy-static/thumbnails/50746061-2acc-4128-a284-1101ebe6877c.jpgDrawing: FueFue (Foo-way) is basically a catlike fluffybun who is cute but pretty deadly, she likes to blend into the grounds she walks around in! Please enjoy and stuff! Finished drawing: http://www.furaffinity.net/view/22671625/https://nicecrew.tv/static/streaming-playlists/hls/3e46cdae-81c0-4c5c-a64d-d8ccb938b6ad/fc011ffc-9a20-48a8-985b-981f964d9b99-master.m3u8https://nicecrew.tv/videos/embed/8G2KQnopCMi1m3JUZxUAaK1641002024-12-15T01:50:26.749ZFuecutefluffypinkpastelYESDreamy's LoungeNOhttps://nicecrew.tv/w/mecrSXbxCex4QdELzhz9ZDhttps://nicecrew.tv/lazy-static/thumbnails/43a18bc2-bb0d-4dfa-8120-febca645b3c8.jpgDrawing Moon hijabAnother hijabi girl but follows the bright sun child under her feet in the shadows! Please enjoy and stuff! Please enjoy and stuff! I'm sorry if the video seems really laggy! :/ Moonia in the stars: http://rainbowdoodler209.deviantart.com/art/Moon-hijabi-665020581?ga_submit_new=10%3A1487732304https://nicecrew.tv/static/streaming-playlists/hls/a3ce7f04-f197-4aee-a88f-752d37ae91f7/5ccd530c-b8a2-45f4-aeaf-a09c598da036-master.m3u8https://nicecrew.tv/videos/embed/mecrSXbxCex4QdELzhz9ZD288002024-12-15T01:48:52.583ZmoonchildhijabcoldcolorscuteanimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/uusJKwS15X4sTYExaU19s6https://nicecrew.tv/lazy-static/thumbnails/7f7eafa7-39f4-48c8-8103-44e3e4133f33.jpgSpeed doodling: Carrot hijabPlease enjoy this little drawing and stuff! Finished carrot cake: http://rainbowdoodler209.deviantart.com/art/Carrot-hijab-665219654?ga_submit_new=10%3A1487823348https://nicecrew.tv/static/streaming-playlists/hls/e6b92f73-1531-4786-9173-95c660cfffa9/6bd73be3-4652-496a-af17-73ad24e048c2-master.m3u8https://nicecrew.tv/videos/embed/uusJKwS15X4sTYExaU19s6533002024-12-15T01:49:01.052ZcarrotcutedrawingpaintoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/5RaTJi18fyiik37do3voYjhttps://nicecrew.tv/lazy-static/thumbnails/aea67dd6-e9f6-49c2-8b1c-ea7af49d5e54.jpgDrawing: Nonina shadowAnother little drawing video, I was a bit impatient for the whole video to load! I'll be animating now for a bit after this uploads! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Monina-Shadows-665369379?ga_submit_new=10%3A1487897908https://nicecrew.tv/static/streaming-playlists/hls/27421870-03d0-4e36-9007-0a8acc4ca042/6c5c3e6e-5bfb-460b-92e9-3fb059e54a93-master.m3u8https://nicecrew.tv/videos/embed/5RaTJi18fyiik37do3voYj617002024-12-15T01:49:43.438ZNoninacuteespeed paintpainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/a3Fif6wLiDCR1j7muDa4LJhttps://nicecrew.tv/lazy-static/thumbnails/342622d9-53c7-4831-adef-5c8ec31e374b.jpgAnimation: Happy MuslimahA little animation before I go to bed and stuff! Please enjoy everyone!https://nicecrew.tv/static/streaming-playlists/hls/4941f40b-4e13-4646-9bca-d8c48b981fc6/0a2f4ce8-d4d2-4173-ba35-0db196fa5748-master.m3u8https://nicecrew.tv/videos/embed/a3Fif6wLiDCR1j7muDa4LJ23002024-12-15T01:48:50.597ZCuteanimeMuslimahAnimationhappyYESDreamy's LoungeNOhttps://nicecrew.tv/w/ffhpgg48edgFjRKzP4MhY9https://nicecrew.tv/lazy-static/thumbnails/14a96bed-d8e8-4947-8e9c-74cfb1ed5e20.jpgDrawing Chocolate LaceAnother little muslimah girl but with a theme of chocolate. Vanilla is coming up next! Choco: http://rainbowdoodler209.deviantart.com/art/Chocolate-Lacing-665571351?ga_submit_new=10%3A1487989233https://nicecrew.tv/static/streaming-playlists/hls/735e7628-1965-4a22-8f58-d1f4e3002250/91a52a2a-9e28-42e8-ad13-4e4e1688ee86-master.m3u8https://nicecrew.tv/videos/embed/ffhpgg48edgFjRKzP4MhY9351002024-12-15T01:49:09.634Zmuslimahcandy themepainttoolsaispeedpaintchocolateYESDreamy's LoungeNOhttps://nicecrew.tv/w/4xt2BuQD2nRBSdj3fRT9xuhttps://nicecrew.tv/lazy-static/thumbnails/0ad2192c-6f87-4fcc-ad3f-c1f47b36a2b2.jpgDrawing: MushlimahMaking a drawing video because I'm waiting for the vanilla hijabi drawing video! Please enjoy and stuff! Finished mushroom: http://rainbowdoodler209.deviantart.com/art/Mushlimah-665834685?ga_submit_new=10%3A1488097041https://nicecrew.tv/static/streaming-playlists/hls/1cb0211b-1530-421c-90c1-87a838a7428a/cee39c12-a4f9-4a75-a3b3-11d5bf633c7e-master.m3u8https://nicecrew.tv/videos/embed/4xt2BuQD2nRBSdj3fRT9xu150002024-12-15T01:48:55.568ZCutedoodlemushroomanimemuslimahYESDreamy's LoungeNOhttps://nicecrew.tv/w/o2zxMeDw5iRxPWExYmvWgqhttps://nicecrew.tv/lazy-static/thumbnails/f1d79bcd-8637-4600-8a8c-01c6d84b2a43.jpgDrawing: Vanilla CoveringA little vanilla muslimah just eating ice cream but ended up in the vanilla river! I hope you guys enjoy and stuff! Vanilla rain: http://rainbowdoodler209.deviantart.com/art/Vanilla-Covering-665835806https://nicecrew.tv/static/streaming-playlists/hls/b261780c-304a-479d-a494-94967acfc09e/ee3930c9-a66d-49f3-8651-ea43045a1f88-master.m3u8https://nicecrew.tv/videos/embed/o2zxMeDw5iRxPWExYmvWgq501002024-12-15T01:49:12.605ZVanillacutemuslimahhijabdullYESDreamy's LoungeNOhttps://nicecrew.tv/w/3oqGA8hFk33Ug9pjAobmaAhttps://nicecrew.tv/lazy-static/thumbnails/e952f1ef-9743-4c12-ac2a-08661650cee8.jpgDrawing: Mosa RoroAnother muslimah girl but is very shy, sweet and monochrome all over! Please enjoy this drawing video! It was a pain to draw with OBS... Maybe it's the FPS? Finished drawing: http://rainbowdoodler209.deviantart.com/art/Mosa-Roro-666422662?ga_submit_new=10%3A1488335687https://nicecrew.tv/static/streaming-playlists/hls/1353dcaf-754f-4da0-887a-d35faba85d2c/dd52091e-42ec-40d6-9819-9be2c2ca1cf9-master.m3u8https://nicecrew.tv/videos/embed/3oqGA8hFk33Ug9pjAobmaA508002024-12-15T01:50:17.747ZMosa Rorocuteanimespeed drawingOBSYESDreamy's LoungeNOhttps://nicecrew.tv/w/9PzC6169PVscpKhPweyX2Vhttps://nicecrew.tv/lazy-static/thumbnails/c265622a-d9d4-4da6-9820-c0550f2f8999.jpgColors! 3D: Lucyanna CandyMy new profile picture because why not, please enjoy this little 3Ds drawing! ^^https://nicecrew.tv/static/streaming-playlists/hls/476dc970-7745-4389-afab-c4cd75cc257b/b3fd5dac-9ec8-4024-b96d-0540b00c27b3-master.m3u8https://nicecrew.tv/videos/embed/9PzC6169PVscpKhPweyX2V81002024-12-15T01:49:02.004ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/x96BLVBDgoNfkv8btxxreNhttps://nicecrew.tv/lazy-static/thumbnails/71f8f6e3-403a-4f25-844b-854bf51a449b.jpgDrawing: Say CheeseA drawing of a muslimah girl at the library, and a few monsters are interested in what she's reading and researching about. Please enjoy this drawing, like and sub also comment if you want! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Say-Cheese-666800754?ga_submit_new=10%3A1488513446https://nicecrew.tv/static/streaming-playlists/hls/fc2cb5c8-f063-413e-aa42-292035404e4c/5370fd92-93ec-4ad1-96d2-52bd7105b649-master.m3u8https://nicecrew.tv/videos/embed/x96BLVBDgoNfkv8btxxreN777002024-12-15T01:52:48.009Zanime muslimahcutepastelspeed paintYESDreamy's LoungeNOhttps://nicecrew.tv/w/qcChyvnavozMob9GRMxwL3https://nicecrew.tv/lazy-static/thumbnails/97e0ec70-a287-4397-83d5-94458b7cc951.jpgQuick doodle: Yin N YangA little muslimah but based off of the yin and yang symbol! Please enjoy! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Yin-N-Yang-667017531?ga_submit_new=10%3A1488615928https://nicecrew.tv/static/streaming-playlists/hls/c3fadefd-ba63-4108-a781-ff7837a9de7a/0fa0926c-cf46-400e-9750-01b96572d900-master.m3u8https://nicecrew.tv/videos/embed/qcChyvnavozMob9GRMxwL3255002024-12-15T01:49:07.939ZYinYangmonochromecutepainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/uDBVpmR64swQdqcwbcF8eChttps://nicecrew.tv/lazy-static/thumbnails/8cd57fd3-c59a-45be-8504-362731024899.jpgDrawing: Galaxy girlA cute little girl wearing the dress of the beautiful galaxies we live in! Please enjoy this drawing video and stuff! Galaxy girl: http://rainbowdoodler209.deviantart.com/art/Galaxy-girl-667167491?ga_submit_new=10%3A1488679095https://nicecrew.tv/static/streaming-playlists/hls/e80089f6-08c7-4ffa-8573-f0bd19aa521a/dc67772d-a7fd-405d-ab1f-cda8d85b4d72-master.m3u8https://nicecrew.tv/videos/embed/uDBVpmR64swQdqcwbcF8eC749002024-12-15T01:53:39.118Zgalaxycuteanime artcold colorsspaceYESDreamy's LoungeNOhttps://nicecrew.tv/w/1FBFKDsGQ7EQ3zYVzz4Sb4https://nicecrew.tv/lazy-static/thumbnails/dd6015bd-443b-4a85-ae2c-782512dd9416.jpgThe Fluff Girl 7Another little animation, please enjoy!https://nicecrew.tv/static/streaming-playlists/hls/0587ffb9-ff70-4ee4-b0ae-f432e4ffb6b7/ce78c902-8b6a-425f-928e-eb7eecc4d812-master.m3u8https://nicecrew.tv/videos/embed/1FBFKDsGQ7EQ3zYVzz4Sb437002024-12-15T01:49:34.762ZanimationsPaper plasticYESDreamy's LoungeNOhttps://nicecrew.tv/w/c565DRN2g6ZqcvaRDePVoNhttps://nicecrew.tv/lazy-static/thumbnails/7155c798-e603-4c78-8876-65fbdba523b5.jpgSpeed doodle: Purple NunJust wanted to make a quick video since my computer over heated and stuff! I'll post the drawing on DA and Tumblr tomorrow. Finished drawing: http://rainbowdoodler209.deviantart.com/art/Purple-Nun-667760902?ga_submit_new=10%3A1488946363https://nicecrew.tv/static/streaming-playlists/hls/59a6a192-27d3-4e75-b00f-61b9c71a38a6/8e17f3b7-ae56-4d84-8447-cd5e00369a9a-master.m3u8https://nicecrew.tv/videos/embed/c565DRN2g6ZqcvaRDePVoN150002024-12-15T01:49:50.271ZcutepurplebruisesanimesoulessYESDreamy's LoungeNOhttps://nicecrew.tv/w/3ewany38tN6pm9RbzichxZhttps://nicecrew.tv/lazy-static/thumbnails/e47b7044-dd07-4532-873b-780dd1b16056.jpgDrawing: Candy WrappedA cute little drawing of a teenage loli girl, as a candy wrapper. Happy woman's day....no.. ..Happy humanity....hmm This drawing might be my first commission? meh... Finished Candy: http://rainbowdoodler209.deviantart.com/art/Candy-wrapped-667971132?ga_submit_new=10%3A1489060508https://nicecrew.tv/static/streaming-playlists/hls/121588b8-6407-45da-9a3f-d00015b2b5e7/99d6c9b1-5de2-48d3-8715-0a571d65e0dd-master.m3u8https://nicecrew.tv/videos/embed/3ewany38tN6pm9RbzichxZ815002024-12-15T01:53:59.761Zpastelcuteanime girllolismall teenagerYESDreamy's LoungeNOhttps://nicecrew.tv/w/7cq9NMyHHuEJpw2hWpQGhDhttps://nicecrew.tv/lazy-static/thumbnails/e589f47f-eb63-4a81-9d10-505118131612.jpgUTAU Lucyanna Kimsel/ ImposterA little quick Utau video before bedtime. Please enjoy and stuff!https://nicecrew.tv/static/streaming-playlists/hls/322ee5c4-7ccb-476b-adda-e6dda81d2f95/cc3ad17e-d30c-48f9-92af-103557b4808e-master.m3u8https://nicecrew.tv/videos/embed/7cq9NMyHHuEJpw2hWpQGhD39002024-12-15T01:49:45.932ZcuteUTAUrandomLucyanna KimselYESDreamy's LoungeNOhttps://nicecrew.tv/w/wY43UDMbxQqgHRb2hzusLJhttps://nicecrew.tv/lazy-static/thumbnails/a77b5059-b04b-4ab9-8aac-bab8b549b76f.jpgDrawing: MS schoolgirl paitingAnother digital ms paint drawing but drawn nicely. Please enjoy! Finnished drawing: http://rainbowdoodler209.deviantart.com/art/MS-Schoolgirl-painting-668313450?ga_submit_new=10%3A1489219902https://nicecrew.tv/static/streaming-playlists/hls/fac5b0cd-3c2c-4e9b-8462-9f4772574b7a/70330df8-41a8-47e7-b0fe-fbefe714006f-master.m3u8https://nicecrew.tv/videos/embed/wY43UDMbxQqgHRb2hzusLJ472012024-12-15T01:51:57.284Zanime girlcuteMS PaintMS PAINTpastel colorsYESDreamy's LoungeNOhttps://nicecrew.tv/w/p1S7rC5K4cC2E283yVywm7https://nicecrew.tv/lazy-static/thumbnails/2d8288eb-67ef-42ee-9e06-aead506173a7.jpgDrawing: Little princessA little muslimah girl who likes to see herself as a sweet little princess, or queen. Please enjoy this video and sub to my channel. Cute princess: http://rainbowdoodler209.deviantart.com/art/Little-Princess-668500087https://nicecrew.tv/static/streaming-playlists/hls/ba61123b-8551-4605-aa24-9b3ea581a316/5ab8a36e-7634-4b40-9f42-03d6dce4fff2-master.m3u8https://nicecrew.tv/videos/embed/p1S7rC5K4cC2E283yVywm7483002024-12-15T01:52:00.865ZpastelcuteanimemuslimahcolorfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/uaZqsCnXNTgHTH5xVAXevmhttps://nicecrew.tv/lazy-static/thumbnails/ad82f7c9-9bed-4141-9362-ae5dc2dd5e84.jpg3Ds drawing: Ahlam Ria DoodleA little 3ds doodle, I was at a band concert which is why I didn't make a video at all tonight, hopefully you guys have a great night as well! :)https://nicecrew.tv/static/streaming-playlists/hls/e424f6bb-429f-485e-9fb4-56585aaab512/f4ee9951-c240-4086-b545-3bd6e34149af-master.m3u8https://nicecrew.tv/videos/embed/uaZqsCnXNTgHTH5xVAXevm45002024-12-15T01:50:02.681ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/835KCnGZAwrEdtrGKJnvDqhttps://nicecrew.tv/lazy-static/thumbnails/27a3c776-e8b9-4b82-846b-6b126082d72e.jpgDrawing: Rainbow girl 2A little rainbow girl drawing before bedtime, I really need some rest to be honest... Finished drawing: http://rainbowdoodler209.deviantart.com/art/Rainbow-Girl-669249774?ga_submit_new=10%3A1489631976https://nicecrew.tv/static/streaming-playlists/hls/38fa6305-7ae0-4d92-b441-fd5040d364d6/b623105a-d87b-4e54-856e-40971829b1d7-master.m3u8https://nicecrew.tv/videos/embed/835KCnGZAwrEdtrGKJnvDq1358002024-12-15T02:00:51.388ZrainbowcolorfulcuteanimeRainbowdoodler209YESDreamy's LoungeNOhttps://nicecrew.tv/w/mgh8oAMDGKAfsGH7HbPBK2https://nicecrew.tv/lazy-static/thumbnails/7ebafb43-ef08-495a-9cfd-9408db1bfa60.jpgEs drawing: El diabloEs drawing of a cute diablo, gracias for watching the video and goodnight to you all my fine amigos! Es diablo drawing: http://rainbowdoodler209.deviantart.com/art/El-Diablo-669440284?ga_submit_new=10%3A1489725652https://nicecrew.tv/static/streaming-playlists/hls/a418de5d-bf29-43be-a92e-e27442569443/7844ba9b-41d1-4439-b97c-d9862f059b15-master.m3u8https://nicecrew.tv/videos/embed/mgh8oAMDGKAfsGH7HbPBK279002024-12-15T01:50:43.756Zel drawingdiablodevilcuteredYESDreamy's LoungeNOhttps://nicecrew.tv/w/iqzqnvuudeMgRkgmNwbaLyhttps://nicecrew.tv/lazy-static/thumbnails/61e78c0d-f385-4756-8726-89280e654bb8.jpgdrawing: Three eyed devilI wanted to draw another little devil, I got my replacement cord and now I can draw more now. Anyways, please enjoy this video, even though It's Monday, I wanted to post today for a bit. Please enjoy. Finished drawing: http://rainbowdoodler209.deviantart.com/art/Three-eyed-devil-670191923?ga_submit_new=10%3A1490062634https://nicecrew.tv/static/streaming-playlists/hls/8d19cdba-274f-42a8-8006-9de16dc46c0c/8e0da1a4-3066-4fc5-8b75-2ed603fa43f6-master.m3u8https://nicecrew.tv/videos/embed/iqzqnvuudeMgRkgmNwbaLy382002024-12-15T01:51:59.145ZpainttoolsaicutedevilthirdeyecolorfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/2figLUHNQgyuTwipnE5DEwhttps://nicecrew.tv/lazy-static/thumbnails/eb209120-d030-4032-abaa-c630f8bbb189.jpgUTAU: Factory Metal JiaoshiAnother little utau video because why not, please enjoy and stuff! I'll make a thumbnail for my videos from now on.https://nicecrew.tv/static/streaming-playlists/hls/0a183217-6e96-44bf-bc83-33b28c97bc4e/1325bbb8-4074-441f-b273-7f5a3d4a1430-master.m3u8https://nicecrew.tv/videos/embed/2figLUHNQgyuTwipnE5DEw106012024-12-15T01:50:35.819ZUTAUUTAU JiaoshirandomNoiseliodYESDreamy's LoungeNOhttps://nicecrew.tv/w/hFoRM4JS6dMG5U4aYKJc1fhttps://nicecrew.tv/lazy-static/thumbnails/12728086-505e-43fa-9e5d-78378ce8653c.jpgDrawing: Cake Hijab:Another muslimah girl but based off of a pastel cake, please enjoy and stuff! Finished drawing: http://rainbowdoodler209.deviantart.com/art/cake-Hijab-670546011?ga_submit_new=10%3A1490238546https://nicecrew.tv/static/streaming-playlists/hls/87124ffe-1419-4cf6-a2cd-ddb46735639a/0082f17d-0953-4eb1-a191-e896e69435de-master.m3u8https://nicecrew.tv/videos/embed/hFoRM4JS6dMG5U4aYKJc1f212002024-12-15T01:51:32.936ZAnime artmuslimahpastel colorshappyjoyYESDreamy's LoungeNOhttps://nicecrew.tv/w/9A8sfYLSWwP6Vahqxh5hwPhttps://nicecrew.tv/lazy-static/thumbnails/e2f67277-9c97-45e0-b10f-0beab304e498.jpgDrawing: Red velvetA cute monster holding a red velvet cake with vanilla frosting, mmm I love cake! Enjoy the video everyone! Finished cake: http://rainbowdoodler209.deviantart.com/art/Velvet-cake-670981263?ga_submit_new=10%3A1490461241https://nicecrew.tv/static/streaming-playlists/hls/458cfd88-b239-45b7-89e2-1ac39ecee63b/87bde8f7-32f4-4bb1-bff9-724b3fc4dec1-master.m3u8https://nicecrew.tv/videos/embed/9A8sfYLSWwP6Vahqxh5hwP205012024-12-15T01:51:40.285ZcakemonsterpastelcartoonillistrationYESDreamy's LoungeNOhttps://nicecrew.tv/w/7ZvVs7aVYnn5hrzd5V9LNjhttps://nicecrew.tv/lazy-static/thumbnails/5bf4df24-62ab-479c-908b-434744613319.jpgDrawing: Somthing WrongAcnother cute muslimah but looking adorable reading the hijab books she likes to look at, I enjoyed making this drawing and coloring the lineart, please enjoy and stuff everyone. Finished muslimah: http://rainbowdoodler209.deviantart.com/art/Somthing-wrong-670870007?ga_submit_new=10%3A1490407185https://nicecrew.tv/static/streaming-playlists/hls/389eaaaa-6532-49c5-ac58-0275e04fcf3e/38461e8e-36cf-46f2-830e-94a3ec85a60f-master.m3u8https://nicecrew.tv/videos/embed/7ZvVs7aVYnn5hrzd5V9LNj434002024-12-15T01:52:14.922ZmuslimahcutevibrantanimereadingYESDreamy's LoungeNOhttps://nicecrew.tv/w/oetGskhLYFs3agH5ZRut34https://nicecrew.tv/lazy-static/thumbnails/c4884ece-2b20-490c-a457-76b0de38491f.jpgColors! 3D: Soft SmilesA little 3ds drawing I wanted to show you guys before bed, the next video will be loaded up hopefully, please enjoy! ♡♡♡https://nicecrew.tv/static/streaming-playlists/hls/b40ac9e8-e79e-491f-9036-d1ebead638d3/fe646083-35a1-4dd1-9983-2af66b4e3086-master.m3u8https://nicecrew.tv/videos/embed/oetGskhLYFs3agH5ZRut3474002024-12-15T01:52:02.930ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/m2RDfNa4oqmqkqx2fYN7yQhttps://nicecrew.tv/lazy-static/thumbnails/2db77610-a29c-4eb4-ae34-bd38f3648097.jpgDrawing: Peach FuzzAnother cute drawing of Aisa but holding a soft plump peach, please enjoy this cute little illustration and such. Finished peach: http://rainbowdoodler209.deviantart.com/art/Peach-fuzz-671472292https://nicecrew.tv/static/streaming-playlists/hls/a2391c32-47c2-4b92-ab4b-2a79effa0578/44c9a3b0-d67c-4fd1-9c9b-a7cab3f21548-master.m3u8https://nicecrew.tv/videos/embed/m2RDfNa4oqmqkqx2fYN7yQ409002024-12-15T01:56:20.407ZpeachesAisaillistrationanimecuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/9fUBU4UpK9dEH78jrinpfThttps://nicecrew.tv/lazy-static/thumbnails/c12e7a1a-daec-48d1-90ec-24215ffd829c.jpgDrawing: Soft VoiceI just wanna draw myself, someone give me some ideas for shitposting, I dunno. Enjoy and stuff and yeah... I must need to slow down when I draw then....uhh. Ehh: http://rainbowdoodler209.deviantart.com/art/Soft-voice-671661592?ga_submit_new=10%3A1490755549https://nicecrew.tv/static/streaming-playlists/hls/42ddf31a-a45d-451c-bd49-04274fd57393/51321541-e8b0-4aaa-b850-cdd3da328f00-master.m3u8https://nicecrew.tv/videos/embed/9fUBU4UpK9dEH78jrinpfT181002024-12-15T01:54:42.984Zdoodledrawingdigitalself drawingpainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/tBpJGKktHNsPXAAyjnMy7shttps://nicecrew.tv/lazy-static/thumbnails/88e7dc5d-187c-433b-ab3c-fda0aedd5edf.jpgLime SlimeA cute little slime girl since I haven't drawn them in a long long while, uuh, please enjoy and sub, comment and like my channel. Gloop gloop: http://rainbowdoodler209.deviantart.com/art/Lime-Slime-671829549?ga_submit_new=10%3A1490838887https://nicecrew.tv/static/streaming-playlists/hls/df98675c-6a76-42fa-999f-2212707a878e/e55b17ad-5871-4137-9d06-62e6699c8997-master.m3u8https://nicecrew.tv/videos/embed/tBpJGKktHNsPXAAyjnMy7s251002024-12-15T01:53:54.493ZslimeanimecutepainttoolsaigreenYESDreamy's LoungeNOhttps://nicecrew.tv/w/9UtbXFMDH7crAVknXwk9Zkhttps://nicecrew.tv/lazy-static/thumbnails/2f9ff19f-0f30-477c-a400-80fa24d7d4fa.jpgDrawing: Dolly's dressAnother cute gilr but her nickname is Dollygirl, mainly becuase she wears whatever you give her, even if it's an odd outfit, please enjoy and Happy 1st day of April, I'll make another "Best drawing ever 8D" Because why not! Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/481c8a86-99cc-4c7a-a6ce-9bb3b07ea415/80169ea5-dae4-4bc3-832d-741627c9c2b5-master.m3u8https://nicecrew.tv/videos/embed/9UtbXFMDH7crAVknXwk9Zk362002024-12-15T01:57:16.486ZdressDollygirlpastelcuteanimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/m8Zuo6HwQP1r5J1nzwWTiZhttps://nicecrew.tv/lazy-static/thumbnails/81000858-8da6-4141-8aa9-6b82dc85d868.jpgPuffball the dog manHis name is puffball and he loves mangos and other fruits and veggies, but he's also very selfish but begging long enough he'll actually give you a mango. REEEEEEEEE: https://www.furaffinity.net/view/23080032/https://nicecrew.tv/static/streaming-playlists/hls/a314689d-1416-438d-8e7e-20f188fb016f/d597bc7d-03dc-4dcc-aa49-7102c0a1780f-master.m3u8https://nicecrew.tv/videos/embed/m8Zuo6HwQP1r5J1nzwWTiZ179002024-12-15T01:55:04.962ZPuffball doganimehybridcutestingeyYESDreamy's LoungeNOhttps://nicecrew.tv/w/bvzkPJJVHWuLNF7P5JNkp8https://nicecrew.tv/lazy-static/thumbnails/75725bc0-9452-4e75-8863-49fb80fc51e1.jpgDrawing: Sweet GothikaA quick MS drawing, I don't wanna keep you guys waiting, please enjoy! Sorry if the video is lagging again.... Finished drawing: http://rainbowdoodler209.deviantart.com/art/Sweet-Gothika-672669403?ga_submit_new=10%3A1491186989https://nicecrew.tv/static/streaming-playlists/hls/551c80e7-5544-46f8-a3bf-9c4cd7cd74f9/ecb87f0c-8948-4188-abc9-1049d9db41a4-master.m3u8https://nicecrew.tv/videos/embed/bvzkPJJVHWuLNF7P5JNkp8445002024-12-15T01:57:26.529ZGothikacuteloliconmspaintlittle selfYESDreamy's LoungeNOhttps://nicecrew.tv/w/pr7qa6YWyEmwVKqpBDhAsUhttps://nicecrew.tv/lazy-static/thumbnails/bf2c2438-76cd-41bc-9452-349fc5376b4f.jpgLemon Macaroon girlAnother girl based off of desserts, I hope you guys enjoy this little quick drawing video.https://nicecrew.tv/static/streaming-playlists/hls/bdc3bcdc-6333-4068-9078-aa201983b050/ae6416b0-5ac3-4ddd-be39-b5dc68caeeb6-master.m3u8https://nicecrew.tv/videos/embed/pr7qa6YWyEmwVKqpBDhAsU29002024-12-15T01:53:52.887ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/mmBAT6e736c8C7o1R2RDvohttps://nicecrew.tv/lazy-static/thumbnails/62f081a6-202a-4325-b28c-69f81fd8c068.jpgDrawing: Angry Mint ChocoAnother dessert girl I made, tell me what dessert or food I should draw as girls, I dunno. But I honestly hope you guys enjoy this video and stuff! Mint Choco girl: http://rainbowdoodler209.deviantart.com/art/Angry-Mint-Choco-673022022?ga_submit_new=10%3A1491358454https://nicecrew.tv/static/streaming-playlists/hls/a4d796b7-9117-439c-b56e-7e613fa51834/d381347f-7c59-4332-8df5-cf652b4b6862-master.m3u8https://nicecrew.tv/videos/embed/mmBAT6e736c8C7o1R2RDvo421002024-12-15T01:58:31.915Zmint choco girlice cream girlangryanime drawingscartonsYESDreamy's LoungeNOhttps://nicecrew.tv/w/i3hMe3B9EVxPuqJMJpZYzohttps://nicecrew.tv/lazy-static/thumbnails/a5615e7f-ec17-4595-9320-23c066ba7605.jpgDoodling: LiqiA cute bunch of doodles of an adorable monster thing. It's name is Liqi, and that's all I got for this video. Yeah, I'll make another video. Why not.https://nicecrew.tv/static/streaming-playlists/hls/89fd2f86-3ac7-4368-a6c0-6e5976e29948/46c55675-076d-4c5b-872d-e77ea70ccc79-master.m3u8https://nicecrew.tv/videos/embed/i3hMe3B9EVxPuqJMJpZYzo167002024-12-15T01:57:08.038ZcuteLiqi monsteradorablerandomsilly doodlesYESDreamy's LoungeNOhttps://nicecrew.tv/w/5LHjuTADj2Xy8vyNQ6uJnYhttps://nicecrew.tv/lazy-static/thumbnails/55bc98bf-2907-49b1-8a53-df334a6af607.jpgQuick drawing: Soft StareA quick little drawing, OBS is acting up and I'll probably need to claen my computer a bit, please enjoy and stuff! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Soft-Stare-673393036?ga_submit_new=10%3A1491533073https://nicecrew.tv/static/streaming-playlists/hls/26a2be85-00d3-45ab-919e-83cf89c86312/71413cc7-ba16-470c-9538-d06f662425d1-master.m3u8https://nicecrew.tv/videos/embed/5LHjuTADj2Xy8vyNQ6uJnY150002024-12-15T01:56:48.155Zcolorfulcutekawaiianimeanime girlsYESDreamy's LoungeNOhttps://nicecrew.tv/w/5whiDHSE47Qn4zHEpyorDphttps://nicecrew.tv/lazy-static/thumbnails/08cbbcf9-d24d-4823-ab32-f8d7e5eb4e43.jpgDrawing: Midi FairyAnother midi based drawing but a girl based off of the falls colors you see hitting the piano keys, making beautiful music. I hope you guys enjoy and stuff! I'll use more piano music or jazz, enjoy everyone! Midi fairy is loading...: http://rainbowdoodler209.deviantart.com/art/Midi-Fairy-673581607?ga_submit_new=10%3A1491622871https://nicecrew.tv/static/streaming-playlists/hls/249eea66-dfb9-42fa-8a1f-31dda86022cd/45d1194b-d253-459c-8a67-d1a4f91b3fdd-master.m3u8https://nicecrew.tv/videos/embed/5whiDHSE47Qn4zHEpyorDp150002024-12-15T01:56:49.780ZcolorfulcutepainttoolsaiMidi fairyYESDreamy's LoungeNOhttps://nicecrew.tv/w/eSpjJongcy7hSZQJaDvFNUhttps://nicecrew.tv/lazy-static/thumbnails/35211109-4831-46cb-b722-55fe4e52b42d.jpgShining NightA song about the night and the moon shining brightly with the stars. 🌙https://nicecrew.tv/static/streaming-playlists/hls/70505d46-6114-4114-9e16-a32109ef8314/fc898b57-b541-4a34-b88f-0ae0203a9dd2-master.m3u8https://nicecrew.tv/videos/embed/eSpjJongcy7hSZQJaDvFNU87002024-12-15T01:56:13.998ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/iSoMxvXsRLiWL7FKN5s6PKhttps://nicecrew.tv/lazy-static/thumbnails/a502dafc-2c3f-4359-b907-802c2f693e37.jpgDrawing: JajakittyJajakitty is a neko girl who likes to slice and dice other monster, please enjoy and stuff! El rojo gato: http://rainbowdoodler209.deviantart.com/art/Jajakitty-673988945?ga_submit_new=10%3A1491793386https://nicecrew.tv/static/streaming-playlists/hls/90b4966e-1505-4c24-a70a-0eacc8c6cfd5/5340ee4d-2921-4c66-86b7-6668881e25a0-master.m3u8https://nicecrew.tv/videos/embed/iSoMxvXsRLiWL7FKN5s6PK150002024-12-15T01:57:12.425ZJajakittycutekawaiiredguroYESDreamy's LoungeNOhttps://nicecrew.tv/w/nzk89bXyBSAy9CKbetJtEdhttps://nicecrew.tv/lazy-static/thumbnails/1c340735-ef9f-4791-8584-691d9b6425b2.jpgColors! 3D: Smol hijabiA cute little child hijab girl, I hope you guys enjoy and that is all! :) ありがと〜❤︎ 谢谢你！https://nicecrew.tv/static/streaming-playlists/hls/aeb73dc6-bad0-4429-b945-d54af33c55d4/430ad88e-b261-46ee-8fc7-8b3996db0a1b-master.m3u8https://nicecrew.tv/videos/embed/nzk89bXyBSAy9CKbetJtEd48002024-12-15T01:57:04.478ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/hqhMUGumgAuqosAzqKVVSihttps://nicecrew.tv/lazy-static/thumbnails/66dcc046-a3a1-4d86-bc46-c91487f936cd.jpgDrawing: Ribbon hero (P1)A cute hero girl I drew for fun, I will send out part two, and send the finished drawing on Part two, please enjoy~https://nicecrew.tv/static/streaming-playlists/hls/84f66acc-b7b6-4355-b795-4073f5e25011/154df2db-457e-4fa8-95ce-69d5e990a3e1-master.m3u8https://nicecrew.tv/videos/embed/hqhMUGumgAuqosAzqKVVSi600002024-12-15T01:59:02.293ZspeedpaintcuteherofemaleanimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/9bozUKjshcLztm6VJEBxLNhttps://nicecrew.tv/lazy-static/thumbnails/e277bde0-fa83-4c80-ba45-74c23fba2073.jpgDrawing: Ribbon hero (P2)Here is part two, please enjoy! An dstuff, and have a great night! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Ribbon-Hero-674176120?ga_submit_new=10%3A1491879223https://nicecrew.tv/static/streaming-playlists/hls/423c771b-6b0b-4402-9d0f-f9d0b066375a/42209928-123d-4822-98b3-c4ca9ab87b4d-master.m3u8https://nicecrew.tv/videos/embed/9bozUKjshcLztm6VJEBxLN270002024-12-15T01:57:42.851Zspeedpaintcuteanimeheroribbon heroYESDreamy's LoungeNOhttps://nicecrew.tv/w/78kBM74HrFcdGpN3zj8h8Nhttps://nicecrew.tv/lazy-static/thumbnails/cb5336af-9b79-44b2-85e2-5bd91fb6ac97.jpgDrawing: Yui's dress (P1)ANother cute Yui drawing, haven't drawn her in a long time! Please enjoy!https://nicecrew.tv/static/streaming-playlists/hls/319d20ae-cb91-4005-8f2f-15bbc8f46e5c/a5561ad0-7398-4c8a-bc34-35f842abbafc-master.m3u8https://nicecrew.tv/videos/embed/78kBM74HrFcdGpN3zj8h8N150002024-12-15T01:57:37.418ZpainttoolsaiYui ratYESDreamy's LoungeNOhttps://nicecrew.tv/w/rLX1Jsw9Egx4g5xTN8pJdJhttps://nicecrew.tv/lazy-static/thumbnails/a786a844-cefc-4cf4-91e4-ea127bfe2392.jpgDrawing: Yui's dress (P2)Just wanted to finish the drawing, and finished the drawing off camera as well, please enjoy and stuff! Yui's cute dress: http://rainbowdoodler209.deviantart.com/art/Yui-s-outfit-674353945https://nicecrew.tv/static/streaming-playlists/hls/d0bb1859-432a-4c7e-a129-94b5d58264d2/ca1a9917-7fff-43e2-af45-f5b54831df35-master.m3u8https://nicecrew.tv/videos/embed/rLX1Jsw9Egx4g5xTN8pJdJ150002024-12-15T01:58:07.642ZcuteYui ratcolofulspeedpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/vT6zSZu5cCKEN2an6JBDbFhttps://nicecrew.tv/lazy-static/thumbnails/4c0dbd96-bf52-4c2b-8044-336e7fea298e.jpgDrawing: PistachimahAnother cute food related Muslimah, I adore pistachios so much! Their so tasty! Anyways, please enjoy and happy Wednesday! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Pistachimah-674548189?ga_submit_new=10%3A1492052124https://nicecrew.tv/static/streaming-playlists/hls/f1fb650e-345a-486a-bd39-2d944c106b97/84f53417-cb9f-4ef7-8f5e-2a7b96301b9d-master.m3u8https://nicecrew.tv/videos/embed/vT6zSZu5cCKEN2an6JBDbF600002024-12-15T02:00:20.470ZPistachioscutemuslimahgreentree nutYESDreamy's LoungeNOhttps://nicecrew.tv/w/2MoibeuSr2k1DomDNQLwZehttps://nicecrew.tv/lazy-static/thumbnails/ae9e38bf-8bf0-47de-bb9d-0864156011c2.jpgDrawing: ZyxI hope you guys don't mind me just making more drawing videos, I'll be trying to figure out how to upload my animations more professionally I guess? Anyways, enjoy! Finished demon summoning: http://rainbowdoodler209.deviantart.com/art/Zyx-674738808?ga_submit_new=10%3A1492138880https://nicecrew.tv/static/streaming-playlists/hls/0e6f594a-cea7-465b-8362-bebca498250f/e91a1e39-cd75-4f5d-86b8-ac94e13d5ccf-master.m3u8https://nicecrew.tv/videos/embed/2MoibeuSr2k1DomDNQLwZe600002024-12-15T02:00:11.692ZZyxcutedemonmonsterpainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/iFjSttj2PdgFYnLb8T9VBGhttps://nicecrew.tv/lazy-static/thumbnails/56a4e27c-1dc5-4485-b40d-ec74fa738aec.jpgDrawing: Bailey Bear dogA quick little blue bear dog thing, please enjoy and stuff! Goodnight everyone! Roar bark: http://rainbowdoodler209.deviantart.com/art/Bailey-Bear-dog-674971354?ga_submit_new=10%3A1492231795https://nicecrew.tv/static/streaming-playlists/hls/8f28fe52-6fc6-4fcc-aa81-3648d376e8da/762692a3-d170-4dd1-83b8-03ce62bdac0e-master.m3u8https://nicecrew.tv/videos/embed/iFjSttj2PdgFYnLb8T9VBG264002024-12-15T01:59:03.936ZcuteblueBailey Bear dogYESDreamy's LoungeNOhttps://nicecrew.tv/w/mdYzRhNWm6hXN49G62iYTUhttps://nicecrew.tv/lazy-static/thumbnails/301d7511-590b-44fa-a603-366410b3b8e1.jpgDrawing: CaheretA new version of Caheret's persona, I hope you guys enjoy! I edited the drawing a bit off camera so yeah! Please enjoy! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Caheret-675175448?ga_submit_new=10%3A1492316427https://nicecrew.tv/static/streaming-playlists/hls/a3c691bf-d145-4362-9753-9003e4946a7a/4a1f8ffd-2037-4eb9-ba45-49122bf37635-master.m3u8https://nicecrew.tv/videos/embed/mdYzRhNWm6hXN49G62iYTU600002024-12-15T02:02:14.088ZCaheretMidi angelcuteanimecolorfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/bQsCACTkPPiUtSA9wxD86xhttps://nicecrew.tv/lazy-static/thumbnails/1b7f4178-e78d-4614-b0a0-463b773e3b35.jpgDrawing: Chubby Dragon girl (NSFW kind of)A cute chubby dragon girl because why not, I basically wanna make another NSFW drawing. And Yeah! Please enjoy and stuff! I fixed the last video since it had copyrighted song. Enjoy~ Finished dragon spell: http://www.pixiv.net/member_illust.php?mode=medium&illust_id=62448095https://nicecrew.tv/static/streaming-playlists/hls/57bf7fde-715c-413f-9d9f-af18ab6971b5/2f62d08c-e888-48b5-ae91-e63209820fe7-master.m3u8https://nicecrew.tv/videos/embed/bQsCACTkPPiUtSA9wxD86x600002024-12-15T02:02:54.112ZblueanimepastelpainttoolsaichubbyYESDreamy's LoungeNOhttps://nicecrew.tv/w/bB4jyKSRYzsZPMCmYkibDhhttps://nicecrew.tv/lazy-static/thumbnails/ec0d3d10-990e-4d65-bd7b-b311a855d4bb.jpgDrawing: Rinda the goatA little old OC redraw, Rinda the demon goat, she was a normal goat before too so...yeah. Please enjoy and stuff! Discord invite: https://discord.gg/aqzV5zg Finished drawing: http://rainbowdoodler209.deviantart.com/art/Rinda-the-goat-675754199?ga_submit_new=10%3A1492568209https://nicecrew.tv/static/streaming-playlists/hls/55e076f1-8c62-4d77-918d-de6828c349b2/793ff4c3-c1d0-4051-9a02-b54ea358b4c3-master.m3u8https://nicecrew.tv/videos/embed/bB4jyKSRYzsZPMCmYkibDh150002024-12-15T01:59:14.134ZRindaGoatcreepyred and blackgreymonochromaticYESDreamy's LoungeNOhttps://nicecrew.tv/w/8dsRKtvZ2MW5WFqEK5KcjBhttps://nicecrew.tv/lazy-static/thumbnails/ace82027-0e82-49e8-b6fb-b34f3a5cf972.jpgDrawing: Old CinnaminA little cute old lady drawing, please enjoy. I'll make more great drawings tomorrow. I might make another chubby dragon girl since you guys seem to like it, so yeah.... Sad old cinnamon: http://rainbowdoodler209.deviantart.com/art/old-Cinnamin-675962507?ga_submit_new=10%3A1492657117https://nicecrew.tv/static/streaming-playlists/hls/3a6d7291-ca43-4667-bacc-d4fbf5116c1b/142e2815-ec6f-4bfb-888b-8957cee84846-master.m3u8https://nicecrew.tv/videos/embed/8dsRKtvZ2MW5WFqEK5KcjB150002024-12-15T01:59:23.891ZOldCinnaminsadfeelsbadmanspeedpaintold ladyYESDreamy's LoungeNOhttps://nicecrew.tv/w/m5NNU5rkkYxCyFyBbD8Mq9https://nicecrew.tv/lazy-static/thumbnails/5ac5042b-faaa-4672-8096-f0d61fd7e3c2.jpgDrawing: Tubby red dragon girl (NSFW kind of..)Another cute chubby tubby dragon girl, please enoy and stuff! Roar: https://www.pixiv.net/member_illust.php?mode=medium&illust_id=62502819https://nicecrew.tv/static/streaming-playlists/hls/a2a29858-1ebc-4a6c-8ec3-5b9d1fff2134/16106a3e-36e1-400d-aba4-cf42973b2a1c-master.m3u8https://nicecrew.tv/videos/embed/m5NNU5rkkYxCyFyBbD8Mq9150002024-12-15T02:00:33.346ZDragon girlNSFW kind ofredpainttoolsaispeedpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/t6Uh86u8BYM3RT16pWjVajhttps://nicecrew.tv/lazy-static/thumbnails/4ddc84c5-3e41-45ff-89ea-ecabb7850079.jpgDrawing: Ema Yuki (yukkuri)A little yukkuri character I wanted to update on, please enjoy and stuff! That's it and all! Nya: http://rainbowdoodler209.deviantart.com/art/Ema-Yuki-676336334?ga_submit_new=10%3A1492829203https://nicecrew.tv/static/streaming-playlists/hls/db79ae1b-f49a-4ef6-8e47-e63e06354060/d8fcb41d-accf-4ade-9e6a-e56cc7818fc0-master.m3u8https://nicecrew.tv/videos/embed/t6Uh86u8BYM3RT16pWjVaj150002024-12-15T02:01:15.649ZYukkuricuteanimebluecatYESDreamy's LoungeNOhttps://nicecrew.tv/w/a62LHaeyuC9S1PAQ4DJm18https://nicecrew.tv/lazy-static/thumbnails/48abc87b-de70-4eb7-9d30-466d5097593c.jpgDrawing: Safina Cinnabon (2017)Another floofy Safina drawing, and I wanted to give her a last name as well! Enjoy~ Nya: http://www.furaffinity.net/view/23299746/https://nicecrew.tv/static/streaming-playlists/hls/49960ee0-dc9b-4bac-9ae9-e95d23ac9d97/a7f57907-ddf2-4d75-a1ac-7deab016414c-master.m3u8https://nicecrew.tv/videos/embed/a62LHaeyuC9S1PAQ4DJm18150002024-12-15T02:01:21.787ZSafinaSafina cinnabon 2017furryanime anthrocuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/o6qz77pNEm6sTdHELoWae5https://nicecrew.tv/lazy-static/thumbnails/0704e8b6-4b78-4354-b556-d5fc4fd5812d.jpgDrawing: Night VeilAnother muslimah girl but wears dark cold colors for the soft evening breeze, please enjoy and stuff! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Night-Veil-676767956?ga_submit_new=10%3A1493004351https://nicecrew.tv/static/streaming-playlists/hls/b2eae962-093d-456b-92d3-546c48569a8a/3ad468de-50b1-4b33-b1b2-486218f2d386-master.m3u8https://nicecrew.tv/videos/embed/o6qz77pNEm6sTdHELoWae5150002024-12-15T02:01:24.985ZAnime muslimahbluedark colorscuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/9tqLWUyHdhVqqpUgdfEEJPhttps://nicecrew.tv/lazy-static/thumbnails/7d24ef03-2f07-4dc3-80ef-1f982280a48b.jpgDrawing: MaolitaANother pastel Lolita, please enjoy ands stuff. nanananananan bat man! Ehh, I dunno... ???: http://rainbowdoodler209.deviantart.com/art/Maolita-677128859?ga_submit_new=10%3A1493174457https://nicecrew.tv/static/streaming-playlists/hls/449d758c-3547-4085-a70f-76814ab5481b/eb7d9487-0f75-4ad9-a4ae-8239f043e256-master.m3u8https://nicecrew.tv/videos/embed/9tqLWUyHdhVqqpUgdfEEJP150002024-12-15T02:02:02.809ZAnimeCute#FixYoutubespeedpaintcolorfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/vBFr2EBM4ucPC8wpm7XS4uhttps://nicecrew.tv/lazy-static/thumbnails/81b7f851-0795-4015-8dfb-3bf5f43e7917.jpgDrawing: Smol SkylarkOne of my angel twin Oc's Skylark Nonnel, He loves his husband Blankie White, and is very kind and caring to him. I hope you guys enjoy and stuff! I'll draw his twin sister tomorrow. Finished precious little shadow: http://rainbowdoodler209.deviantart.com/art/Smol-Skylark-677482100?ga_submit_new=10%3A1493344626https://nicecrew.tv/static/streaming-playlists/hls/efd45a87-b57c-4b88-884c-eb77ca7cbd0a/2b06598a-e6f0-4b05-bc42-d0db0581dfbc-master.m3u8https://nicecrew.tv/videos/embed/vBFr2EBM4ucPC8wpm7XS4u150002024-12-15T02:02:09.958ZSkylark NonnelSpeedpaintcute/creepysmoldarm angelYESDreamy's LoungeNOhttps://nicecrew.tv/w/6792iNhD7wqTAfGhXvPRHahttps://nicecrew.tv/lazy-static/thumbnails/962a8488-c2e4-4c3d-a420-630029c33aaa.jpgClaymonster.movA little animation I made at school this morning, please enjoy! I hope you enjoy it! ^^ I'll upload the thumbnail later...https://nicecrew.tv/static/streaming-playlists/hls/29591998-5b53-4d7b-9af2-b59132aaf0bf/abed2135-4c37-4e27-b23d-482d0b48d3a5-master.m3u8https://nicecrew.tv/videos/embed/6792iNhD7wqTAfGhXvPRHa27002024-12-15T02:01:49.916ZClaycuteanimationschool projectYESDreamy's LoungeNOhttps://nicecrew.tv/w/8zPpBwNSu9Zn1Bmzo5tPzthttps://nicecrew.tv/lazy-static/thumbnails/f12a9c6a-5b7c-4236-a77e-5cbaed9dbfb6.jpgDrawing: FlandreAnother Touhou fan drawing, please enjoy and stuff..... dun dun dun dun, dun, du du du du, do do do do do do do do.... And I finished it off screen as well! Finished Flandre: http://rainbowdoodler209.deviantart.com/art/Flandre-677890961?ga_submit_new=10%3A1493533722https://nicecrew.tv/static/streaming-playlists/hls/3d68bb0f-47d8-4902-ba04-3fb1c95242a9/418140eb-56c0-426b-b0cc-bfd3e66c7397-master.m3u8https://nicecrew.tv/videos/embed/8zPpBwNSu9Zn1Bmzo5tPzt150002024-12-15T02:02:19.360ZFlandretouhoucutespeedpaintPainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/imbFzvFxzkXW6UwLn418VYhttps://nicecrew.tv/lazy-static/thumbnails/a488408d-f11c-4fea-8d11-95da0a223c97.jpgDrawing: Broken BeautyAnother bloody but sad drawing, just wanna spill out my sadness and hopelessness to this drawing this time. Please enjoy.https://nicecrew.tv/static/streaming-playlists/hls/8c7cd0dc-b515-4e24-8c4c-713ce1a7b986/29f25c8a-b18e-4ec3-83e8-dbdffaf8a945-master.m3u8https://nicecrew.tv/videos/embed/imbFzvFxzkXW6UwLn418VY71002024-12-15T02:02:18.870ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/hyNvMPJtmYNQP2ST33ZLz1https://nicecrew.tv/lazy-static/thumbnails/1e17bc4e-fb76-4942-9c31-ff5aedd2a683.jpgDarwing: Grumpy PurpleA little drawing I made on Sunday. Please enjoy and stuff! Mr. Purple: http://rainbowdoodler209.deviantart.com/art/Grumpy-Purple-678428010?ga_submit_new=10%3A1493766076https://nicecrew.tv/static/streaming-playlists/hls/8626af2a-3211-4956-83c5-ed2ab72a64b2/e4f02f33-641f-42f3-889d-fc04b7fa7614-master.m3u8https://nicecrew.tv/videos/embed/hyNvMPJtmYNQP2ST33ZLz1150002024-12-15T02:02:21.944ZmonsterfluffycutepainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/7RV2oA42hZu8QbAtjcxF1ehttps://nicecrew.tv/lazy-static/thumbnails/1c0320b5-e9d4-4592-9ced-505b547dfa18.jpgDrawing: Cute red hijabA cute red hijab on my self character, my new profile picture, pleas enjoy! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Cute-red-hijab-678643744?ga_submit_new=10%3A1493867385https://nicecrew.tv/static/streaming-playlists/hls/378ef430-6931-4f75-a28e-6244986b8411/534322b0-fea0-4c4f-beb5-ac6d11c191aa-master.m3u8https://nicecrew.tv/videos/embed/7RV2oA42hZu8QbAtjcxF1e150002024-12-15T02:02:41.088Zhijab2017 May profile picturecutemuslimahpainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/o2hZvk4G1kkfuV29rxkVDUhttps://nicecrew.tv/lazy-static/thumbnails/9aef5b61-d63e-48d0-b5f2-850d1f582e91.jpgDrawing: Strawberry shortcakeA cute little muslimah has a strawberry shortcake, and that is all I have for the description, enjoy~! Drawing: http://rainbowdoodler209.deviantart.com/art/Strawberry-Shortcake-679015544?ga_submit_new=10%3A1494050099https://nicecrew.tv/static/streaming-playlists/hls/b2574402-434b-43ee-9a7e-76a9151aad12/94354211-7f5f-439e-b149-03b751c559aa-master.m3u8https://nicecrew.tv/videos/embed/o2hZvk4G1kkfuV29rxkVDU150002024-12-15T02:02:51.840ZmuslimahcutepastelpainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/iHHgMAXU7ricAmGJYS8sE8https://nicecrew.tv/lazy-static/thumbnails/34ec19ee-f828-421e-a63d-f7bd9dab0368.jpgUTAU Lucyanna Kimsel: The Soup song (original)Another little utau video, but a song about tomato soup. Please enjoy and stuff! And the audio kindof glitched because of the speed pretty much, please enjoy~ 谢谢 Thumbnail: http://rainbowdoodler209.deviantart.com/art/Soup-Song-679213154?ga_submit_new=10%3A1494136088https://nicecrew.tv/static/streaming-playlists/hls/8f7e4963-5e55-42b0-af08-a3454fabf403/0b569d88-9f53-480c-8fc9-b1e407df53b7-master.m3u8https://nicecrew.tv/videos/embed/iHHgMAXU7ricAmGJYS8sE831002024-12-15T02:02:26.574ZsoupchinesecuteutauYESDreamy's LoungeNOhttps://nicecrew.tv/w/vq8hK8rxdoPgr82SSq89x3https://nicecrew.tv/lazy-static/thumbnails/7f75bb37-69dd-45cd-be03-dc55f46dcd6c.jpgDrawing: RelaxingRemember my little muslimah seld drawing? Why not make another, please enjoy and stuff! If you like, send some requests to the coments below or to my tumblr! Peace to you all and have a great night! Peacefully: http://rainbowdoodler209.deviantart.com/art/Relaxing-679404048?ga_submit_new=10%3A1494212602https://nicecrew.tv/static/streaming-playlists/hls/ee375d09-be84-4939-a449-902421678200/dc63f852-8ece-4c06-82f6-fe44254b6ffe-master.m3u8https://nicecrew.tv/videos/embed/vq8hK8rxdoPgr82SSq89x3150002024-12-15T02:02:59.943ZMuslimahislamicanimepainttoolsaihappyYESDreamy's LoungeNOhttps://nicecrew.tv/w/o81b4JSEfSuZ3yCxAiEvNjhttps://nicecrew.tv/lazy-static/thumbnails/edc6fbc9-e5a1-4b87-b5b3-495c63d44902.jpgDrawing: cyan blueA little drawing for my main tumblr, I hope you enjoy and have peaceful dreams! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Cyan-Blue-679750039?ga_submit_new=10%3A1494381705 Why am I drawing more muslimahs? Why not, (I'm probably gonna name my future files to letters now...)https://nicecrew.tv/static/streaming-playlists/hls/b3235d25-2d9a-4927-9d3a-ed2a32413a92/c9c5b247-e906-4e14-b4d5-902e4758c90c-master.m3u8https://nicecrew.tv/videos/embed/o81b4JSEfSuZ3yCxAiEvNj150002024-12-15T02:03:07.174ZMuslimahcuteanimepainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/8RSoQQaPqaAukSkoP4LESyhttps://nicecrew.tv/lazy-static/thumbnails/33c1260d-fcd3-459e-b208-cc0c7b6b58fd.jpgDrawing: Kiu ruMy new profile picture for my youtube, why not change it. Finished drawing: http://rainbowdoodler209.deviantart.com/art/Kiu-Ru-680107853?ga_submit_new=10%3A1494557342 Hail satan.https://nicecrew.tv/static/streaming-playlists/hls/3fa678bd-f699-4796-9019-81413f265e3c/085d55f9-3e64-425f-8eae-468c1ffa3305-master.m3u8https://nicecrew.tv/videos/embed/8RSoQQaPqaAukSkoP4LESy150002024-12-15T02:03:04.704ZcuteKiu RucolorfulpainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/oy472idA5FDyxtFvXRJw5Mhttps://nicecrew.tv/lazy-static/thumbnails/f84687c7-8430-4272-a06b-e8e4cc789212.jpgDrawing: PtymoyA little demon that's lurking inside me ever since I was born. Enjoy! Hail satan: http://rainbowdoodler209.deviantart.com/art/Pytmoy-680304429?ga_submit_new=10%3A1494653402https://nicecrew.tv/static/streaming-playlists/hls/b6a2c393-3aaa-463d-befa-480836d7030d/265d6ab8-bd9b-4836-bcc4-3a214c493499-master.m3u8https://nicecrew.tv/videos/embed/oy472idA5FDyxtFvXRJw5M150002024-12-15T02:03:14.929ZdemonPytmoycuteanimepainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/hVyZKw89rmcDzBEyYMXER2https://nicecrew.tv/lazy-static/thumbnails/2941a0c8-42dc-47db-84ef-dcc90ed45eba.jpgDrawing: KopiaA cute veilian girl who prays to the gods of limbo, her religion is called "Limboism". I scaled down the drawing so it won't look stretched out. Drawing: http://rainbowdoodler209.deviantart.com/art/Kopia-680504062?ga_submit_new=10%3A1494741613https://nicecrew.tv/static/streaming-playlists/hls/890cf902-2fa3-4716-9737-0b6e645483db/ff446cdb-fb60-47af-9a95-9ac43e22076c-master.m3u8https://nicecrew.tv/videos/embed/hVyZKw89rmcDzBEyYMXER2150002024-12-15T02:03:36.904ZKopiaveiliancutepainttoolsaiLimboismYESDreamy's LoungeNOhttps://nicecrew.tv/w/9ZTB4dHW6Q6FsPgdcxH2hyhttps://nicecrew.tv/lazy-static/thumbnails/3b1c3029-e76d-4fd6-bc9b-93d276e0e599.jpgI talk about: A Beatles floppy disc gameIt was an old game from 1999 game based off the Beatles, where you play as the 4 band members with different powers and abilities. I'm probably gonna make rips based off the game and stuff because why not. Please enjoy this quick talk about video. This was from a dream I recently had, the only song playing in the game was "She loves you"https://nicecrew.tv/static/streaming-playlists/hls/48de4e77-bde8-4919-8035-0c7a4c95039c/2165bc62-ff46-4099-96e1-7c0f415633c9-master.m3u8https://nicecrew.tv/videos/embed/9ZTB4dHW6Q6FsPgdcxH2hy185002024-12-15T02:03:40.803ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/iw6KDYiti8ThTkbpUzvXKVhttps://nicecrew.tv/lazy-static/thumbnails/aaa95797-2c3a-4c62-9cd0-c7a15eae5ef4.jpgJohn. Title screenA track from an unreleased floppy disk by an unknown bootleg company. Enjoy.https://nicecrew.tv/static/streaming-playlists/hls/8ddf372c-c097-4e9d-8904-98c324024887/8c3d5456-4f24-4a27-b8d6-01d222f18a7e-master.m3u8https://nicecrew.tv/videos/embed/iw6KDYiti8ThTkbpUzvXKV88002024-12-15T02:03:10.767ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/tovyeomGwMQSv97xaMwc8qhttps://nicecrew.tv/lazy-static/thumbnails/233cc056-2f55-4db3-8994-d9e9be599f2b.jpgDrawing: Hungry RobotA little robot boy who is pretty polite and mannered, eats his screws and bolts, finishing his plate, please enjoy! finished drawing: http://rainbowdoodler209.deviantart.com/art/Hungry-robot-681203290?ga_submit_new=10%3A1495075532https://nicecrew.tv/static/streaming-playlists/hls/ddcb5234-323b-4968-89a6-829b86e6c41a/ff37c31b-5b93-4740-bd65-d41a876d3f58-master.m3u8https://nicecrew.tv/videos/embed/tovyeomGwMQSv97xaMwc8q600042024-12-15T02:04:48.454Zrobot boycutepastelspeed drawinganimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/9DRiDAoAiVXdXngCEpRv9mhttps://nicecrew.tv/lazy-static/thumbnails/63d582ad-a107-4685-9e91-5b55ed323620.jpgTomatoA little animation thing about a tomato girl, please enjoy!https://nicecrew.tv/static/streaming-playlists/hls/4612037c-04f3-45b3-9234-4f2b15806450/0a63d188-3e7f-4dae-a678-58551b51a7a2-master.m3u8https://nicecrew.tv/videos/embed/9DRiDAoAiVXdXngCEpRv9m5002024-12-15T02:03:25.918ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/3oRTQpwYqudwEJY1s4CoiQhttps://nicecrew.tv/lazy-static/thumbnails/06daab58-bb2d-488e-ab59-611e177365af.jpgColors! 3D: Mint AisaAnother cute Asia drawing, please enjoy and stuff.https://nicecrew.tv/static/streaming-playlists/hls/1363636a-9269-4912-b1d7-47a9ad0f7632/041e807a-afb3-4629-801d-57c5ce14839f-master.m3u8https://nicecrew.tv/videos/embed/3oRTQpwYqudwEJY1s4CoiQ90002024-12-15T02:03:41.833ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/iZ6GJdqxTLXCbB5kqpXZiLhttps://nicecrew.tv/lazy-static/thumbnails/5fb63023-7bc0-4cd3-904f-922c0be9082d.jpg可不 (animation short)A chinese bootleg kirby who gets their own bootleg game.https://nicecrew.tv/static/streaming-playlists/hls/91a44426-daae-4f5c-b257-d0137fb792d2/de97fbd2-06de-4e40-b6ef-fcdbb1fc95d5-master.m3u8https://nicecrew.tv/videos/embed/iZ6GJdqxTLXCbB5kqpXZiL6002024-12-15T02:03:33.584ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/rzpwJzXg8LupU9jx8SxGNGhttps://nicecrew.tv/lazy-static/thumbnails/7eb48262-a923-4e16-b163-7c3d2d048633.jpgDrawing: Inspector LucyLucyanna Kimsel dressed up as Inspector gadget, why did I draw this? Why not, and the fact that I was listening to Inspector gadget rips too. Pleas enjoy and stuff! I'll have this as my new avatar. Go go Lucy: http://rainbowdoodler209.deviantart.com/art/Inspector-Lucy-682502439?ga_submit_new=10%3A1495681283https://nicecrew.tv/static/streaming-playlists/hls/cf1e8300-7c2c-4850-a30d-98ebb601924c/aa380f5f-f458-4d21-aad5-f7049a5bc529-master.m3u8https://nicecrew.tv/videos/embed/rzpwJzXg8LupU9jx8SxGNG150002024-12-15T02:03:59.099ZLucyanna KimselpainttoolsailineartcuteanimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/7QatvwwVESMQjszibgwDEHhttps://nicecrew.tv/lazy-static/thumbnails/34e8d786-9c28-4bf6-bd87-c417d208aa2a.jpgDrawing: Funeral day, BabygirlAnother cute drawing of Babygirl but dressed up for the Tarreon traditional holiday, it happens on every Monday since 1602. Finishe drawing: http://rainbowdoodler209.deviantart.com/art/Funeral-Day-Babygirl-682716210?ga_submit_new=10%3A1495785118https://nicecrew.tv/static/streaming-playlists/hls/37505f25-3236-4238-a9a4-a7d9615ad699/d2c746e8-768e-43af-832a-4ebefcbd1517-master.m3u8https://nicecrew.tv/videos/embed/7QatvwwVESMQjszibgwDEH150002024-12-15T02:04:02.093ZBabygirlcutesadfuneralthemeYESDreamy's LoungeNOhttps://nicecrew.tv/w/vQawczXWn5Nre3bJpCFGcohttps://nicecrew.tv/lazy-static/thumbnails/4c923f84-c1ef-4de3-88e1-8563b1db7529.jpgWoodman 2Another woodman based animation, took me too long to finish it, enjoy everyone!https://nicecrew.tv/static/streaming-playlists/hls/f19296e4-eaf9-4062-a8c4-8bc220454b6c/59867499-cead-4ef8-9b2b-76e9731ac4b8-master.m3u8https://nicecrew.tv/videos/embed/vQawczXWn5Nre3bJpCFGco10002024-12-15T02:03:43.385ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/kkrCoFRb4Fwus5uVjKkukyhttps://nicecrew.tv/lazy-static/thumbnails/ff88e1bd-b160-4a3c-9326-0e04a954319c.jpgPainting: Ice queenPlease enjoy this cute cartoon painting, I'm gonna sleep now.... Finished drawing: http://rainbowdoodler209.deviantart.com/art/Ice-Queen-682889565?ga_submit_new=10%3A1495865105https://nicecrew.tv/static/streaming-playlists/hls/9c948f44-5e62-4e09-b964-46065b194586/69de2107-bcd1-437b-a685-e2c7bc08197f-master.m3u8https://nicecrew.tv/videos/embed/kkrCoFRb4Fwus5uVjKkuky150002024-12-15T02:04:08.999Zice fairycuteanimelolipainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/avtdRX8LSi5MqDL24pYQQmhttps://nicecrew.tv/lazy-static/thumbnails/1a794b24-a588-45cb-90c7-8de9e6749ce6.jpgDrawing: Banana-SamaA cute banana girl drawing, because I love eating bananas so much, and sipping chocolate milk with it. Banananannananana: http://rainbowdoodler209.deviantart.com/art/Banana-Sama-683070673?ga_submit_new=10%3A1495947222https://nicecrew.tv/static/streaming-playlists/hls/4cff97e0-4e61-4f51-9327-73d1d389d504/73f075c6-23a9-4a7a-b2bf-f631fee12ec6-master.m3u8https://nicecrew.tv/videos/embed/avtdRX8LSi5MqDL24pYQQm150002024-12-15T02:04:04.062Zbanana-samacutepainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/2UuK9fwteakrafTfgWZyNGhttps://nicecrew.tv/lazy-static/thumbnails/439f6ace-48b2-408f-9ea3-433d3387594d.jpgTermites and maggotsA quick animation, 5 seconds.......see you guys tomorrow night...gonna be bust at a marching band tomorrow.https://nicecrew.tv/static/streaming-playlists/hls/0f6d8759-ea97-4395-a43a-416975b29abc/79c89845-0a65-4434-849a-c8be0f0bd36d-master.m3u8https://nicecrew.tv/videos/embed/2UuK9fwteakrafTfgWZyNG5002024-12-15T02:03:52.110ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/mvLt3aUWU7Xh8arWZR38j7https://nicecrew.tv/lazy-static/thumbnails/c7d440db-bc2a-4e15-9298-4b3eff83a703.jpgColors 3D: Poofy girlA cute little redesign of an old manderin character I've made, so I made a new version of her. Please enjoy! :) The drawing is already published. This drawing took me 40+ minutes to make as well.https://nicecrew.tv/static/streaming-playlists/hls/a61ebeeb-2f1a-4a0e-845f-87acbff15416/4dbbad4c-ff8a-4986-834f-c89a874ccc0b-master.m3u8https://nicecrew.tv/videos/embed/mvLt3aUWU7Xh8arWZR38j7106002024-12-15T02:04:13.226ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/1cHmHTANLyJgrtc2mz3Lknhttps://nicecrew.tv/lazy-static/thumbnails/c13eab68-3605-4796-8c5e-0ad69ff97d33.jpgDrawing: Two VeiliansJamna and Maleka has converted to Limbism because they changed minds on their current religion. Please enjoy! Limboism loves all: http://rainbowdoodler209.deviantart.com/art/Two-Veilians-683825122?ga_submit_new=10%3A1496287111https://nicecrew.tv/static/streaming-playlists/hls/01a2ab36-6ed8-43de-b522-8c4379a54533/902eeb5a-3c20-4381-8e6a-f32ed5d22e7e-master.m3u8https://nicecrew.tv/videos/embed/1cHmHTANLyJgrtc2mz3Lkn150002024-12-15T02:04:13.336ZLimboismJamnaMalekacutehappyYESDreamy's LoungeNOhttps://nicecrew.tv/w/pKPHFnZatkxG8ZXdfWtkw6https://nicecrew.tv/lazy-static/thumbnails/407ad5ec-2a01-4563-8ef6-2e8614675f99.jpgA normal songA normal songhttps://nicecrew.tv/static/streaming-playlists/hls/c0609434-53d3-4159-b0a2-5fc1f675b655/e8ee43a2-c66c-4583-86d9-5d1228824615-master.m3u8https://nicecrew.tv/videos/embed/pKPHFnZatkxG8ZXdfWtkw6230002024-12-15T02:04:04.217ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/spPxXfBYb9oAgA9PsicHDwhttps://nicecrew.tv/lazy-static/thumbnails/2c5d9b22-afe2-4250-b7fb-7d2dabc7948d.jpgDrawing: Clover girlwas a bit bummed out, but oh well. I wanted to draw a cute clover girl to cheer me up. Enjoy! Finished: http://rainbowdoodler209.deviantart.com/art/Clover-girl-684215554?ga_submit_new=10%3A1496467981https://nicecrew.tv/static/streaming-playlists/hls/d5e10422-e645-4ac9-a2fd-06b968582d0c/6de781a5-f349-4e93-85bc-3d19e683c9fe-master.m3u8https://nicecrew.tv/videos/embed/spPxXfBYb9oAgA9PsicHDw150002024-12-15T02:04:17.463Zredheadcuteanime4chancloverYESDreamy's LoungeNOhttps://nicecrew.tv/w/baSWG8fxZdQFpTdoCd78EQhttps://nicecrew.tv/lazy-static/thumbnails/69733a49-420e-4d2c-a9dd-328b7dc8099e.jpgDrawing: Choco and strawberryAnother cute self drawing, but with some pastel dye added in, please enjoy, I finished the drawing off camera too. Goodnight! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Choco-and-Strawberry-684600424?ga_submit_new=10%3A1496633154https://nicecrew.tv/static/streaming-playlists/hls/525c79a9-b655-4a77-a4a4-e29a2f9cd578/0b3a7164-9e7a-4b72-8b72-942c854977fe-master.m3u8https://nicecrew.tv/videos/embed/baSWG8fxZdQFpTdoCd78EQ150002024-12-15T02:04:42.438ZCuteSelf drawinganimepainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/sx5MJTW7MnuZmpYMwcsUhchttps://nicecrew.tv/lazy-static/thumbnails/26d6f51d-8ee4-4e00-8c42-2c1ec8f74e68.jpgDrawing: Raggy Moncha (2017)I wanted to draw Raggy again, that is all honestly! :) Enjoy! Raggy Moncha: http://rainbowdoodler209.deviantart.com/art/Raggy-Moncha-2017-684991347?ga_submit_new=10%3A1496804777https://nicecrew.tv/static/streaming-playlists/hls/d6e49cf5-45c1-40a2-91e3-69990a10a7bb/19e43ea3-e453-4871-b4f7-3cc07e5b77af-master.m3u8https://nicecrew.tv/videos/embed/sx5MJTW7MnuZmpYMwcsUhc150002024-12-15T02:04:22.741ZRaggy MonchabluemonstercutesharknoseYESDreamy's LoungeNOhttps://nicecrew.tv/w/kZTj79BWKSaHAxh6rukHqGhttps://nicecrew.tv/lazy-static/thumbnails/c2c2de5a-a5e8-4289-849c-daa1de7c95d7.jpgDrawing: nom nomAnother little guro drawing, please enjoy! Finished snack: http://rainbowdoodler209.deviantart.com/art/nom-nom-685389513?ga_submit_new=10%3A1496987663https://nicecrew.tv/static/streaming-playlists/hls/a1f2a6d4-7b34-4ee2-a0d8-4ed2b102a1f4/97d26f75-a7b2-4f05-a255-1a9c60d8f622-master.m3u8https://nicecrew.tv/videos/embed/kZTj79BWKSaHAxh6rukHqG150002024-12-15T02:04:52.099ZguropastelYESDreamy's LoungeNOhttps://nicecrew.tv/w/sxPaH6Wyvdm9FAvEZSPuophttps://nicecrew.tv/lazy-static/thumbnails/c209edf0-8fea-4974-8d97-46a1cd94cc8e.jpgNormal song 2Another series of songs and references.https://nicecrew.tv/static/streaming-playlists/hls/d6febadf-1ef9-44e8-a1de-00640551361b/2c70e5e7-0295-4271-8e21-04f987661184-master.m3u8https://nicecrew.tv/videos/embed/sxPaH6Wyvdm9FAvEZSPuop175002024-12-15T02:04:40.854ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/x6rybuxwUzjuzRVoL3QvFPhttps://nicecrew.tv/lazy-static/thumbnails/57f92752-3014-4ca9-8aaa-036e445a7a44.jpgDrawing: GorificMeh, just gonna upload this here. Please enjoy and stuff. Finished gore: http://rainbowdoodler209.deviantart.com/art/Gorific-685789786?ga_submit_new=10%3A1497171970https://nicecrew.tv/static/streaming-playlists/hls/fbcdc41b-47fb-415b-afec-07fdce077039/d77f3a70-98c5-4d7b-82b6-96189baba5a2-master.m3u8https://nicecrew.tv/videos/embed/x6rybuxwUzjuzRVoL3QvFP150002024-12-15T02:04:59.511ZgurocreepypaintoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/k73qyWEpXm18s2sTrmKErWhttps://nicecrew.tv/lazy-static/thumbnails/72fcc336-d94a-488d-9ab0-3334bd98c010.jpgDrawing: The beastThe beast has only one song, 8-bit beast haunted house. Please enjoy! Finished beast: http://rainbowdoodler209.deviantart.com/art/The-beast-685967384?ga_submit_new=10%3A1497241888https://nicecrew.tv/static/streaming-playlists/hls/9ab5973b-3bbb-42fa-92d1-929245aa9090/18ed88d4-9420-470a-842e-3f74ed1b4715-master.m3u8https://nicecrew.tv/videos/embed/k73qyWEpXm18s2sTrmKErW150002024-12-15T02:04:56.828Z8-bit beastmonstercutedarkpainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/wnDpH32wPsVByK9Qs8uH4bhttps://nicecrew.tv/lazy-static/thumbnails/1a4060ba-4737-483d-987e-f539b32ff3e7.jpgDrawing: Scared Wq-1Wq-1 is basically a bootleg trying to look like Aisa, and that is it. A try hard bootleg cartoon trying to look like someone else, sounds familiar. Finished drawing: http://rainbowdoodler209.deviantart.com/art/Scared-Wq-1-686425135?ga_submit_new=10%3A1497480167https://nicecrew.tv/static/streaming-playlists/hls/f5f7d53a-f6d1-4dc0-9a82-2f34821b248c/88b1029f-fe59-44d9-a0b2-8477bb107132-master.m3u8https://nicecrew.tv/videos/embed/wnDpH32wPsVByK9Qs8uH4b150002024-12-15T02:05:03.111ZWq-1pastelcutefearstartledYESDreamy's LoungeNOhttps://nicecrew.tv/w/foUf1aEwxrpxXt8rd5YgrHhttps://nicecrew.tv/lazy-static/thumbnails/86d8bcb9-bfbd-4ab5-b7ca-0b77d9d8f440.jpgMini animationsAnother animation but cut in half.https://nicecrew.tv/static/streaming-playlists/hls/74927fc5-4c3e-4dbf-b061-da42d8dc362f/dde18f8c-cded-412d-8145-436c544430b5-master.m3u8https://nicecrew.tv/videos/embed/foUf1aEwxrpxXt8rd5YgrH6002024-12-15T02:04:54.955ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/18eaDRK4Ab54Wdg7Kwk73Ghttps://nicecrew.tv/lazy-static/thumbnails/1af23f6c-73b9-4d35-be3a-0bc9bcbfe515.jpgDrawing: Pastel wizardI'm gonna draw wizards from now and ever. That doesn't really soubd right, well. Anyways! Please enjoy! Finished: http://rainbowdoodler209.deviantart.com/art/Pastel-wizard-686948634?ga_submit_new=10%3A1497683176https://nicecrew.tv/static/streaming-playlists/hls/0102520b-8783-4c98-906e-94de6ed2012c/4e4b3c1c-6eda-475f-9c23-26ea73be4ea0-master.m3u8https://nicecrew.tv/videos/embed/18eaDRK4Ab54Wdg7Kwk73G150002024-12-15T02:05:05.269Zwizardwizzawoopastel2017cuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/5i6v2oRQqS3CeP8sU3ETzchttps://nicecrew.tv/lazy-static/thumbnails/f9c377fa-c5e3-43a4-a2fe-fe728d5a1754.jpgDrawing: Sweet BunnyWhy are my OC's so fun to draw? Anyways, I wanted to draw my new recent fursona who is a bunny, mainly based off my Chinese zodiac. Please enjoy the video. and I'll sleep now. Finished drawing: http://rainbowdoodler209.deviantart.com/art/Sweet-bunny-687160670?ga_submit_new=10%3A1497779475https://nicecrew.tv/static/streaming-playlists/hls/22c796a6-ad35-469c-92ed-d93b29265341/5ff98e6e-b8b9-4e21-9ea3-b9f5849784f7-master.m3u8https://nicecrew.tv/videos/embed/5i6v2oRQqS3CeP8sU3ETzc150002024-12-15T02:05:12.740ZMiliYubunnyanime anthrospeedpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/uvHtosNgiEEdRAT63SVxmMhttps://nicecrew.tv/lazy-static/thumbnails/2af2d6c0-a36a-4fc6-938d-279d058da925.jpgDrawing: Lavender NunWanted to draw another nun, please enjoy and stuff. Ya miss me? Finished drawing: http://rainbowdoodler209.deviantart.com/art/Lavender-nun-688372198?ga_submit_new=10%3A1498298201https://nicecrew.tv/static/streaming-playlists/hls/e6e6028c-94d6-462d-a73a-dbc539b77179/ea6ec030-3ef9-4647-a866-3801f8103c65-master.m3u8https://nicecrew.tv/videos/embed/uvHtosNgiEEdRAT63SVxmM600002024-12-15T02:06:09.318ZnunchristianpainttoolgloomyYESDreamy's LoungeNOhttps://nicecrew.tv/w/q2mffaZrgyDUc8dsQAopNshttps://nicecrew.tv/lazy-static/thumbnails/dbd6bac1-105a-4ec4-b533-d1ea28a86d20.jpgDrawing: Akilah EidaWanted to give this oc a name. (I make too many Ocs) and wanted to make her join limboism, its a religion about true kindness and individuality to their believers. Please enjoy and stuff. Finished drawing: http://rainbowdoodler209.deviantart.com/art/Akilah-Eida-688527211?ga_submit_new=10%3A1498361421https://nicecrew.tv/static/streaming-playlists/hls/c28b8c63-e4d0-4686-b012-92afe7637fd2/ddff07bd-9b65-4718-91f3-c850c5744811-master.m3u8https://nicecrew.tv/videos/embed/q2mffaZrgyDUc8dsQAopNs150002024-12-15T02:05:14.373ZlimboistcutepainttoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/uPy88Ao2rLUxaM4Pn4Tpfvhttps://nicecrew.tv/lazy-static/thumbnails/09820110-533f-4a5d-bbc8-997537e96c06.jpg7 sirensAnother song basically about grandad, but something is wrong....https://nicecrew.tv/static/streaming-playlists/hls/e963a2da-0128-486b-8d2e-75104d7dad0d/ca60d737-04f0-4658-8bb1-70d735941477-master.m3u8https://nicecrew.tv/videos/embed/uPy88Ao2rLUxaM4Pn4Tpfv158002024-12-15T02:05:11.072ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/wZVUCyVjomXr9i8PzxwWG2https://nicecrew.tv/lazy-static/thumbnails/bf45aa3c-497a-48a5-8f5d-496d2db14f29.jpgDrawing: Cute_Space bannerA drawing for my new subreddit, Cute_Space. Please enjoy! Link: https://www.reddit.com/r/Rainbowdoodler209/https://nicecrew.tv/static/streaming-playlists/hls/fb08c6bc-d517-411b-9973-843346a3ca29/eac9fd0e-a3e5-455c-835b-11c405a98a48-master.m3u8https://nicecrew.tv/videos/embed/wZVUCyVjomXr9i8PzxwWG2150002024-12-15T02:05:32.527ZredditspeedpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/6HJM7QeHSAqrTdvmEKxaCmhttps://nicecrew.tv/lazy-static/thumbnails/68bfbe2d-f2ed-431d-b208-5024b659eff3.jpgDrawing: MM2cloudI couldn't resist making an mm2wood reference. Another avatar request by my lovely subscribers. Today is my birthday as well. Finished cloud: http://rainbowdoodler209.deviantart.com/art/Mm2cloud-690890530?ga_submit_new=10%3A1499374514https://nicecrew.tv/static/streaming-playlists/hls/2e518cf9-919a-4721-847a-18cb7992dc48/f447551c-3d64-4a79-b34c-6991d491d987-master.m3u8https://nicecrew.tv/videos/embed/6HJM7QeHSAqrTdvmEKxaCm150012024-12-15T02:05:23.232Zmm2cloudpainttoolsaicutepoofyrequestYESDreamy's LoungeNOhttps://nicecrew.tv/w/9iEJFQT85soqAg4zFE2YaXhttps://nicecrew.tv/lazy-static/thumbnails/723fa8d8-595e-4cd8-90ca-798dccf9a667.jpgDrawing: Bacteria-chan (One layer)A little one layer challenge thingy, probably my last windows drawing video pretty much. Enjoy! I'll surprise you in the next video. ;) Finished drawing: http://rainbowdoodler209.deviantart.com/art/Bacteria-chan-690987164https://nicecrew.tv/static/streaming-playlists/hls/4340a011-7d83-42aa-9b79-1f9dd44578c9/b87f07b5-ba18-436e-84a3-7cd1e2f7e484-master.m3u8https://nicecrew.tv/videos/embed/9iEJFQT85soqAg4zFE2YaX150002024-12-15T02:05:42.113ZOne layercuteanimepaintoolsaiYESDreamy's LoungeNOhttps://nicecrew.tv/w/gVWBEWU4f6MgLkiffDJJiShttps://nicecrew.tv/lazy-static/thumbnails/3f748192-ab77-4fc8-a5c3-5a5dbaf36060.jpgDrawing Dream catAnother little photoshop drawing, and please enjoy and stuff! Finished drawing: http://www.furaffinity.net/view/24079861/https://nicecrew.tv/static/streaming-playlists/hls/8101284c-5e99-4399-bfab-0777573af194/7e80e5dc-e7f9-4e24-a819-c12f938f0a49-master.m3u8https://nicecrew.tv/videos/embed/gVWBEWU4f6MgLkiffDJJiS1993002024-12-15T02:06:41.565ZcutephotoshopspeedpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/6krotmaLhRWQyMiHeHcATRhttps://nicecrew.tv/lazy-static/thumbnails/eff1b13f-98cc-4f5d-bd13-02b657f32e16.jpgFishAnother little flash animation short. Please enjoy and stuff!https://nicecrew.tv/static/streaming-playlists/hls/2b347872-6755-4314-b6ca-66735d81baaf/eaa7bf7f-7bdb-44df-848c-934196c8711d-master.m3u8https://nicecrew.tv/videos/embed/6krotmaLhRWQyMiHeHcATR4002024-12-15T02:05:31.040Zflash animationoriginalshortYESDreamy's LoungeNOhttps://nicecrew.tv/w/mpecJ7t4LgSDqaRf7xPntZhttps://nicecrew.tv/lazy-static/thumbnails/31c7b5e0-4204-43ca-974a-fe23bb2bbf8d.jpgDrawing: RainbowGunnerA new avatar, but inspired by SiivaGunner. Please enjoy and stuff! Finished drawing: http://rainbowdoodler209.deviantart.com/art/RainbowGunner-691571290?ga_submit_new=10%3A1499655873 Please read the description.https://nicecrew.tv/static/streaming-playlists/hls/a535041b-1538-42af-9d5e-1880a6ad4553/350ff792-6ab2-4c97-bca0-1812ea0251b8-master.m3u8https://nicecrew.tv/videos/embed/mpecJ7t4LgSDqaRf7xPntZ481002024-12-15T02:05:50.316ZSiivagunnerRainbowGunnerspeedpaintphotoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/v7PxSXEKHVvfWLKtv1xf1jhttps://nicecrew.tv/lazy-static/thumbnails/63fd9b67-2d4c-4b86-8946-f2ef9d68e3e6.jpgDrawing: Amura the LolitaA little DA request, please enjoy this cute little drawing, and that is all. Amura is kind of cute! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Amura-the-lolita-691789680?ga_submit_new=10%3A1499745236https://nicecrew.tv/static/streaming-playlists/hls/ebccc989-f2a3-42aa-a318-15b3fd305a42/aba6ee21-4b61-430c-9b1f-72c8a3fc490e-master.m3u8https://nicecrew.tv/videos/embed/v7PxSXEKHVvfWLKtv1xf1j553002024-12-15T02:06:02.927ZphotoshopCCcuterequestYESDreamy's LoungeNOhttps://nicecrew.tv/w/8XV33xCLZ3K3DVE4SwzG66https://nicecrew.tv/lazy-static/thumbnails/40a83e30-3525-450c-bb92-c3c5d131cc9e.jpgHaunted 7 Bus StopA song about grandad and a gargoyle standing at 7 bus stop.https://nicecrew.tv/static/streaming-playlists/hls/407e8fe5-9f1d-4a85-a776-57f9a04b87cf/57b513ed-6056-41da-b569-c1c07517a63e-master.m3u8https://nicecrew.tv/videos/embed/8XV33xCLZ3K3DVE4SwzG66158002024-12-15T02:05:47.201ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/dh29aY8dSzjqWCuQsbjXyLhttps://nicecrew.tv/lazy-static/thumbnails/948fd060-42be-45a0-b9c3-b39328f09c2b.jpgDrawing Orange And LimeAnother slime drawing, but with two slimes. That's it really. Finished drawing: http://rainbowdoodler209.deviantart.com/art/Lime-Slime-and-Orange-slime-692218561?ga_submit_new=10%3A1499924092https://nicecrew.tv/static/streaming-playlists/hls/636a4470-72b8-47ea-8bc3-dca8e3add7d8/2d7068d9-acdc-4ce8-9096-98498c26b0b0-master.m3u8https://nicecrew.tv/videos/embed/dh29aY8dSzjqWCuQsbjXyL338002024-12-15T02:05:56.642ZSlime girlscutespeedpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/fsHZDnXrXk3ZeAPGBe51YWhttps://nicecrew.tv/lazy-static/thumbnails/7303b092-e729-4723-8f51-c06653d8e91c.jpgDrawing: The dimension fairyA cute fairy named Cevin that controls time and space, if you defeat her, detentions will be mixed up or corrupted. Finished drawing: http://rainbowdoodler209.deviantart.com/art/The-dimension-Fairy-692449966?ga_submit_new=10%3A1500025069https://nicecrew.tv/static/streaming-playlists/hls/751b28ad-c8a1-420b-8a92-e8a3e53413b6/0ca7034b-e681-4fa0-ba49-100c6378178b-master.m3u8https://nicecrew.tv/videos/embed/fsHZDnXrXk3ZeAPGBe51YW396002024-12-15T02:06:04.414Zadobe flash drawingcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/45vXCmAoXAvvoZF9HwZPTbhttps://nicecrew.tv/lazy-static/thumbnails/23c49346-67d5-4cb4-879c-d9cbbc3605c7.jpgDrawing: Little gothA little gothic lolita, I pretty much wanted to draw Gothika in a black dress. and wanted to chang her hair do as well, please enjoy! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Little-Goth-693439712?ga_submit_new=10%3A1500442588https://nicecrew.tv/static/streaming-playlists/hls/18ecda9f-cc81-4790-a2b4-352f0e20a31c/b55e486b-9996-461b-a2b6-3389d57ed24b-master.m3u8https://nicecrew.tv/videos/embed/45vXCmAoXAvvoZF9HwZPTb827002024-12-15T02:06:42.440ZGothikacutelolitaphotoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/p79Uvzg644EcJWAZ61TKWYhttps://nicecrew.tv/lazy-static/thumbnails/e6017009-bbc2-4bd0-8b38-17b6d9a77890.jpgMade a FacebookI made a Facebook today, *Looks regretful* Please enjoy the video and stuff. And I made a soundcloud as well for my garageband rips. Facebook: https://www.facebook.com/arlayna.sykes.3https://nicecrew.tv/static/streaming-playlists/hls/bb1e23d1-4ad5-4a52-8690-b851b38b12d8/1a3ef52b-19b9-465a-bb68-143b4683ea70-master.m3u8https://nicecrew.tv/videos/embed/p79Uvzg644EcJWAZ61TKWY214002024-12-15T02:05:59.330ZspeedpaintcutefacebookYESDreamy's LoungeNOhttps://nicecrew.tv/w/x9pKyQqYhesGJgfSgcGQEYhttps://nicecrew.tv/lazy-static/thumbnails/3a08345d-b2dc-4f5a-940f-abdd260cbefc.jpgContent Aware scale| Christ Loli (Shitpost)I wanted to try out content aware scale on my drawings. I just wanted to make a different type of photoshop related video, so yeah. Please enjoy and stuff!https://nicecrew.tv/static/streaming-playlists/hls/fc37e2c2-7677-463b-a0ab-37eb674ce864/54a87481-0993-4240-ab24-3e094101a2fe-master.m3u8https://nicecrew.tv/videos/embed/x9pKyQqYhesGJgfSgcGQEY75002024-12-15T02:06:06.144ZContent aware scalephotoshopshitpostYESDreamy's LoungeNOhttps://nicecrew.tv/w/fMqbJNPcHBzK8k7Fu8B2Gjhttps://nicecrew.tv/lazy-static/thumbnails/e62eb7c0-fd8b-4997-ae1c-9b52cb6d548c.jpgDrawing: Christ chanA request by my pixiv followers I've been talking to on Facebook, so please enjoy this little drawing of Christ-chan! Deus Vult: http://rainbowdoodler209.deviantart.com/art/Christ-Chan-694817602?ga_submit_new=10%3A1501032197https://nicecrew.tv/static/streaming-playlists/hls/77b750c5-5828-406e-9718-11121326c26e/58f5e18f-56c8-4596-a77c-958c04f91de1-master.m3u8https://nicecrew.tv/videos/embed/fMqbJNPcHBzK8k7Fu8B2Gj488002024-12-15T02:06:20.913Zchrist-chan4chan/pol/speedpaintphotoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/4ERdLqyuQh2EJKX9TibYZWhttps://nicecrew.tv/lazy-static/thumbnails/12547596-08c4-447f-92f3-b670f0836219.jpgmasked monstersAnother little animation I made for fun, please enjoy and stuff!https://nicecrew.tv/static/streaming-playlists/hls/1db8031f-e875-43d7-b7a6-f5b447e64200/9d6f02d7-f509-4995-8659-3dccd25e7592-master.m3u8https://nicecrew.tv/videos/embed/4ERdLqyuQh2EJKX9TibYZW4002024-12-15T02:06:05.022ZFlash animationscutemonstersYESDreamy's LoungeNOhttps://nicecrew.tv/w/9FBHNnzd1FSm4YFgDm61R1https://nicecrew.tv/lazy-static/thumbnails/1aa7faf9-b167-4eef-abf0-4dee9409762e.jpgDrawing Seaweed girlJust wanted to make a little seaweed girl, please enjoy and stuff. Wanted to also paint over the lines kind of. I hope you guys enjoy! Finished Drawing: http://rainbowdoodler209.deviantart.com/art/Seaweed-girl-696699665?ga_submit_new=10%3A1501826995https://nicecrew.tv/static/streaming-playlists/hls/46512145-2f4d-4e76-9e0c-9d2d510ea082/953d08fb-1207-4563-99b9-3904bfc28985-master.m3u8https://nicecrew.tv/videos/embed/9FBHNnzd1FSm4YFgDm61R1650002024-12-15T02:06:35.465ZsurrealanimeZeinocutestrangeYESDreamy's LoungeNOhttps://nicecrew.tv/w/o9knLzTCiuRsdyFEUyNi8nhttps://nicecrew.tv/lazy-static/thumbnails/0ed5c64e-c870-4c06-a16c-6cc639a09abe.jpgDrawing: CazuluA little anime girl drawing, please enjoy and I'll try to grow up as a person and stop being cringe. Finished drawing...:https://nicecrew.tv/static/streaming-playlists/hls/b352f0ee-f86b-42a9-a060-2674ab1009bf/535ac686-902b-444d-a49e-9497cbd59f1e-master.m3u8https://nicecrew.tv/videos/embed/o9knLzTCiuRsdyFEUyNi8n241002024-12-15T02:06:12.406ZCazulucutecthuluspeedpaintmonochromeYESDreamy's LoungeNOhttps://nicecrew.tv/w/iE7x9TavjFHArtg19GBz1Mhttps://nicecrew.tv/lazy-static/thumbnails/ca775e3e-d6cc-48df-ae77-bf4c3c22355b.jpgDrawing RunilaA little drawing of Runila who used to be a bassoon, and that's it. Just wanted to draw him to you! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Runila-697696887?ga_submit_new=10%3A1502251656https://nicecrew.tv/static/streaming-playlists/hls/8efda62d-0f6f-44e5-af25-0d00fa3c1f49/211d8115-e558-4f5c-af95-76eabf0c1fae-master.m3u8https://nicecrew.tv/videos/embed/iE7x9TavjFHArtg19GBz1M403002024-12-15T02:06:24.772ZcuteRunila_BassoonspeedpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/cwhPKyDMymvRBop3zb1fv1https://nicecrew.tv/lazy-static/thumbnails/6b30e33c-d540-4af0-99d9-e5cba28d0f47.jpgDrawing Money ChanA drawing about capitalism, I already did an anime girl drawing about communism, don't know what else to draw about for tomorrow, but I'll at least have a great idea for a new drawing! Please enjoy this video! Finished drawing: http://rainbowdoodler209.deviantart.com/art/Money-Chan-697904885?ga_submit_new=10%3A1502338761https://nicecrew.tv/static/streaming-playlists/hls/5d4f34c1-e3e9-4a12-84ad-6f08203678ca/01b6436d-1912-49b1-bbb4-4eba3e48838b-master.m3u8https://nicecrew.tv/videos/embed/cwhPKyDMymvRBop3zb1fv1430002024-12-15T02:06:33.122ZcutecapitalismgreenMoney-chananimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/idgFNjRMbqbuUtrE5Bsiqohttps://nicecrew.tv/lazy-static/thumbnails/4fb9160a-7b64-4f69-8ca5-2096b7fe00a5.jpgContent Aware Scale JiaoshiI'm guessing I'm getting dislikes on some videos because maybe people want something different? I will probably make more original drawings too. I'm sorry if some you don't like my videos. It's okay if you don't like them.https://nicecrew.tv/static/streaming-playlists/hls/8b61f30c-d564-4e3e-834c-e225100de3aa/892a0599-65e8-4c9e-aa91-558983f0745d-master.m3u8https://nicecrew.tv/videos/embed/idgFNjRMbqbuUtrE5Bsiqo75002024-12-15T02:06:25.108ZContent aware scaleYESDreamy's LoungeNOhttps://nicecrew.tv/w/kFm1upZ47rguCiUwjEu2cPhttps://nicecrew.tv/lazy-static/thumbnails/b4a4232c-671a-4317-a956-1b5359bdcadd.jpgDrawing: Plain jewJust wanted to draw a jewish girl, I was gonna record on my 3ds but I changed my mind, so please enjoy the video and I'll stop complaining. Finished drawing: http://rainbowdoodler209.deviantart.com/art/Plain-jew-698293907?ga_submit_new=10%3A1502511323 I also fixed up the drawing too. A jewish character named Leela, likes to make drawings to people and entertain the crowd with dancing and music. And that's her story.https://nicecrew.tv/static/streaming-playlists/hls/9f5bf8e2-f2ea-4f1e-9b5b-a3d8f513b051/38bd5deb-711f-4ac5-8979-5f6e0a26169b-master.m3u8https://nicecrew.tv/videos/embed/kFm1upZ47rguCiUwjEu2cP324002024-12-15T02:06:43.676Zjewish girlspeedpaintArt block?YESDreamy's LoungeNOhttps://nicecrew.tv/w/qnpEi36Et53QxiAt2C8B3thttps://nicecrew.tv/lazy-static/thumbnails/92c50cbc-790f-4e7f-ab31-b67f8ded7d05.jpgDrawing 领养Another cute character I created, I'll be making doodles on my twitter. Please enjoy and stuff! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Liang-Yang-698693114?ga_submit_new=10%3A1502687454https://nicecrew.tv/static/streaming-playlists/hls/c5588734-c038-4e37-ab4d-2381e7418433/a053533a-265d-4f3b-bbf3-e0aecf50181b-master.m3u8https://nicecrew.tv/videos/embed/qnpEi36Et53QxiAt2C8B3t518002024-12-15T02:06:46.116ZcutespeedpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/dRW4KppCsKpjaKSzxZGYaehttps://nicecrew.tv/lazy-static/thumbnails/e5ebb13b-9108-42e2-9feb-6c0eb969c95d.jpgDrawing Nice DressAnother girl portrait, don't be shocked if I make more drawing/Painting videos more than I used too. Please enjoy! Dress: https://rainbowdoodler209.deviantart.com/art/Nice-Dress-698991627?ga_submit_new=10%3A1502825619https://nicecrew.tv/static/streaming-playlists/hls/68266d5a-57d5-40cf-836d-92dea3f51f67/8b53e66b-0a74-4eae-af17-273e24ab6a15-master.m3u8https://nicecrew.tv/videos/embed/dRW4KppCsKpjaKSzxZGYae504002024-12-15T02:06:58.345Zblack girlanimecutephotoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/rVtzqzrmANhXxeBEe8KqW1https://nicecrew.tv/lazy-static/thumbnails/164ef285-90f0-4c23-97e9-f69744ed4b33.jpgDrawing Rosey NunMy new avatar for Blogger, just wanted to draw another nun but me as one, I just enjoy drawing nuns to be honest, and muslimahs, but I'll draw mostly christian stuff from now on and some surreal artwork. Enjoy the video guys! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Rose-Nun-699007738?ga_submit_new=10%3A1502830743https://nicecrew.tv/static/streaming-playlists/hls/d1ebe17b-7ff0-407d-ab52-687209f90ce4/7e0d7044-4074-4406-8501-efc4aabe5a60-master.m3u8https://nicecrew.tv/videos/embed/rVtzqzrmANhXxeBEe8KqW1446002024-12-15T02:06:50.745ZnunspeedpaintcutepinkphotoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/tJLa9ZEwHcVZyBf9CHJdk1https://nicecrew.tv/lazy-static/thumbnails/8745a436-9c32-4ea4-8f96-2fced32c4379.jpgDoodling: Sword nunJust a little doodle of a sword nun, the sword is her hood piece. Pleas enjoy and stuff. I'll send the drawing link in the morning.https://nicecrew.tv/static/streaming-playlists/hls/e09f3205-af75-4ef6-a0e1-57e9bc59529e/c588e8a9-4c4a-4115-971b-ef2e8f5863b5-master.m3u8https://nicecrew.tv/videos/embed/tJLa9ZEwHcVZyBf9CHJdk1644002024-12-15T02:07:33.807Znunanime girlloliYESDreamy's LoungeNOhttps://nicecrew.tv/w/a9Yi4amFtZAYdyiTKpk3ZZhttps://nicecrew.tv/lazy-static/thumbnails/722822ce-6f8f-4c57-8760-46d507e78a61.jpgMarching nuns.flAnother animation, hope you all enjoy!https://nicecrew.tv/static/streaming-playlists/hls/4a22e3fa-3608-484e-be14-549e779f6ff3/69bee8e7-d189-4ceb-b9b9-78540cac0c36-master.m3u8https://nicecrew.tv/videos/embed/a9Yi4amFtZAYdyiTKpk3ZZ8002024-12-15T02:06:36.898Znunsflash animationYESDreamy's LoungeNOhttps://nicecrew.tv/w/b2hJXX3yScKkqdgkp5mNLzhttps://nicecrew.tv/lazy-static/thumbnails/cd055cfa-ce6a-4eaa-b2c6-0419ec95b466.jpgDrawing Ricky TommyJust wanted to draw a boy with long hair. Just wanted to draw a teenage boy really. I have fun drawing girls too. That's it tbh. I love you all! Finished pretty boy: https://rainbowdoodler209.deviantart.com/art/Ricky-Tommy-699648811?ga_submit_new=10%3A1503115148 I also have a blogger as well, so yeah.https://nicecrew.tv/static/streaming-playlists/hls/5129727e-0aa6-4aea-8ca6-03ea92f61b91/7b36d54b-c9f2-4730-bd2f-22093a2f785e-master.m3u8https://nicecrew.tv/videos/embed/b2hJXX3yScKkqdgkp5mNLz376002024-12-15T02:06:55.990ZAnime boy with long hairSpeedpaintcutegrumpyYESDreamy's LoungeNOhttps://nicecrew.tv/w/p2nS5vg36k9UqBTJfr2UHLhttps://nicecrew.tv/lazy-static/thumbnails/a4c566a5-afaa-4fbc-bc00-867fca9c87db.jpgDrawing RulianAnother drawing of a christian girl, that is all really. Finished Christian girl: https://rainbowdoodler209.deviantart.com/art/Rulian-700039820?ga_submit_new=10%3A1503287918https://nicecrew.tv/static/streaming-playlists/hls/ba736821-01f7-4a77-9333-9a1133df153e/8a1a343b-65da-47d1-861d-fd74da3ec226-master.m3u8https://nicecrew.tv/videos/embed/p2nS5vg36k9UqBTJfr2UHL355002024-12-15T02:07:02.271ZspeedpaintchristiancuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/asjWvzHib8nfz5wm8HHZB1https://nicecrew.tv/lazy-static/thumbnails/8ed93826-353e-493b-9334-6a58262ce3d2.jpgDrawing: Happy nunAnother cute nun drawing, you guys can send out requests if you want and stuff. Finished nun drawing: https://rainbowdoodler209.deviantart.com/art/Happy-Nun-700393129?ga_submit_new=10%3A1503453610 And one more thing, I love every single one of you guys!https://nicecrew.tv/static/streaming-playlists/hls/4c8f420f-2516-4350-a471-1690b9331a4a/016f4ab1-76b7-4b1c-b15b-45e388128f8e-master.m3u8https://nicecrew.tv/videos/embed/asjWvzHib8nfz5wm8HHZB1339012024-12-15T02:07:30.381ZnunspeedpaintcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/dCKTAo4AY9ucBiWbBvrQUEhttps://nicecrew.tv/lazy-static/thumbnails/bcf0e43b-281d-4f0a-87ab-5a34e0c2b2ad.jpgDrawing JiolaHmm, dunno what to say here tbh, a bit bummed out tonight. But I hope you all enjoy this drawing video. Finished drawing: https://rainbowdoodler209.deviantart.com/art/Jiola-700586145?ga_submit_new=10%3A1503544178 Thanks for watching, and like comment and sub. (If you want to)https://nicecrew.tv/static/streaming-playlists/hls/664f7cce-5fd8-47cf-864b-51d6a269a0c6/5268a62e-0c2f-43b7-a483-389c10acf253-master.m3u8https://nicecrew.tv/videos/embed/dCKTAo4AY9ucBiWbBvrQUE456002024-12-15T02:07:53.103ZjiolacutegirlspeedpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/7W5vdV5dejjhKLSYwm7nudhttps://nicecrew.tv/lazy-static/thumbnails/f0383d01-059c-4cc1-8a2d-36076318fded.jpgDrawing Floral NunAnother drawing of a nun except it's based off of flowers. Please enjoy! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Floral-Nun-700932775?ga_submit_new=10%3A1503714393https://nicecrew.tv/static/streaming-playlists/hls/3823c568-bd49-4a8b-867d-7e8b42c7ea48/1fcc0a73-3056-478e-9864-905dc4779c0c-master.m3u8https://nicecrew.tv/videos/embed/7W5vdV5dejjhKLSYwm7nud561002024-12-15T02:08:08.937ZNunspeedpaintphotoshopanimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/51FjSStaSd7p2givqL3Y7Xhttps://nicecrew.tv/lazy-static/thumbnails/3b641077-97ac-407c-a7df-f10546b7f745.jpgDrawing: KiquoAnother drawing of a robot girl but kiquo flies around planet Tarreon, looking for nuts and bolts that are buried in the ground or floating in the atmosphere of the orange planet. I hope you all enjoy and such! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Kiquo-701137541?ga_submit_new=10%3A1503806129https://nicecrew.tv/static/streaming-playlists/hls/207cca31-a39f-4580-bfde-eb27e60b9843/59f58882-5575-4102-92a5-a7ef9ffd3377-master.m3u8https://nicecrew.tv/videos/embed/51FjSStaSd7p2givqL3Y7X398002024-12-15T02:07:58.481ZcutegreenrobotgirlphotoshopYESDreamy's LoungeNOhttps://nicecrew.tv/w/3dmhniuwCkDFv6supGLf7fhttps://nicecrew.tv/lazy-static/thumbnails/c5050a63-716a-4d9e-9ed7-c32c057959c2.jpgPainting: Lucyanna JacksonA drawing of Lucyanna as Micheal Jackson and flying in the middle of the skies. I hope you all enjoy this drawing. Finished drawing: https://rainbowdoodler209.deviantart.com/art/Lucyanna-Jackson-701883562?ga_submit_new=10%3A1504150223https://nicecrew.tv/static/streaming-playlists/hls/11ebb3b0-21e0-4ca1-bdef-f8fd4328ff22/42997634-d7a8-445e-973b-66aa05558777-master.m3u8https://nicecrew.tv/videos/embed/3dmhniuwCkDFv6supGLf7f481002024-12-15T02:08:04.151ZLucyanna KimselspeedpaintpaintingYESDreamy's LoungeNOhttps://nicecrew.tv/w/pmAq87gNs42EMbiL29iBCVhttps://nicecrew.tv/lazy-static/thumbnails/c49579fd-38f0-4f5a-bed9-f21a66138e9a.jpgI talk about: Gameboy games collection & moreI know there's like a lot of video-game related videos, but I just want to show you all my game boy games collection, I should've showed you guys my game to color but I might drag the video too long. But I hope you all enjoyed the video and stuff, and I did listen to the entire video for the sound volume. Love you all and bless you all!https://nicecrew.tv/static/streaming-playlists/hls/bd22462d-be1a-49b6-8857-55cba17ca091/d52f1339-6766-4c51-81f4-8f878b22fcfb-master.m3u8https://nicecrew.tv/videos/embed/pmAq87gNs42EMbiL29iBCV255002024-12-15T02:08:20.122ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/vq2MranpUZKCYXgvFVqCd3https://nicecrew.tv/lazy-static/thumbnails/fe11a4e4-3b96-4d90-99a8-4ee2b513bc6b.jpgColors! 3D: Mosquito girlI made this drawing yesterday, I'm currently looking for my MacBook, since my mom and I moved. I'll have to figure out where I put it. Don't worry though, I'll still draw for videos. Thanks for watching and reading.https://nicecrew.tv/static/streaming-playlists/hls/ee33f87c-105d-457f-88af-a9cce5db00fa/33b41bea-86ee-4186-a1e4-686b77b02241-master.m3u8https://nicecrew.tv/videos/embed/vq2MranpUZKCYXgvFVqCd3153002024-12-15T02:08:11.544ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/wqzDKvPJSrquvDgW66cfNEhttps://nicecrew.tv/lazy-static/thumbnails/f4b40ce2-44ef-40ae-b2e9-ed2e6e5269c9.jpgDrawing ms paint: Nyun And H-b31I wanted to draw my little beast character again, with her robot radio hijacker friend named H-b31. Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/f660bf94-b557-43ba-aea9-fcb50ea895b2/d0495a91-0ef6-4152-83af-9b2e5f23c212-master.m3u8https://nicecrew.tv/videos/embed/wqzDKvPJSrquvDgW66cfNE150002024-12-15T02:08:05.921ZdrawingBeastmspaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/iCQCf7mB16ymrGsg27jQu8https://nicecrew.tv/lazy-static/thumbnails/432686c8-5e1f-485c-a6a8-e1f6799e29d1.jpgFlying aroundAnother short animation. Enjoy!https://nicecrew.tv/static/streaming-playlists/hls/8ed0195d-e9d5-4bb0-a658-41283029d8af/218d7234-e541-44f0-8bd7-7dc74e24254b-master.m3u8https://nicecrew.tv/videos/embed/iCQCf7mB16ymrGsg27jQu84002024-12-15T02:07:53.750ZnuncuteanimationsYESDreamy's LoungeNOhttps://nicecrew.tv/w/xui3oa6u3LjZKqH5BCAUoChttps://nicecrew.tv/lazy-static/thumbnails/2845ad57-b78a-4509-8985-eeb59cdaaebf.jpgRadio potionAn animation about Nyun being splashed with the radio potion. Please enjoy this little animation short.https://nicecrew.tv/static/streaming-playlists/hls/fefea03e-5ed8-4842-b360-c2825b0ae660/86ee309c-69cd-487e-a1cd-abb95dc0d9bf-master.m3u8https://nicecrew.tv/videos/embed/xui3oa6u3LjZKqH5BCAUoC9002024-12-15T02:07:59.853Zflash animationcuteshortoriginalYESDreamy's LoungeNOhttps://nicecrew.tv/w/cgzizyM67za8yL52qFAAbzhttps://nicecrew.tv/lazy-static/thumbnails/90f32578-9cc7-4654-9a36-63810259dbbf.jpgDos Gato y ComunistaI hope you all enjoy this little animation. Gracias!https://nicecrew.tv/static/streaming-playlists/hls/5b41349f-c4ed-491b-8582-7cda2ff08f2d/706b1f5a-8aa2-409c-be8d-c6b98aac82ed-master.m3u8https://nicecrew.tv/videos/embed/cgzizyM67za8yL52qFAAbz8002024-12-15T02:08:00.102ZanimationcatsspanishgatobienYESDreamy's LoungeNOhttps://nicecrew.tv/w/fkE33VMg8P8ozJWURN673bhttps://nicecrew.tv/lazy-static/thumbnails/b6caa054-827b-4380-a44d-53d00f0ed45a.jpgContent Aware Scale Derpy mouseyWanted to make another content aware scale video of me making my drawings looking more miserable than ever! Please enjoy the video!https://nicecrew.tv/static/streaming-playlists/hls/741e8353-3e15-4282-b3e1-f1c530a62e9e/bc28e96a-4e9e-48f2-8ab3-2c5993077999-master.m3u8https://nicecrew.tv/videos/embed/fkE33VMg8P8ozJWURN673b46002024-12-15T02:08:03.418Zcontent Aware ScalecutesadYESDreamy's LoungeNOhttps://nicecrew.tv/w/oky32x7KVG4S1VBJd2Yg6Hhttps://nicecrew.tv/lazy-static/thumbnails/62a1ef1d-63d6-49e8-aed6-cabd8d44cbab.jpgBrown BearAnother little animation. Happy first day of october!https://nicecrew.tv/static/streaming-playlists/hls/b4e3eca4-57f1-43fa-aa95-2ad2bdf47ab7/624081c1-1e23-4a0a-8906-96b0e9a5d40e-master.m3u8https://nicecrew.tv/videos/embed/oky32x7KVG4S1VBJd2Yg6H15002024-12-15T02:08:00.293Zflash animationoctober 1stcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/67DdNy5HqfqLFSTigAjXbphttps://nicecrew.tv/lazy-static/thumbnails/48940ecf-b7e6-40bc-9737-bd4981eba5f8.jpgColors 3D: Vampire NunA little 3ds doodle before bed, I'll send in the new drawing on my second account on G+. Please enjoy!https://nicecrew.tv/static/streaming-playlists/hls/296b1811-3c6f-4a3c-9e52-4d059cb02627/519ba61f-abb8-4714-be29-7a2bf4c44fee-master.m3u8https://nicecrew.tv/videos/embed/67DdNy5HqfqLFSTigAjXbp125002024-12-15T02:08:22.770ZColorslive3ds drawingnunanime artcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/ksLw2bAeocDaUn7FsgR2f9https://nicecrew.tv/lazy-static/thumbnails/e472b273-23c7-4ffe-bbab-beb769479b80.jpgMeet my new cat: SmoresA new kitty has been adopted. She's so cute!https://nicecrew.tv/static/streaming-playlists/hls/9d9a6851-ffd2-48b1-9df0-42af5b0093f0/a92a39cc-c2a1-4ba1-9de0-a56c4a311976-master.m3u8https://nicecrew.tv/videos/embed/ksLw2bAeocDaUn7FsgR2f9175002024-12-15T02:09:05.284ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/4w9MYdtS6ug8pB35FeUZrMhttps://nicecrew.tv/lazy-static/thumbnails/73588eae-529c-4a78-9322-cb27b0b51a74.jpgColors! 3D: Red and yellowA little drawing of Reina but dressed in the colors of the communist flag. Please enjoy!https://nicecrew.tv/static/streaming-playlists/hls/1c8125cf-5fc8-4af2-939e-b19fe34b532b/fa476c31-876d-4403-a55b-59fac9315a13-master.m3u8https://nicecrew.tv/videos/embed/4w9MYdtS6ug8pB35FeUZrM183002024-12-15T02:09:13.792ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/wLitjffVxqyZ6hEsLnufeqhttps://nicecrew.tv/lazy-static/thumbnails/b4004069-2d33-4f84-b239-4138feb8d2bc.jpgDrawing Jisun Nal doodleA little doodle of Jisun Nal, I'll be pretty busy tomorrow, please enjoy the slow drawing. Finished drawing: https://rainbowdoodler209.deviantart.com/art/Jinsun-Nal-doodle-710531463?ga_submit_new=10%3A1508385040https://nicecrew.tv/static/streaming-playlists/hls/f921a70c-2f28-4764-97fa-061295ddc8b2/ffe3779a-a4d8-4b96-92c5-e9b8569a4d7d-master.m3u8https://nicecrew.tv/videos/embed/wLitjffVxqyZ6hEsLnufeq431002024-12-15T02:09:16.102ZJinsun Naldoodleslow drawingYESDreamy's LoungeNOhttps://nicecrew.tv/w/dxUM786wLj4Gky5gKzDEJGhttps://nicecrew.tv/lazy-static/thumbnails/fe158190-9f11-435f-adf5-50bb0276c0e8.jpgCute AisaAnother animation, Please enjoy! Will also be posted in Minds.https://nicecrew.tv/static/streaming-playlists/hls/65a23f06-7167-4329-83af-f2b79c59437c/1c258818-b0a1-4b51-8280-92ce891a05cf-master.m3u8https://nicecrew.tv/videos/embed/dxUM786wLj4Gky5gKzDEJG15002024-12-15T02:08:16.370ZanimationAisa YisarandomboredomanimeYESDreamy's LoungeNOhttps://nicecrew.tv/w/2vRx4VMzmgkoLp5XZuskD7https://nicecrew.tv/lazy-static/thumbnails/1dc63fd9-fd4f-4f64-837a-8e918dd537f1.jpgColors 3d: Soft sweet bunnyAnother drawing of Miliyu my current fursona, please enjoy everyone.https://nicecrew.tv/static/streaming-playlists/hls/0c443c44-6cf4-4310-b1c0-51f211fed944/460430d4-3d40-4b02-b786-93ac1ac0013f-master.m3u8https://nicecrew.tv/videos/embed/2vRx4VMzmgkoLp5XZuskD7172002024-12-15T02:09:25.830ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/exvQa4hTQxwsEvgkJAqT3Xhttps://nicecrew.tv/lazy-static/thumbnails/b00e583b-a7c2-4749-8d04-464d1577051d.jpgDrawing: Shaja JunShaja is a 19 year old girl who likes to dress pretty moderately everyday, the sun hardly bothers her anyways when she wears black 24/7. Please enjoy! Finished: https://rainbowdoodler209.deviantart.com/art/Shana-Jun-711705341?ga_submit_new=10%3A1508981097https://nicecrew.tv/static/streaming-playlists/hls/6dad3e36-0b1a-47d4-8925-fa5f04731037/e9b532cf-55bf-41a2-aafe-2a31056012b8-master.m3u8https://nicecrew.tv/videos/embed/exvQa4hTQxwsEvgkJAqT3X258002024-12-15T02:09:21.558ZShaja Jundrawingcuteanime girlslow drawingYESDreamy's LoungeNOhttps://nicecrew.tv/w/qMdD18Ci1vZBy6HNBC2QpVhttps://nicecrew.tv/lazy-static/thumbnails/49b799e4-a2ff-4e7d-9664-9ca26ae051f8.jpgSpeed drawing: Smiling maidAnother speed drawing on my sketchbook, please enjoy. Sorry, I was listening to a video while drawing this picture. I hope you all enjoy and stuff! ^^ Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/c8ab95fe-8fad-4d86-97f0-7d9ee9241873/c0421e05-07a7-44e7-b9b6-b8cc11f213d6-master.m3u8https://nicecrew.tv/videos/embed/qMdD18Ci1vZBy6HNBC2QpV29002024-12-15T02:08:54.543ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/vxcwUq1hHnxuyE4EkmmgQbhttps://nicecrew.tv/lazy-static/thumbnails/22cfee28-7e84-4700-a31a-a84a470cf280.jpgDrawing Yeo sanA girl who likes capitalism, please enjoy this slow drawing. I love you all. Finished capitalist girl: https://rainbowdoodler209.deviantart.com/art/Yeo-san-712393286?ga_submit_new=10%3A1509326244https://nicecrew.tv/static/streaming-playlists/hls/ef342f74-0209-41a3-9907-0ee58a186646/128a20d6-4a4f-4f2a-af97-6da8dfb7be88-master.m3u8https://nicecrew.tv/videos/embed/vxcwUq1hHnxuyE4EkmmgQb483002024-12-15T02:09:47.367Zslow drawingcutecapitalismYESDreamy's LoungeNOhttps://nicecrew.tv/w/aiAk6wLSSGkhdSxpRnaVAKhttps://nicecrew.tv/lazy-static/thumbnails/dad1a036-23df-40e9-8399-d0b93158933e.jpgColors! 3D: Halloween DevilAnother devil drawing but wearing a traditional uniform for “Scary year” which is celebrated in planet Tarreon every year in October. Please enjoy! Happy Halloween everyone! 🎃https://nicecrew.tv/static/streaming-playlists/hls/4b570c54-da14-479c-840e-34703970b8eb/c9d836c0-9876-4f70-a923-ee883958b008-master.m3u8https://nicecrew.tv/videos/embed/aiAk6wLSSGkhdSxpRnaVAK275002024-12-15T02:10:15.320ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/ut6YmYe4NvP4yG2ZkvR5pjhttps://nicecrew.tv/lazy-static/thumbnails/a1720a58-36c2-4c5c-9efc-5ec56ba7a578.jpgColors! 3D: Sleepytime BunnyAnother 3ds drawing video. I might make another animation too. I hope you all enjoyed the video! ^^https://nicecrew.tv/static/streaming-playlists/hls/e688a4fd-6aa9-4e21-831e-ce4fa5cc5bf0/9d3edf98-dfb0-4870-91e7-5393fb6c53dd-master.m3u8https://nicecrew.tv/videos/embed/ut6YmYe4NvP4yG2ZkvR5pj166002024-12-15T02:09:49.689ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/geFTwF8NmfaTHDer3dry2ahttps://nicecrew.tv/lazy-static/thumbnails/288695ba-755b-4293-8bd9-408138434346.jpgSpeed drawing: Pink girlI’m not sure what to name this character yet. It’s her first design as well. I might change her hair color at some point. But please enjoy! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Pink-girl-713490268https://nicecrew.tv/static/streaming-playlists/hls/7b6254be-38ae-4cf2-b470-37a8fe7f426b/ff552053-a677-4e7a-a27d-855b81cfc5b8-master.m3u8https://nicecrew.tv/videos/embed/geFTwF8NmfaTHDer3dry2a30002024-12-15T02:09:25.899ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/5CLhFfkdb3ZQNKea4L7WBrhttps://nicecrew.tv/lazy-static/thumbnails/4655d4a9-f4f6-4fa2-b3ea-2ba80e37a874.jpgStanaPlease enjoy this animation everyone.https://nicecrew.tv/static/streaming-playlists/hls/25869f9e-f6e6-4af1-8611-6b63570a89ef/480c1f56-f208-4630-b55e-11e04ddc2416-master.m3u8https://nicecrew.tv/videos/embed/5CLhFfkdb3ZQNKea4L7WBr5002024-12-15T02:09:23.477ZanimationcuteStanaYESDreamy's LoungeNOhttps://nicecrew.tv/w/pXT4Z2tZevGsTqk7XdAc39https://nicecrew.tv/lazy-static/thumbnails/4613410e-ade9-4c40-871a-2a7b5cff4c30.jpgDrawing: DA IDA little drawing of my new DeviantArt ID. Why not update it. Don't worry, I'll still animate as well. Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/c20f9197-9943-4b13-9412-e29f3574f778/60012abc-48e4-4c26-9348-f80826482e25-master.m3u8https://nicecrew.tv/videos/embed/pXT4Z2tZevGsTqk7XdAc39154002024-12-15T02:09:27.679ZdrawingYESDreamy's LoungeNOhttps://nicecrew.tv/w/8xitZhpsSHcue671HRap4Uhttps://nicecrew.tv/lazy-static/thumbnails/aabd6629-7a7b-469d-b14c-bbcf8ba4c290.jpgNet Neutrality PSA drawingJust wanted to make this drawing about Net neutrality, don't let FCC force you pay for internet! Finished drawing PSA: https://rainbowdoodler209.deviantart.com/art/Net-Neutrality-PSA-716330129?ga_submit_new=10%3A1511333645https://nicecrew.tv/static/streaming-playlists/hls/3d0ecd2e-897d-41ef-b223-0572c2f17f36/fa6ab4cd-2c8a-4472-8fd3-a673c9800a3d-master.m3u8https://nicecrew.tv/videos/embed/8xitZhpsSHcue671HRap4U278002024-12-15T02:10:09.430ZNet_NeutralityspeedartPSA Anime ArtcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/uW8cuD7VeZLWFv6Jt8qKW7https://nicecrew.tv/lazy-static/thumbnails/77cdadac-ea07-4de4-ae72-c10a7878fc1f.jpgSpeed drawing: Yellow And GreyJust wanted to try out my crayons. Enjoy! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Yellow-and-grey-716435194https://nicecrew.tv/static/streaming-playlists/hls/ea4e7b6a-2ccf-4f2a-a765-e73aafb3ee5e/c2b70fde-ea9a-434f-a672-042c7d8ea5c5-master.m3u8https://nicecrew.tv/videos/embed/uW8cuD7VeZLWFv6Jt8qKW730002024-12-15T02:09:54.647ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/qodnG974DN3EEuwEFU1noXhttps://nicecrew.tv/lazy-static/thumbnails/61467d6c-410d-4ce0-992f-2c3bf3539600.jpgDrawing: Limboist GirlA limboist girl who loves to dress modestly and wear all kinds of dress like outfits. Hopefully you all enjoy this drawing! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Limboist-Girl-716784501?ga_submit_new=10%3A1511573306&ga_type=edit&ga_changes=1&ga_recent=1https://nicecrew.tv/static/streaming-playlists/hls/c5755108-0934-4ef8-a059-e78bd01e3447/25001da7-6296-42b5-93c4-f4145d0fc0ac-master.m3u8https://nicecrew.tv/videos/embed/qodnG974DN3EEuwEFU1noX304002024-12-15T02:10:29.909ZlimboistlimboismspeedartYESDreamy's LoungeNOhttps://nicecrew.tv/w/r2SsbEzXTLNV6JghceRvHAhttps://nicecrew.tv/lazy-static/thumbnails/412b8000-2ba4-4488-9308-7622fa5ab52c.jpgDrawing Repillia chanI hope you all enjoyed this little political girl drawing. Please enjoy! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Repillia-chan-717009165?ga_submit_new=10%3A1511679583https://nicecrew.tv/static/streaming-playlists/hls/cab74d54-ff5f-4ae6-9f84-b773f040b158/dce5dfd6-9474-4a79-a523-61dde4f1d1d7-master.m3u8https://nicecrew.tv/videos/embed/r2SsbEzXTLNV6JghceRvHA453002024-12-15T02:10:15.801ZpoliticalrepublicanRepillia-chanYESDreamy's LoungeNOhttps://nicecrew.tv/w/xt1UhBeYuaRKYAAPQhPxFEhttps://nicecrew.tv/lazy-static/thumbnails/a10137d1-9423-43a8-a84a-9f4a5d92a979.jpgColors 3D: Nakimah QurinI already posted the original on Colorslive and DA. So please Enjoy!https://nicecrew.tv/static/streaming-playlists/hls/fed0ef91-5bb7-462a-bab5-faf5cd57ed70/46973199-70d1-440d-8140-7236a84babde-master.m3u8https://nicecrew.tv/videos/embed/xt1UhBeYuaRKYAAPQhPxFE153002024-12-15T02:10:45.503Zcolorslive3dsdrawingYESDreamy's LoungeNOhttps://nicecrew.tv/w/oAuiquL1ZDj935hDaFMgsEhttps://nicecrew.tv/lazy-static/thumbnails/c3756263-4898-4b7d-98bd-ddbe67d4b936.jpgDrawing Blue girlHopefully you all enjoy this drawing: Finished drawing: https://rainbowdoodler209.deviantart.com/art/Blue-girl-718725217https://nicecrew.tv/static/streaming-playlists/hls/b6f9c788-d80a-41e1-938b-d4a091918b7e/1871cf3c-4017-4e3f-a730-a8b433e125f6-master.m3u8https://nicecrew.tv/videos/embed/oAuiquL1ZDj935hDaFMgsE444002024-12-15T02:10:26.166ZspeedpaintphotoshopccYESDreamy's LoungeNOhttps://nicecrew.tv/w/564chKGW4fm3Y3cRt6SMRxhttps://nicecrew.tv/lazy-static/thumbnails/97317d50-940a-471e-9c50-2fdc898d98ca.jpgDrawing SpinuoA little drawing of a thing....I made for fun. Please enjoy! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Spinuo-719363572?ga_submit_new=10%3A1512900830https://nicecrew.tv/static/streaming-playlists/hls/21193e04-5b6a-411d-9c2d-c14434b87f4d/bbef9cc2-8b3b-45c4-9340-b7a001efe081-master.m3u8https://nicecrew.tv/videos/embed/564chKGW4fm3Y3cRt6SMRx284002024-12-15T02:10:23.279ZspeedpaintcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/q6MVDAm9LkcroMUUaen9Pahttps://nicecrew.tv/lazy-static/thumbnails/86a5103b-d477-4160-a12b-59362063d25d.jpgDrawing Robo 961Another cute little robot girl drawing, because why not! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Robo-961-719825244?ga_submit_new=10%3A1513137992https://nicecrew.tv/static/streaming-playlists/hls/c32a5955-3c48-4fbc-90b6-63bf8a934187/97c59176-ff8d-44ef-b34d-691a5966602c-master.m3u8https://nicecrew.tv/videos/embed/q6MVDAm9LkcroMUUaen9Pa586002024-12-15T02:11:02.719ZspeedpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/1jsJdjC7J3msnoeTLz3FzGhttps://nicecrew.tv/lazy-static/thumbnails/f6372eff-126e-4c7e-925a-0a5b75698880.jpgDrawing - Galaxy GirlA cute lavender girl, with her hair being as dark as the endless galaxy. Please enjoy! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Galaxy-Girl-720439212?ga_submit_new=10%3A1513472615https://nicecrew.tv/static/streaming-playlists/hls/0293dc05-1183-4283-8664-27e318374a3e/a7ece21e-16b0-4388-b49e-ddf463b7e6fd-master.m3u8https://nicecrew.tv/videos/embed/1jsJdjC7J3msnoeTLz3FzG468002024-12-15T02:10:31.917ZcutespeedpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/x722eU9V1gTY8RJkW64UDShttps://nicecrew.tv/lazy-static/thumbnails/2a4a8408-149e-41bf-9735-1f8e0e2f0c8c.jpgDrawing: свитерA little drawing of a girl wearing a turquoise sweater, I hope you all enjoy the video! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Sweater-721045825https://nicecrew.tv/static/streaming-playlists/hls/fbe263f9-5466-4395-b8aa-9be9e37d522c/f3b4dfcf-068a-4f05-99a2-e8fd38292962-master.m3u8https://nicecrew.tv/videos/embed/x722eU9V1gTY8RJkW64UDS564002024-12-15T02:11:12.179ZspeedpaintcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/gVp4ECFQkZigLfRFPsgsMLhttps://nicecrew.tv/lazy-static/thumbnails/1c8e29a2-66ec-4a42-822e-19ae8ea570f8.jpgPainting: Sunset GirlAnother quick drawing, I also got the nintendo switch now. I also hope you all have a wonderful Christmas as well! This video is also on my vidlii. (Vidlii - Fishrum11) Finished drawing: https://rainbowdoodler209.deviantart.com/art/Sunset-girl-721822501?ga_submit_new=10%3A1514179966https://nicecrew.tv/static/streaming-playlists/hls/80edb681-b90a-4ad0-9bcd-dd234dbbe49e/6bac1011-44d5-4530-8995-14cfedfa5e43-master.m3u8https://nicecrew.tv/videos/embed/gVp4ECFQkZigLfRFPsgsML774002024-12-15T02:11:09.056ZspeedpaintcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/1PwJXcqtyRQnciq1J2y2Rjhttps://nicecrew.tv/lazy-static/thumbnails/85a60db7-7ed7-414c-8314-0a11b4f6b3b4.jpgDrawing Limboist Girl 2Another limboist girl drawing but really colorful, to be honest. I like drawing girls. Please enjoy and stuff. Finished drawing: https://rainbowdoodler209.deviantart.com/art/Limboist-girl-2-722167390https://nicecrew.tv/static/streaming-playlists/hls/06a2e6d7-6c8d-4702-949e-f1979b1885a0/24782443-8389-4943-b8bd-bc69e26893a4-master.m3u8https://nicecrew.tv/videos/embed/1PwJXcqtyRQnciq1J2y2Rj803002024-12-15T02:14:04.438ZspeedpaintRD209cutecolorfulYESDreamy's LoungeNOhttps://nicecrew.tv/w/ajYThTb1unXyV5zUK98Wsahttps://nicecrew.tv/lazy-static/thumbnails/8057a0a5-b2f4-4214-9f2c-3dc564787472.jpgDrawing Pink and blueI finally figured out the solution, if your app on your computer is freaking out, just force quit it! Anyways I hope you all have a wonderful day. Finished drawing: https://rainbowdoodler209.deviantart.com/art/Pink-and-blue-722352399https://nicecrew.tv/static/streaming-playlists/hls/4b88b127-c5c2-4f49-9686-8ac6749c7a7d/9d75e567-2817-4839-9234-5e24bde8857f-master.m3u8https://nicecrew.tv/videos/embed/ajYThTb1unXyV5zUK98Wsa436002024-12-15T02:10:48.190ZislamicmuslimahcutepinkYESDreamy's LoungeNOhttps://nicecrew.tv/w/3xcNHjVsNQBSzKUQ6nafN5https://nicecrew.tv/lazy-static/thumbnails/a3e38f2e-8257-4b87-aa0f-258343e2c7c9.jpgHanging out with smoresJust wanted to make another video about smores. Please enjoy.https://nicecrew.tv/static/streaming-playlists/hls/148d9c09-7012-4df9-9ffe-5acd072d9f40/eabb50aa-c5b1-461f-8924-a042d5386b56-master.m3u8https://nicecrew.tv/videos/embed/3xcNHjVsNQBSzKUQ6nafN5175512024-12-15T02:11:07.626ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/kmmphuULddbbBGd6sStRqShttps://nicecrew.tv/lazy-static/thumbnails/314034e6-241a-4735-94bb-3d675665dc4f.jpgDrawing Vai Gorvan 2018A little drawing of Vai Gorvan for my pixiv. Please enjoy and stuff. Finished drawing: https://rainbowdoodler209.deviantart.com/art/Vai-Gorvan-2018-722894245https://nicecrew.tv/static/streaming-playlists/hls/9cb51531-52a6-4251-9188-a541259df65e/7358fe00-31b6-4b49-9b0a-05a55db2e152-master.m3u8https://nicecrew.tv/videos/embed/kmmphuULddbbBGd6sStRqS473002024-12-15T02:12:11.880ZSpeedpaintcutesketchbookpro7YESDreamy's LoungeNOhttps://nicecrew.tv/w/37xWRSNsxStWHSL9ym1cgzhttps://nicecrew.tv/lazy-static/thumbnails/7ea52292-3500-4ad7-a856-34920a559c8a.jpgDrawing Zalion the mimeCharacter info. Zalion is a 17 year old mime that was born in France in the big city. He always keeps his spirits very high as well as trying to make people laugh. Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/111c6d61-f98b-4c18-8fa7-da1fdd191953/8c0ba04a-6050-4408-b562-26b844159236-master.m3u8https://nicecrew.tv/videos/embed/37xWRSNsxStWHSL9ym1cgz506002024-12-15T02:11:34.416ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/3VytLAc4gvpPEtP82DmuGZhttps://nicecrew.tv/lazy-static/thumbnails/7378d959-1907-4755-9aaf-4b15dbad5c40.jpgDrawing AziimaA little drawing of a girl who originally lives Yemen, she tries her best at being happy in life and now she lives in America enjoying her favorite hobby which is fishing. Hopefully you all enjoyed this drawing video. I also finished the drawing off camera as well. Finished drawing: https://rainbowdoodler209.deviantart.com/art/Aziima-724048943?ga_submit_new=10%3A1515208798https://nicecrew.tv/static/streaming-playlists/hls/17acb67f-98d4-4413-ad77-6ef8c41dd189/2f77a985-354b-46ca-b988-60d8ee46d752-master.m3u8https://nicecrew.tv/videos/embed/3VytLAc4gvpPEtP82DmuGZ413002024-12-15T02:11:30.704ZAziimaRD2092018speedpaintcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/5pjsrmJBgu13bK2ot2zFuahttps://nicecrew.tv/lazy-static/thumbnails/e7555042-0e65-4d33-aff3-bc3fd19350e8.jpgDrawing: На холодеI hope you all enjoy this little drawing I made! That's it tbh. Finished drawing: https://rainbowdoodler209.deviantart.com/art/In-the-cold-724271974?ga_submit_new=10%3A1515309054https://nicecrew.tv/static/streaming-playlists/hls/23a608ff-8b6d-4496-bc2d-ed00d40085f5/1e166fb6-8075-41d1-9b5b-959eda06c1fd-master.m3u8https://nicecrew.tv/videos/embed/5pjsrmJBgu13bK2ot2zFua577002024-12-15T02:12:47.678ZНа холодеcuteRD2092018YESDreamy's LoungeNOhttps://nicecrew.tv/w/9WPgAyHijGL61qVewzhuDWhttps://nicecrew.tv/lazy-static/thumbnails/fb3db45f-d963-451e-a254-03b841ce16ea.jpgDrawing Happy PoodleA happy drawing of a poodle, please enjoy and stuff. Finished drawing: https://rainbowdoodler209.deviantart.com/art/Happy-Poodle-724934199https://nicecrew.tv/static/streaming-playlists/hls/48706742-0e8a-4913-a7bf-137c3deb9c98/8bd15d55-b338-4a19-89f3-ce6d52c17628-master.m3u8https://nicecrew.tv/videos/embed/9WPgAyHijGL61qVewzhuDW523002024-12-15T02:12:25.752ZpoodleRD2092017speedpaintcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/tFN7AZsFYPiCJYzywmmQiahttps://nicecrew.tv/lazy-static/thumbnails/74076c2f-f3e4-4582-9d2e-4fdcc1675ace.jpgDrawing Goth MiliAnother cute drawing of Miliyu, please enjoy and stuff! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Goth-Mili-Yu-725453970https://nicecrew.tv/static/streaming-playlists/hls/e0352b65-9f10-48ed-9f7f-31d094f33a43/30c70713-2540-4640-9116-6323a39e608f-master.m3u8https://nicecrew.tv/videos/embed/tFN7AZsFYPiCJYzywmmQia333002024-12-15T02:11:49.719Z2018MiliYucutefursonaYESDreamy's LoungeNOhttps://nicecrew.tv/w/hXBVa1f9uZ9J3cuvqhvv8ahttps://nicecrew.tv/lazy-static/thumbnails/08f33416-7d6b-479f-9861-c413bc1276a2.jpgDrawing Pretty girlI hope everyone is having a wonderful day, please enjoy the video! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Pretty-girl-726175040https://nicecrew.tv/static/streaming-playlists/hls/8956429d-d395-49e6-8a5e-cf6c8a0fbf7b/9aacdfa2-8803-46fd-b961-5a68036a89ea-master.m3u8https://nicecrew.tv/videos/embed/hXBVa1f9uZ9J3cuvqhvv8a419002024-12-15T02:12:56.146ZBlack girl2018cuteanime artspeedpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/qBtcXHTDa14hUiXfstYsL7https://nicecrew.tv/lazy-static/thumbnails/b8602abc-d6b3-4781-81cd-e74fe498f810.jpgDrawing Evening GirlAnother cute girl drawing, please enjoy! Dunno what else to say here. Finished piece: https://rainbowdoodler209.deviantart.com/art/Evening-Girl-726526662https://nicecrew.tv/static/streaming-playlists/hls/c74f204f-d5f1-4652-bdb2-e5acbe061556/e84e53b0-1f44-49f0-bba7-ccf235d5f81d-master.m3u8https://nicecrew.tv/videos/embed/qBtcXHTDa14hUiXfstYsL7317002024-12-15T02:11:51.592Zcute2018speedpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/nXWk6Y9hZcWYJrr9DscgeXhttps://nicecrew.tv/lazy-static/thumbnails/981f9573-d9ae-4888-87ce-6b618bb12ab1.jpgDrawing - RabahaAnother cute anthro drawing. A little raccoon-bear that lives in the dessert in a small town. I hope you all enjoy and stuff! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Rebaha-727890802https://nicecrew.tv/static/streaming-playlists/hls/b1df4d05-a9be-4d37-a9c6-cd9497c4113d/ad7f1ff0-f8fa-47e5-84ed-7c39cc83807b-master.m3u8https://nicecrew.tv/videos/embed/nXWk6Y9hZcWYJrr9DscgeX391002024-12-15T02:12:09.063ZAnthrocharactercuteRD2092018YESDreamy's LoungeNOhttps://nicecrew.tv/w/36B2DUtis1nRTsgE2waWcdhttps://nicecrew.tv/lazy-static/thumbnails/6619118a-b391-4853-b24a-7a70710969a6.jpgDrawing FedinalAnother cute girl drawing, I hope you all enjoyed and stuff! I know this is posted on a Monday but yeah. Finished drawing: https://rainbowdoodler209.deviantart.com/art/Fedinal-728113338https://nicecrew.tv/static/streaming-playlists/hls/10fa9550-3f43-4ccf-a001-16526784100a/2998bc1c-b794-4c67-8b2a-80535d9570e7-master.m3u8https://nicecrew.tv/videos/embed/36B2DUtis1nRTsgE2waWcd476002024-12-15T02:13:54.229ZRD2092018speedpaintsketchbookpro7cuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/eSjLahDnyUMHk2jcDBrct7https://nicecrew.tv/lazy-static/thumbnails/f99fb375-323e-4861-a587-7ba4bc7538fb.jpgIn the woodsAnother cute black girl drawing, please enjoy! Finished piece: https://rainbowdoodler209.deviantart.com/art/In-the-woods-728592112?ga_submit_new=10%3A1517450824https://nicecrew.tv/static/streaming-playlists/hls/704d8d9d-fc9e-4b96-bdc8-059a65050aa8/ee69cf9c-cd3e-4f1b-9469-d76de414deba-master.m3u8https://nicecrew.tv/videos/embed/eSjLahDnyUMHk2jcDBrct71091002024-12-15T02:13:01.841Zcutespeedpaint2018RD209YESDreamy's LoungeNOhttps://nicecrew.tv/w/kgsytnXBJVv6tg3HtcHNb1https://nicecrew.tv/lazy-static/thumbnails/f13df8bb-4b21-4529-8d20-eb352b7d627d.jpgDrawing Big RainbowAnother happy go lucky and vibrant drawing! Please enjoy and stuff! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Big-Rainbow-729144375https://nicecrew.tv/static/streaming-playlists/hls/9c0628c0-77f8-4948-aad9-8135e7d3d4f4/845c9a2a-76c5-4ee4-84cd-38d55f695ef8-master.m3u8https://nicecrew.tv/videos/embed/kgsytnXBJVv6tg3HtcHNb1940002024-12-15T02:14:49.849Zcutelimboism2018RD209speedpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/fthor2KvhDoDZ5w13w1TUwhttps://nicecrew.tv/lazy-static/thumbnails/8d642429-08bd-462d-a004-11388ef921ef.jpgDrawing Pink monsterAnother weird drawing from me, but a light pink flesh monster. Please enjoy! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Pink-Monster-729955003?ga_submit_new=10%3A1518149375https://nicecrew.tv/static/streaming-playlists/hls/752f1f29-4c9a-4431-91f8-35663e363a32/72c6b5d0-8fa8-4ea6-9802-7a3489579881-master.m3u8https://nicecrew.tv/videos/embed/fthor2KvhDoDZ5w13w1TUw226002024-12-15T02:12:45.066ZFlesh monsterRD2092018drawingYESDreamy's LoungeNOhttps://nicecrew.tv/w/iDFP8xoviKp3dR19XBRZuxhttps://nicecrew.tv/lazy-static/thumbnails/76d3f946-7e74-4486-9fcb-f8826b11d993.jpgDrawing - Girl in purpleAnother limboist girl drawing. Pleas enjoy! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Girl-in-purple-730289287https://nicecrew.tv/static/streaming-playlists/hls/8eee697e-99f0-4acb-a60f-e99de5c92eb3/6adb3ec9-480d-4ed0-9bd8-e4f44ef7aa02-master.m3u8https://nicecrew.tv/videos/embed/iDFP8xoviKp3dR19XBRZux600002024-12-15T02:13:19.418Zmspaint2018RD209YESDreamy's LoungeNOhttps://nicecrew.tv/w/da6iPZfrYynt2E5udoGbXmhttps://nicecrew.tv/lazy-static/thumbnails/88462c61-efd3-48ff-9f7c-fbf345d3944a.jpgSpeed doodle: Fire beingA little monster doodle before I'm picked up by my mom, the video cut off because of coarse my iPhone reminds me of storage. Oh well. Please enjoy everyone! Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/6272a0ee-03b9-48a1-8a38-8f6c60ec1612/64c4e4d3-e225-45da-bd51-f7fba5427621-master.m3u8https://nicecrew.tv/videos/embed/da6iPZfrYynt2E5udoGbXm5002024-12-15T02:12:49.327ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/sJjeCubDD4kYCPr98G9gc4https://nicecrew.tv/lazy-static/thumbnails/6872e78a-3a62-41e6-a9b5-04dc0c824d51.jpgDrawing НетгфпаI hope you all enjoyed this drawing video, I polished the drawing a little too since I forget the finishing touches. Enjoy! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Hetrona-732021644?ga_submit_new=10%3A1519182364https://nicecrew.tv/static/streaming-playlists/hls/d87614ca-0974-441d-b309-54a25dfe123d/5d762083-72dc-4c74-9531-f1b8210ac2d4-master.m3u8https://nicecrew.tv/videos/embed/sJjeCubDD4kYCPr98G9gc4469002024-12-15T02:13:00.520ZRD2092018speedpaintSketchbookpro7YESDreamy's LoungeNOhttps://nicecrew.tv/w/gBUFzqDNaG6rtzL17pGcu7https://nicecrew.tv/lazy-static/thumbnails/def3b66a-48b1-40ab-b1b3-ad4af00d7a5f.jpgDrawing - Red QueenA drawing of a queen in black with red hair. Please enjoy! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Red-Queen-732702296?ga_submit_new=10%3A1519542790https://nicecrew.tv/static/streaming-playlists/hls/7e7c9418-acd6-4339-94b1-75c31259545a/4f55fc03-0236-4364-b791-e2464fedcf62-master.m3u8https://nicecrew.tv/videos/embed/gBUFzqDNaG6rtzL17pGcu7500012024-12-15T02:13:27.756ZSpeedpaint2018Firealpacadrawing(Short)YESDreamy's LoungeNOhttps://nicecrew.tv/w/qJXN5FKndA9kvjhNSapcVyhttps://nicecrew.tv/lazy-static/thumbnails/37406b80-f826-4eae-926c-4fae699594bc.jpgDrawing - Amish beeI just wanted to draw a cute bug-like monster. Please enjoy and stuff. Finished Pollen: https://rainbowdoodler209.deviantart.com/art/Amish-bee-hybrid-733469590?ga_submit_new=10%3A1519963032https://nicecrew.tv/static/streaming-playlists/hls/c85af364-fd84-46d3-86f9-11ac1f2a1c96/75db3247-0806-4579-b77e-d16f02764888-master.m3u8https://nicecrew.tv/videos/embed/qJXN5FKndA9kvjhNSapcVy366002024-12-15T02:13:06.854Zspeedpaint2018RD209cutepastelYESDreamy's LoungeNOhttps://nicecrew.tv/w/6Du5XE3EZz1iavohxuok9Nhttps://nicecrew.tv/lazy-static/thumbnails/a7f98c4a-2b23-4cb9-a177-1e32b70842ed.jpgDrawing - Simple scarf girlA little drawing of a girl in a soft scarf. Pleas enjoy! Drawing: https://rainbowdoodler209.deviantart.com/art/Simple-Scarf-girl-733839632?ga_submit_new=10%3A1520163070https://nicecrew.tv/static/streaming-playlists/hls/2db98566-d7da-456f-9c0a-1bb9d3048d3a/6007c4f8-a88f-464f-9a46-729e8254d3ef-master.m3u8https://nicecrew.tv/videos/embed/6Du5XE3EZz1iavohxuok9N473002024-12-15T02:15:39.811ZcuteRD2092018firealpacaYESDreamy's LoungeNOhttps://nicecrew.tv/w/v9NSYj4Cq7ZLzMvqDC6X6bhttps://nicecrew.tv/lazy-static/thumbnails/a745304d-2824-408d-a13e-44f5979d9686.jpgDrawing - IllishiaI hope you all enjoy this video. Finished drawing: https://rainbowdoodler209.deviantart.com/art/Illishia-735867816?ga_submit_new=10%3A1521272001https://nicecrew.tv/static/streaming-playlists/hls/ec13dc84-2cf6-4c76-ad5d-bb960041b290/fc40a51a-e16c-4200-9081-eef9208ee7f4-master.m3u8https://nicecrew.tv/videos/embed/v9NSYj4Cq7ZLzMvqDC6X6b455002024-12-15T02:13:34.622ZRD2092018speedpaintKritacuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/kRF333mMffJFgBTYP4PHp4https://nicecrew.tv/lazy-static/thumbnails/0f829358-7857-4f3a-8a13-bf2f821fee8e.jpgDrawing: Bootleg Bunny girlPossibly my first bootleg cartoon character, and her name is Truip. Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/a0cd22b0-050b-4b4c-ace3-c540a701d765/2ec96edf-a64d-4690-b88b-4d20a68646b4-master.m3u8https://nicecrew.tv/videos/embed/kRF333mMffJFgBTYP4PHp435002024-12-15T02:13:29.545ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/6TeAaWbA66Y91CQFpni72Yhttps://nicecrew.tv/lazy-static/thumbnails/e3eac633-cf59-40ad-8a1c-e0c18512b4d1.jpgDrawing - River SutJust wanted to draw my own genderless character. I hope you like it! Finished drawing: https://rainbowdoodler209.deviantart.com/art/River-Sut-737864154?ga_submit_new=10%3A1522363128https://nicecrew.tv/static/streaming-playlists/hls/2fa5000c-46e7-4dab-a0f2-0455fb2c2f62/1682d0b3-3ece-4500-beec-8cc693443e74-master.m3u8https://nicecrew.tv/videos/embed/6TeAaWbA66Y91CQFpni72Y402002024-12-15T02:14:47.419ZRD209River SutGenderless ocspeedpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/7Y58HrkFWFQ8xmw9hjH2TZhttps://nicecrew.tv/lazy-static/thumbnails/c2e015b5-472f-41f4-8988-1309029b527a.jpgDrawing - Very QuietA mute nun that's always staring. And yes, this is a serious description. Finished drawing: https://rainbowdoodler209.deviantart.com/art/Very-Quiet-738276872?ga_submit_new=10%3A1522572806https://nicecrew.tv/static/streaming-playlists/hls/386b07b7-0215-4fc3-b1f0-a7d740c8a173/6cab9673-57d0-46fe-bd79-e5513ced714e-master.m3u8https://nicecrew.tv/videos/embed/7Y58HrkFWFQ8xmw9hjH2TZ521032024-12-15T02:16:24.941ZRD209KritanuncolorfulspeedpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/edtujLhnfZ4HAVaukeGu1Jhttps://nicecrew.tv/lazy-static/thumbnails/c400fc32-827e-45d4-9bd6-dc2095336dfe.jpgDrawing - Pink rabbit girlA cute little drawing for you guys, and I hope you all enjoyed and stuff. Finished drawing: https://rainbowdoodler209.deviantart.com/art/Pink-bunny-girl-738907202?ga_submit_new=10%3A1522895464https://nicecrew.tv/static/streaming-playlists/hls/6b04ab09-3192-449c-92a1-6158778f4d8a/0e520c12-f01a-46bb-a1d2-1dac9bde3396-master.m3u8https://nicecrew.tv/videos/embed/edtujLhnfZ4HAVaukeGu1J409002024-12-15T02:14:44.079ZRD209cutespeedpaintKritaYESDreamy's LoungeNOhttps://nicecrew.tv/w/iHLgd3TQdBHagYeXLXherqhttps://nicecrew.tv/lazy-static/thumbnails/8a2f10d7-1a99-4f80-a854-170f95ce5445.jpgDrawing - Lavender GoddessI hope you all enjoyed this god like drawing. Wanted to draw something new. Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/8f80211c-84d6-4742-8994-335178da5346/a960484d-2161-4842-b982-c286fc0959e1-master.m3u8https://nicecrew.tv/videos/embed/iHLgd3TQdBHagYeXLXherq510002024-12-15T02:15:31.775Z2018RD209new pfpoddsurrealYESDreamy's LoungeNOhttps://nicecrew.tv/w/uMpCUJLZ8QRa6WLtGwXpSwhttps://nicecrew.tv/lazy-static/thumbnails/ee28e98f-a67c-47ea-af6c-ee5bce8878c2.jpgDrawing - Wary GirlWanted to draw another quick girl drawing, I hope you enjoy and stuff. Finished drawing: https://rainbowdoodler209.deviantart.com/art/Wary-Girl-740628819?ga_submit_new=10%3A1523843250https://nicecrew.tv/static/streaming-playlists/hls/e916eb26-a183-484c-bb69-b7fb1cff5be6/c0eceb9d-4748-4e58-95ca-858fe894a7fa-master.m3u8https://nicecrew.tv/videos/embed/uMpCUJLZ8QRa6WLtGwXpSw238002024-12-15T02:14:51.994Zgirldrawingspeed paint2018YESDreamy's LoungeNOhttps://nicecrew.tv/w/9DgNWgxvEme6RdY5p3CYpMhttps://nicecrew.tv/lazy-static/thumbnails/4f738f18-5083-4bc6-8e6c-1812565bc47f.jpgDrawing - No reactionJust wanted to make another black girl drawing, because why not. Please enjoy and stuff. I'll probably draw in Paint.net for a bit because why not. Finished drawing: https://rainbowdoodler209.deviantart.com/art/No-reaction-741380100?ga_submit_new=10%3A1524285160https://nicecrew.tv/static/streaming-playlists/hls/45fd5f1e-62e6-4475-998a-373fd6a60563/213b9f49-3ce5-484d-bb84-b26f947dd747-master.m3u8https://nicecrew.tv/videos/embed/9DgNWgxvEme6RdY5p3CYpM403002024-12-15T02:15:47.250ZEmotionless2018creepyominousRD209YESDreamy's LoungeNOhttps://nicecrew.tv/w/kooe9BeFEjvDKgLEWaF7YEhttps://nicecrew.tv/lazy-static/thumbnails/04bf4487-a50a-4984-bf74-ba1dff6b2798.jpgDrawing - Ginger root girlA drawing of aging root as a girl, that is all. Please enjoy the video. Finished drawing: https://rainbowdoodler209.deviantart.com/art/Ginger-Root-Girl-743544721?ga_submit_new=10%3A1525517459https://nicecrew.tv/static/streaming-playlists/hls/9cfdb1f6-8c81-40a4-8f44-a844244d2196/ef8d8a10-cee7-4d3b-84c0-474d68df101e-master.m3u8https://nicecrew.tv/videos/embed/kooe9BeFEjvDKgLEWaF7YE2877022024-12-15T02:19:56.691Z2018speedpaintcuteRD209YESDreamy's LoungeNOhttps://nicecrew.tv/w/gNsfJBCuYALbSLXkzc57Mdhttps://nicecrew.tv/lazy-static/thumbnails/936f1bed-25cf-4f4b-815c-0f006b6bd5c1.jpgDrawing - Grey RainA simple drawing of a black girl in the rain.https://nicecrew.tv/static/streaming-playlists/hls/7ff57913-5476-4f40-8ca9-a1da23fcfb46/99e3ebf9-6852-4cf4-a91d-84ec92810336-master.m3u8https://nicecrew.tv/videos/embed/gNsfJBCuYALbSLXkzc57Md191002024-12-15T02:15:34.970ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/pvQ4jSCLorV9Gjhuto8zxhhttps://nicecrew.tv/lazy-static/thumbnails/578e18ea-092b-4651-b47a-fefe37a58ae5.jpgDrawing - Veilia the catAnother cute cat character. Please enjoy.https://nicecrew.tv/static/streaming-playlists/hls/be6c5ff9-13e5-40b3-bd3c-f12dc1e10812/10998ecb-4902-4bf9-b8c2-e837dc248645-master.m3u8https://nicecrew.tv/videos/embed/pvQ4jSCLorV9Gjhuto8zxh221002024-12-15T02:15:42.732ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/7UD7FYSSvyjw7nJd9aF5Lyhttps://nicecrew.tv/lazy-static/thumbnails/86c2cbb8-ffb2-4d70-8f62-9bc6a44b9d0a.jpgRussian blue catAnother flash animation, please enjoy.https://nicecrew.tv/static/streaming-playlists/hls/37f06192-2c1e-4fb3-804b-2923e0569a50/a87a0042-744c-4e2c-900b-a2d868a366fa-master.m3u8https://nicecrew.tv/videos/embed/7UD7FYSSvyjw7nJd9aF5Ly2002024-12-15T02:15:41.205ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/xhaCqzPNRTK1hWhGicuYqNhttps://nicecrew.tv/lazy-static/thumbnails/32c1a5ad-f773-42fa-81f5-fb25ca00db28.jpgShading - ZajeenI hope you all enjoy, and I hope you have a great night! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Zajeen-745914920?ga_submit_new=10%3A1526871025https://nicecrew.tv/static/streaming-playlists/hls/fd4d21da-bbe9-4578-bebb-36e9cc70012e/2e6676d7-712c-432f-9fb8-782d08685ca6-master.m3u8https://nicecrew.tv/videos/embed/xhaCqzPNRTK1hWhGicuYqN422002024-12-15T02:16:28.342ZRD209SpeedshadingBandicamcutePaint.netYESDreamy's LoungeNOhttps://nicecrew.tv/w/kRhuQYrmehdudnXdzaRPcnhttps://nicecrew.tv/lazy-static/thumbnails/31025ad0-ae40-405c-ba96-bd625fc05a98.jpgShading - Blue KittyAnother shading video. I'm doing this series mainly because I can only make videos under 10 minutes and yeah. I hope you like the drawing though. Finished drawing: https://rainbowdoodler209.deviantart.com/art/Blue-Kitty-746760268?ga_submit_new=10%3A1527365757https://nicecrew.tv/static/streaming-playlists/hls/a0bf3f00-90bc-49a0-9156-4f78f6ed1687/4070562a-03b3-45e8-9db5-c168ea12c817-master.m3u8https://nicecrew.tv/videos/embed/kRhuQYrmehdudnXdzaRPcn517002024-12-15T02:16:41.512ZCuteRD2092018speedshadinganthroYESDreamy's LoungeNOhttps://nicecrew.tv/w/cerTgAvnBrd5pnFiGuZyGwhttps://nicecrew.tv/lazy-static/thumbnails/527c596b-9f8f-4c86-9d56-61a2aad7457c.jpgFinishing: AutumeA girl that's one of the special Quadruplits, based off of the four seasons. Please enjoy!https://nicecrew.tv/static/streaming-playlists/hls/5af52554-5c20-4b00-ab9f-cf69106cfe16/04d501d4-654a-466c-9f74-2d7f4a94e47c-master.m3u8https://nicecrew.tv/videos/embed/cerTgAvnBrd5pnFiGuZyGw508012024-12-15T02:16:44.494Z2018RD209Finishing a drawingcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/ogpxdS6GyVXs9EcHFv4vREhttps://nicecrew.tv/lazy-static/thumbnails/b4dace61-4815-444e-ac3e-766580fba5f4.jpgShading: MorgiiHere's another nice drawing made in Medibang. I really like using it! Finished drawing: https://rainbowdoodler209.deviantart.com/art/Morgii-750159936https://nicecrew.tv/static/streaming-playlists/hls/b44fb68b-89a5-47b1-a4e2-3a28e39176bc/5328e947-772d-4d25-9893-ee64d7f0d7f4-master.m3u8https://nicecrew.tv/videos/embed/ogpxdS6GyVXs9EcHFv4vRE300002024-12-15T02:16:32.730Z2018RD209GemgirlcuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/qs5WrS6RQonz1su1g3WPYrhttps://nicecrew.tv/lazy-static/thumbnails/9baedc5c-0b80-4cfb-9d60-559171823510.jpgDrawing: Femi-sangA girl character based purely off of feminism, 1st and 2nd wave feminism btw. Hopefully you all enjoy! Finished: https://www.deviantart.com/rainbowdoodler209/art/Femi-sang-752219925?ga_submit_new=10%3A1530356966https://nicecrew.tv/static/streaming-playlists/hls/c5ffb59e-e634-49ba-ba91-6b18491e4555/a2f24ad1-4fe7-4088-a62d-65b39b6a8cec-master.m3u8https://nicecrew.tv/videos/embed/qs5WrS6RQonz1su1g3WPYr600012024-12-15T02:17:01.352Z2018CuteRD209feminism as one girlspeedpaint.YESDreamy's LoungeNOhttps://nicecrew.tv/w/o6fHDt4eFaXFLBdoiLW1Aghttps://nicecrew.tv/lazy-static/thumbnails/b500f6d4-955d-447a-a8f0-772619c9bd6d.jpgDrawing: AgineA girl that protects her robot space friends from evil space monsters. Only for limboism. Please enjoy! Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Agine-753875187?ga_submit_new=10%3A1531251294https://nicecrew.tv/static/streaming-playlists/hls/b2e4d6f5-4d3e-422f-b4c7-94835f91a113/3c9b1e5d-8b56-4adb-a1c5-8973e8d81f10-master.m3u8https://nicecrew.tv/videos/embed/o6fHDt4eFaXFLBdoiLW1Ag600002024-12-15T02:17:29.180ZRD209cuteYESDreamy's LoungeNOhttps://nicecrew.tv/w/s8i8WenGCNWtFBGNce2Ykuhttps://nicecrew.tv/lazy-static/thumbnails/b1c648e4-9cd7-4ec2-85a0-11bafd430e62.jpgSmores and KirbyJust another simple cat video.https://nicecrew.tv/static/streaming-playlists/hls/d3925f5b-23e0-49cc-beca-96089729aea2/6e4a616b-d8eb-4ba3-9ec6-3ab01ef74b27-master.m3u8https://nicecrew.tv/videos/embed/s8i8WenGCNWtFBGNce2Yku109002024-12-15T02:16:39.376ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/tJ1j6rpy9QVTVZgVBvdRHPhttps://nicecrew.tv/lazy-static/thumbnails/753ed51e-b4fe-4220-80a0-08382a3541e4.jpgMehJust another small animation.https://nicecrew.tv/static/streaming-playlists/hls/e0842ca6-4ff1-430a-9f30-6c41841aaead/76ea45c1-8d53-48c3-9ca6-eeb447fb9830-master.m3u8https://nicecrew.tv/videos/embed/tJ1j6rpy9QVTVZgVBvdRHP4002024-12-15T02:16:30.953Zflipaclipanimationcartoon2d animationdrawingYESDreamy's LoungeNOhttps://nicecrew.tv/w/vmUM1en4sLoJi2zPWvZQ4Ghttps://nicecrew.tv/lazy-static/thumbnails/55c1362f-c9cd-48c8-b282-03e9b65a4033.jpgSpeedpaint: Tavina (Tanzanite)Just wanted to make another Gemgirl, I hope you all will enjoy the video... Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Tavina-Tanzanite-762682591?ga_submit_new=10%3A1536140901https://nicecrew.tv/static/streaming-playlists/hls/edc46bbd-a515-4ff1-a093-776a3b06684e/394f58ed-26b3-44e6-910f-4153cf02090e-master.m3u8https://nicecrew.tv/videos/embed/vmUM1en4sLoJi2zPWvZQ4G600002024-12-15T02:19:13.567ZGemgirl2018RD209SpeedpaintYESDreamy's LoungeNOhttps://nicecrew.tv/w/hUxqZxvSebbbps6wf6UegRhttps://nicecrew.tv/lazy-static/thumbnails/715e1304-e974-452a-857e-f23247d288d5.jpgDrawing: NC-ChanA character based off of nightcore, because why not. I was going to edit this video a littl more but it seems to be sped up. Hope you all enjoy and stuff. Hm. Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/NC-Chan-764182267https://nicecrew.tv/static/streaming-playlists/hls/88e843bb-79a6-4951-a1c0-43003b88a69b/1c81ebbe-2a3f-48a8-8b6d-41d6686d0c25-master.m3u8https://nicecrew.tv/videos/embed/hUxqZxvSebbbps6wf6UegR845002024-12-15T02:19:08.750ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/fb6W939qrkmtzrXvB9zz2yhttps://nicecrew.tv/lazy-static/thumbnails/b39bd254-90f2-44fd-85b4-2a060b277d40.jpgSpeedpaint: Trash PoodleJust wanted to make a character based off of garbage. And also inspired by a comment "trash bitch". (Sorry that I deleted this video, I thought it uploaded already, and I wanted to add some music too.) Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/72c90919-48d7-4afc-8db3-b72a24de5446/05b32255-4ebc-40a6-917b-869e817a7a97-master.m3u8https://nicecrew.tv/videos/embed/fb6W939qrkmtzrXvB9zz2y523002024-12-15T02:19:58.240ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/stm1bJdfctKspBzm2SZXxhhttps://nicecrew.tv/lazy-static/thumbnails/d3ed9597-34bd-4a11-8809-fd3445e23e49.jpgMS Drawing: AnglimA cute version of those ugly angler fish, I hope you all enjoy and such. And I finished the rest of the drawing off camera. Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Anglim-767518484https://nicecrew.tv/static/streaming-playlists/hls/d65f03ac-a243-4d0c-be37-23c77cefeffa/d56852a2-90cf-4ec6-9112-7157042cf392-master.m3u8https://nicecrew.tv/videos/embed/stm1bJdfctKspBzm2SZXxh592002024-12-15T02:19:14.108ZMS PaintfishanthroRD2092018YESDreamy's LoungeNOhttps://nicecrew.tv/w/8AfmtxTvSaE5WaQDH9XjUFhttps://nicecrew.tv/lazy-static/thumbnails/dd162ac6-48ea-42ea-b48e-cc52a5c69e9f.jpgSpeed drawing: Ms.HodagAn ugly green monster from Wisconsin Folklore, but turned into a cute anime girl. Because why not. I hope you all enjoyed the video, I was planning on making a stream, but I sadly don't have a webcam. I'll actually make the stream when I get a new macbook. (And I mostly post my traditional doodles to Instagram or my DA scraps.) Finished drawing: https://www.instagram.com/p/BouxaMwAxDf/?utm_source=ig_share_sheet&igshid=m5nt7z7cplo1https://nicecrew.tv/static/streaming-playlists/hls/3d781aaa-4c39-41f4-b65a-e9563d0faa6f/856f50dd-d312-4111-b93c-a43492ce62db-master.m3u8https://nicecrew.tv/videos/embed/8AfmtxTvSaE5WaQDH9XjUF15002024-12-15T02:16:46.940ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/h7WV3oTTXg1zp1Ac2eWGZ8https://nicecrew.tv/lazy-static/thumbnails/5f46d404-3730-4c33-8980-1f7cafc7eee4.jpgSpeed Drawing: HazetteWanted to draw a bootleg princess Peach, but she looks a little different. Please enjoy!https://nicecrew.tv/static/streaming-playlists/hls/828a8600-8ddc-485f-8c5f-67c2458fd231/78c9edc6-c6c7-4ff6-be7c-8ccd30e28c4d-master.m3u8https://nicecrew.tv/videos/embed/h7WV3oTTXg1zp1Ac2eWGZ837002024-12-15T02:17:46.585ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/v1guS1x4GxMwNG3Uys4TiZhttps://nicecrew.tv/lazy-static/thumbnails/d2c04ce9-8319-41e9-bed3-fc3dfb877ba1.jpgDrawing: Pizza SlugJust a cute traditional drawing of a startled looking pizza slug. She mostly is just a greasy slug that was brought to life in pizza form, and she also lives in the rich and middle class town of Roffino, a town named after their good dictator. Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/eae29267-6584-4157-b3cb-a90f3a977657/f0e2c991-47c0-4acd-8294-275756bb52ae-master.m3u8https://nicecrew.tv/videos/embed/v1guS1x4GxMwNG3Uys4TiZ114002024-12-15T02:18:06.878ZRD209 drawing speed drawingYESDreamy's LoungeNOhttps://nicecrew.tv/w/cmXSjcSJ8MGuWSEk598drNhttps://nicecrew.tv/lazy-static/thumbnails/fb3cdf8b-09d4-41ba-a7ae-5240dcb3e26a.jpgDrawing: Pk-491Just wanted to record myself finishing another little illistration on Sketchbook Auto desk again. I know these are mostly slow paced but I hope you overall enjoyed the making of this illistration, Thanks for supporting me, my subscribers. Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Pk-491-774653389https://nicecrew.tv/static/streaming-playlists/hls/5c01d489-2c6b-4045-9b7a-2bc4476eed60/581da25b-6b97-49d4-aab4-01f06661b11b-master.m3u8https://nicecrew.tv/videos/embed/cmXSjcSJ8MGuWSEk598drN443002024-12-15T02:19:09.001ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/oS9zrzvN78qZHhkuyNc9z3https://nicecrew.tv/lazy-static/thumbnails/f0f66201-adcd-4405-9a6c-d514086a0372.jpgDrawing: Black StripesA tired looking girl in black stripes, I just wanted to make this character doodle. And I'm also feeling a bit off today as well. Thanks for watching though. Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/b9298646-d22f-4165-b9c9-54158d06e1b4/f1510906-e71d-4744-b75b-f13369960abc-master.m3u8https://nicecrew.tv/videos/embed/oS9zrzvN78qZHhkuyNc9z3212002024-12-15T02:18:27.357ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/tVTTAq1neTZJGgEZ2cM7yThttps://nicecrew.tv/lazy-static/thumbnails/2f5ff6da-ec14-4f24-b7e7-c040f77457e0.jpgDrawing: DepressaA girl in grey I just doodled hours ago, I hope you all have a wonderful Christmas as well. Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/e22d2446-2280-4f8d-819a-5f6802c8a6e3/ae4a6f49-2de9-4813-b2e6-7d12cc5bb67f-master.m3u8https://nicecrew.tv/videos/embed/tVTTAq1neTZJGgEZ2cM7yT408002024-12-15T02:19:17.572ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/pRyG5U2dijkbHN5ZWxUg5zhttps://nicecrew.tv/lazy-static/thumbnails/e847b04b-9ce1-47d4-9306-df5bf1e25692.jpgDrawing: Smoke BreakJust a girl smoking a cigarette. That's it really. Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/c12dc7d0-54bd-4e76-a4ff-16521ab02135/afbf0e9d-6498-45ff-b14f-d6326cc8d07b-master.m3u8https://nicecrew.tv/videos/embed/pRyG5U2dijkbHN5ZWxUg5z627002024-12-15T02:20:30.218ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/fSXZLE6tiXrgrQJjSvSPq2https://nicecrew.tv/lazy-static/thumbnails/067e25e3-4328-443c-9c49-db26be0d8a91.jpgDrawing: Ms. AnxiousA character based off of Anxiety and nervousness. Please enjoy! Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/787da376-2731-4093-8832-7e0905e8f66d/c5064db6-2018-4906-bfbe-6e6a9b8af9b8-master.m3u8https://nicecrew.tv/videos/embed/fSXZLE6tiXrgrQJjSvSPq2722512024-12-15T02:20:49.284ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/aTADcMcuyRpGkjqxfXgFnahttps://nicecrew.tv/lazy-static/thumbnails/fa6fdb0c-01bb-4349-a8b2-0c9afd814ccd.jpgDrawing: Annoyed Pink GuyPink guy was about to eat his raman and then an annoying fly landed on his noodles mocking him with its dumb face. Also a request from my subs on Vidlii. I'll also do my fan's other drawing request as well, probably tommorrow. Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Annoyed-Pink-Guy-780323620https://nicecrew.tv/static/streaming-playlists/hls/5016875c-3e27-44e5-b321-f32cbd89908f/033e407d-c682-45d8-9d7b-3f3a3bef8d64-master.m3u8https://nicecrew.tv/videos/embed/aTADcMcuyRpGkjqxfXgFna640002024-12-15T02:20:44.235ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/jqygGDXoaCYijTfan62NoFhttps://nicecrew.tv/lazy-static/thumbnails/d64cd4f2-4761-40b5-b9f7-9e8dad2b9db0.jpgDrawing: Caska In PinkAnother drawing video request, sorry of the video got too long. Took me I think 2 hours to make this one. And I added some details as well. And my hand ends up getting tired. I hope you all enjoyed this request drawing and yeah. I hope I drew her right, I probably should've drawn her as a knight as well. Oh well. Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/95323be0-244f-4346-8c1d-83a12f52f973/2f8c563d-da10-49bd-be43-3064f27efdf0-master.m3u8https://nicecrew.tv/videos/embed/jqygGDXoaCYijTfan62NoF1354002024-12-15T02:22:13.678ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/vhr9c9gzNsuoNyk2hYFwHbhttps://nicecrew.tv/lazy-static/thumbnails/8b0ba507-ae5c-4b65-b43c-0a94f1a8d756.jpgDrawing: LibianaAnother girl based off of the Muslim world states. I thought adding a crescent moon pin would also fit for her since Libya is an Islamic state. I hope you all enjoyed this video and stuff. Music: Cut it - Silent Partner Finished illistration: https://www.deviantart.com/rainbowdoodler209/art/Libiana-783233443https://nicecrew.tv/static/streaming-playlists/hls/ed246a51-312d-43e5-8a45-b66edf4856e4/07053ca4-e684-4b6b-8713-7e706fe3edb7-master.m3u8https://nicecrew.tv/videos/embed/vhr9c9gzNsuoNyk2hYFwHb1017002024-12-15T02:21:54.141ZRD209 speeddrawingYESDreamy's LoungeNOhttps://nicecrew.tv/w/iszfZUaxvyFHB3XY83k3HPhttps://nicecrew.tv/lazy-static/thumbnails/bcabd1f0-3f59-4e4b-905b-617181d841eb.jpgDrawing: Silgum The Flesh queenI honestly didn't like this one. Mainly for the pen getting bad on the drawing. But I hope you all like this drawing video though. Hmm. Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Silgum-The-Flesh-Queen-785510385https://nicecrew.tv/static/streaming-playlists/hls/8d61310b-08ef-4791-b963-e751006331b9/c6349b2d-9859-4238-84fa-76626016cdb6-master.m3u8https://nicecrew.tv/videos/embed/iszfZUaxvyFHB3XY83k3HP102002024-12-15T02:20:47.498ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/fvFFTFszN46Zgp4E5XhAX4https://nicecrew.tv/lazy-static/thumbnails/e5aac858-2cf6-4047-b3a8-adce0f3e32e5.jpgDrawing: Weaponized TinnahI don't know why, but I wanted to draw one of my monkey characters in military gear, except for having guns since I haven't drawn them yet. Anyways, I hope you all enjoy this video. I also don't know why it was really out of focus near the end... Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Weaponized-Tinnah-788567150https://nicecrew.tv/static/streaming-playlists/hls/7584f812-6d38-4748-80c7-16a5b4fe38b1/48a3b767-4f65-4fac-8d17-8a82ebc532a0-master.m3u8https://nicecrew.tv/videos/embed/fvFFTFszN46Zgp4E5XhAX4171002024-12-15T02:21:13.156ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/u35baYCst6C4DjM9wDiZddhttps://nicecrew.tv/lazy-static/thumbnails/c77b1bfd-56ce-496c-bfb1-8cf11dad7532.jpgDrawing: Three Vs One CargonA little idea I've been having ever since I was binge playing Earthbound. And I hope you all will enjoy this illistration. Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Three-vs-One-Cargon-791170403https://nicecrew.tv/static/streaming-playlists/hls/e309f174-d05d-4cc7-b194-8c0bf5b93300/efd65016-a905-42d6-98ea-1ae4ed7a9857-master.m3u8https://nicecrew.tv/videos/embed/u35baYCst6C4DjM9wDiZdd96002024-12-15T02:21:15.248ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/m8Bm4dF5SfnKyMSoyEGkfjhttps://nicecrew.tv/lazy-static/thumbnails/b9555191-0e9b-4fed-83be-fdb91adfa102.jpgOBS Test plus new drawing I madeUnfortunately, I don't have the footage of me drawing this girl named Amosia (Becuase OBS crashed on me). I kind of want to make her an Earthbound oc, but nah. Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Amosina-793831173https://nicecrew.tv/static/streaming-playlists/hls/a306c31f-c1f1-47e7-9642-6c5b8a5a0f0a/6120d379-deb0-4c87-8e47-2f05e69f228a-master.m3u8https://nicecrew.tv/videos/embed/m8Bm4dF5SfnKyMSoyEGkfj15002024-12-15T02:21:05.599ZOBSdrawingYESDreamy's LoungeNOhttps://nicecrew.tv/w/d77HpHEKZmC3kPDxmvDnWRhttps://nicecrew.tv/lazy-static/thumbnails/34767d71-93aa-4091-98cc-7ba5159b95b6.jpgSlow Painting: FeramithI wanted to trying painting in Krita, becuase why not. I wish I can speed up the footage with youtube editor. I'll make this my 400+ sub special too, because why not. Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/6208439f-c88a-4623-a087-992021307eb9/66c39af3-65c3-4b13-99ef-0bc4cbcb9b16-master.m3u8https://nicecrew.tv/videos/embed/d77HpHEKZmC3kPDxmvDnWR4086002024-12-15T02:26:38.364ZDrawingillistrationKritaRD2092019YESDreamy's LoungeNOhttps://nicecrew.tv/w/4QkC5i3PaHHVUiBV3Py75ihttps://nicecrew.tv/lazy-static/thumbnails/2f76c50e-134e-44f9-85cb-1c72ed0fad36.jpgPainting: Sissel and the Green phoneA little digital painting I made alongside other little paintings I made before recording. I'll add a few more characters in there as well. Please Enjoy! Finished Drawing compilation:https://nicecrew.tv/static/streaming-playlists/hls/1f0b359b-a557-4b31-88d1-c47ce426c5c1/e0b76ecd-44d6-4579-8a84-8e7ee01cb935-master.m3u8https://nicecrew.tv/videos/embed/4QkC5i3PaHHVUiBV3Py75i2552002024-12-15T02:25:12.466ZdrawingRD209vibrantSisselYESDreamy's LoungeNOhttps://nicecrew.tv/w/bvQSCUEG94s8ekdDVmWJEKhttps://nicecrew.tv/lazy-static/thumbnails/63ec7d6f-8767-45b1-a44e-34e09645cf32.jpgMy Ds, 3ds & Switch game collection and moreJust wanted to show you guys my ds, 3ds and Switch games since I last uploaded my GBA collection. I hope you guys enjoyed the video --Always take good care of your game systems--https://nicecrew.tv/static/streaming-playlists/hls/55261333-ef4b-40e3-91f8-55d842ecfabf/a77700dc-0da0-4deb-a011-bc547faaf113-master.m3u8https://nicecrew.tv/videos/embed/bvQSCUEG94s8ekdDVmWJEK485002024-12-15T02:22:41.934ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/ujDMuv82XrWjGWFvFSac5mhttps://nicecrew.tv/lazy-static/thumbnails/cae2f9a1-a39e-4474-ace4-fd5089bdef90.jpgSpeed Drawing: Mr.ZebbraA character I saw in a dream once sing for his band mate who look just like him. Sorry that the camera got out of focus near the end. I’ll do some touch ups on the drawings to make the lines more darker. Please enjoy! It’s been a while since I uploaded. Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/e55a8e46-816c-4014-a052-aa1253425230/4f529be4-a625-4de2-8ed9-dae812c587cf-master.m3u8https://nicecrew.tv/videos/embed/ujDMuv82XrWjGWFvFSac5m26002024-12-15T02:21:37.064ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/ryvpKafi27YvCdYvWWWkXVhttps://nicecrew.tv/lazy-static/thumbnails/a1901f28-87b1-4153-a85c-2960ed2bbd0f.jpgDrawing: Two Spooky twinsSince I haven't made a video in the last month, I might as well draw something spooky the best way I could. I think I did pretty good with this one. (And whiting out the first twin's mouth a few times and such) And I hope you all have a good October and Halloween. This was also inspired by a twitter poll I made because why not. Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/cefe642d-3915-4b08-8d34-853ab43e8527/72eece7c-bb5e-4d0f-91d6-19a09df25de2-master.m3u8https://nicecrew.tv/videos/embed/ryvpKafi27YvCdYvWWWkXV59002024-12-15T02:22:04.817ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/4YwiuhpY7yjH2r5LvrQJHdhttps://nicecrew.tv/lazy-static/thumbnails/6518e73d-8ef2-43ba-ab29-cbf36f947673.jpgSpeed drawing: Spidney The Crane flyJust wanted to draw a crane fly, I was wondering what those bugs were called. Please enjoy! Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/202fbdb6-bcdb-45e3-9dbe-d451b413d66e/7ad385f1-1d5e-4990-819f-6cfeaeb5de42-master.m3u8https://nicecrew.tv/videos/embed/4YwiuhpY7yjH2r5LvrQJHd22002024-12-15T02:22:00.756ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/dYrNKtfNoHBsJ7x1V4Rwn3https://nicecrew.tv/lazy-static/thumbnails/390a6a34-7a8a-4f6f-9c03-7a521499b966.jpgDrawing Eyegirl cosplaying Hatsune MikuAnother eyegirl drawing, except she's dressed as a lolita Hatsune Miku. Please enjoy! Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Eyegirl-cosplaying-Hatsune-Miku-833339518https://nicecrew.tv/static/streaming-playlists/hls/690f37f4-1544-4eb7-80c7-157d0771f174/d3011efb-851b-4c7b-a2a1-7d3539ffa3e9-master.m3u8https://nicecrew.tv/videos/embed/dYrNKtfNoHBsJ7x1V4Rwn36606002024-12-15T02:37:10.005ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/ckC1v6KhDerpxZbQFvUSpQhttps://nicecrew.tv/lazy-static/thumbnails/3c265bee-fdba-4163-969f-0cbed4f1c956.jpgSpeed drawing: Despino and her homeDespino is a roach hermit that also lives in a tent she and her neighbors made and she also lives in a big plastic square bin with other bugs living with her as well. I hope you all enjoy the video and have a good day, and always wash your hands! I just wanted to add a few touches off screen as well. Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Despino-and-her-home-838307516https://nicecrew.tv/static/streaming-playlists/hls/5bd1d917-1e09-4472-8212-eecfba8db4be/677bca11-de10-45cd-a6cb-a5c6b2c46042-master.m3u8https://nicecrew.tv/videos/embed/ckC1v6KhDerpxZbQFvUSpQ33002024-12-15T02:22:19.094ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/qT7SVpRkKe9d16WQgzdQEnhttps://nicecrew.tv/lazy-static/thumbnails/12f7156d-f861-4456-aa4a-a33127dcee68.jpgSpeed Drawing: Girl and Her GhostI just got some new supplies yesterday while I was shopping with my mom, and got two new sketchbooks, for general sketches and for mixed media. Anyways, I hope you all like this drawing. Sorry if the colors look a little muddy btw. I added some little touches off camera as well. Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Girl-and-Her-Ghost-845457023https://nicecrew.tv/static/streaming-playlists/hls/c97e7fb1-02b8-442e-a6a1-73b02109d4c1/e15dcc84-03a9-483d-b076-cd0bdf9f2387-master.m3u8https://nicecrew.tv/videos/embed/qT7SVpRkKe9d16WQgzdQEn118002024-12-15T02:22:38.247ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/3h7U3buz3ZFNApBvcbJy7jhttps://nicecrew.tv/lazy-static/thumbnails/631f0487-7a32-454d-8b85-9374a5901e16.jpgSpeed drawing: Heros From Another WorldJust wanted to make up some more superhero characters based around a movie I’m trying to remember, I’ll still look for this low budget film with bad effects I once saw on Netflix in 2017 Anyways, thanks for watching this video and you can sub to me if you enjoy speed drawing videos or normal drawing videos. Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Heros-From-Another-World-848213706https://nicecrew.tv/static/streaming-playlists/hls/12726d9d-e4d7-4680-b39a-3ebc4a01b0be/721ac76a-4f40-4f23-aa52-82be670e8a76-master.m3u8https://nicecrew.tv/videos/embed/3h7U3buz3ZFNApBvcbJy7j29002024-12-15T02:22:35.977ZSpeeddrawMarkersRD209Rainbowdoodler209YESDreamy's LoungeNOhttps://nicecrew.tv/w/rsifoh5gvq4T8TpoyZ18CAhttps://nicecrew.tv/lazy-static/thumbnails/681ec47a-a529-40ec-9ab3-887fe651eced.jpgSpeed Drawing: Toxino The Angel MaidI just wanted to make another maid character after sketching some sad looking maids while listening to Yukai The Maid albums. I did do some finishing touches off camera, and I hope you all enjoy this video! Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Toxino-The-Angel-Maid-851258351https://nicecrew.tv/static/streaming-playlists/hls/ce206f19-344d-43bb-8dd6-f480b3d128d6/df32e243-ca72-4b99-94bd-d2db4912ee74-master.m3u8https://nicecrew.tv/videos/embed/rsifoh5gvq4T8TpoyZ18CA120002024-12-15T02:22:54.287ZSpeed drawinganimearttraditionalartmarkerscolored_pencilsYESDreamy's LoungeNOhttps://nicecrew.tv/w/fH1BvivDJb5oZz24Mr2nPehttps://nicecrew.tv/lazy-static/thumbnails/c25d9cda-3898-49de-bcf0-96681cdc71d0.jpgSpeed drawing: Lucyanna In BootstringA little illustration of Lucyanna flying in the city of Bootstring, a city made with a shoestring budget that's run by a princess named Yukina who does her very best to entertain her citizens. I hope you all enjoy this drawing video, how I'm resting my hand now. And I added more of the background and the signature off camera as well. Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Lucyanna-In-Bootstring-853856519https://nicecrew.tv/static/streaming-playlists/hls/7719d025-18ce-47e6-8a97-ec8c82e4ccbf/888122b0-98d2-4ac4-8448-796ec8f6a752-master.m3u8https://nicecrew.tv/videos/embed/fH1BvivDJb5oZz24Mr2nPe78002024-12-15T02:23:05.005ZSpeedartanimearttraditionalartcolored_pencilstimelapseYESDreamy's LoungeNOhttps://nicecrew.tv/w/jJB1bzBzxt5UgwJaRq2Unwhttps://nicecrew.tv/lazy-static/thumbnails/a52a92a7-d3a2-4c42-8b22-54142bf7e39d.jpgSpeed Drawing: Four Dead GirlsA drawing of girls that passed away from freak accidents, I just wanted to make a drawing with more blood tbh. I hope you all enjoy, I'll still do my usual drawing videos even with my named changed. Have a nice evening, day or night! Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/97b74e40-abe7-4e85-a118-0b674c3a3cb8/c85cff42-d5a8-4cfb-adae-c69b76f62adc-master.m3u8https://nicecrew.tv/videos/embed/jJB1bzBzxt5UgwJaRq2Unw79002024-12-15T02:22:51.417ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/4GYs43he2kamYaLRELCmryhttps://nicecrew.tv/lazy-static/thumbnails/b9845734-af53-4c22-bae5-bf34cf69446e.jpgQuick Painting - Casual HK416Just wanted to try out videopad's speed up feature, and I did make another version where it's 57 seconds but it was low quality so I posted that version on my Vidlii instead. I just wanted to make a quick painting of HK416 wearing causal clothes, because why not. Please enjoy this video. I might make another spooky traditional drawing video in early October as well, or in the middle, I'm not sure. Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Quick-Painting-Casual-HK416-856336859https://nicecrew.tv/static/streaming-playlists/hls/1e03f46f-43e2-4462-8a97-cce3275f2ffa/d2e93ff7-43b2-4897-801d-7990fc19eecc-master.m3u8https://nicecrew.tv/videos/embed/4GYs43he2kamYaLRELCmry3122022024-12-15T02:25:53.763ZDrawinganimeartGirlsfrontlineKritaRD209YESDreamy's LoungeNOhttps://nicecrew.tv/w/65vVAU2aT3MT9wDqJUkd1ehttps://nicecrew.tv/lazy-static/thumbnails/1235d343-45c5-403e-8afe-903bbdf7fc71.jpgSpeed Drawing: Sang JinA little traditional drawing I wanted to make of a dead girl named Sang Jin, she originally died from a lobotomy and blood loss from her feet bleeding out from being the shape of her shoes. I hope you all enjoy this quick drawing video. Finished Drawing:https://nicecrew.tv/static/streaming-playlists/hls/291f1c1c-0b83-4f00-8a3a-287cb2757eb5/a3b5a0fb-b7a1-47f2-b4e7-78f0f5c88f60-master.m3u8https://nicecrew.tv/videos/embed/65vVAU2aT3MT9wDqJUkd1e52002024-12-15T02:23:06.991ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/i3rDtX7Pam1c3L6Yb4DkCEhttps://nicecrew.tv/lazy-static/thumbnails/03898a52-9979-4554-a5c1-627a54d6d2a9.jpgQuick Painting - Doomy and Her luggageHere's a little quick digital painting of Doomy and her luggage in the evening on her way home. That's it really, please enjoy! And the free trial for Videopad ran out as well, so yeah. Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Doomy-and-her-luggage-860998635https://nicecrew.tv/static/streaming-playlists/hls/8a02a65a-613b-4e80-8aec-7718ceab47b2/944deeca-15d8-4a5b-91bd-b6eca7399f71-master.m3u8https://nicecrew.tv/videos/embed/i3rDtX7Pam1c3L6Yb4DkCE2096002024-12-15T02:25:09.648ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/dSLY1PnA7KwhMqfEp5aVWqhttps://nicecrew.tv/lazy-static/thumbnails/5e77d5a8-0bd3-4f1a-9a29-4330a95326b2.jpgQuick Painting - Pinkule The Yulkoon (Gore Warning)Another quick digital painting, I was going to post my geography girl based off of Germany, but I didn't triple check on my recording input and I ended up making the dark grey's of this new drawing too dark for you all to see. But don't worry, I did finish the drawing, it's just not released yet, I will post my German Geo-Girl first before posting this one. And I wanted to make another horror drawing for fun. Please enjoy! Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Pinkule-The-Yulkoon-863532762https://nicecrew.tv/static/streaming-playlists/hls/68449045-1481-4e6e-a88b-498a29780050/907331a6-3a9e-44db-9ff3-c23814a2e032-master.m3u8https://nicecrew.tv/videos/embed/dSLY1PnA7KwhMqfEp5aVWq3494002024-12-15T02:27:15.271ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/gizEC4A7g1b3rkeD5xjr7Lhttps://nicecrew.tv/lazy-static/thumbnails/538fd1f4-0fe0-4671-a214-84a21ed96359.jpgSpeed Drawing: Key Lime DressJust wanted to make a lolita outfit based off of Key Lime Pie, because why not. I hope you guys enjoy the video overall. Finished Drawing:https://nicecrew.tv/static/streaming-playlists/hls/7bed78a9-4a45-4571-a451-996c497f710c/d20eb278-390b-418b-843e-0c0992b7d33a-master.m3u8https://nicecrew.tv/videos/embed/gizEC4A7g1b3rkeD5xjr7L71002024-12-15T02:23:22.156ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/9aWeKEV1bn1FmrAwXvdckZhttps://nicecrew.tv/lazy-static/thumbnails/d0dffc88-bc01-4d8c-a113-cc615956249d.jpgSpeedPaint: Girl In RedJust wanted to make an acrylic painting on camera, I might even touch up this painting sometime. Please enjoy! Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Girl-In-Red-869565749https://nicecrew.tv/static/streaming-playlists/hls/422c3a5f-b014-42c8-8926-34c4026ddca3/19de17a3-1e80-47fa-876e-cbd65f53d191-master.m3u8https://nicecrew.tv/videos/embed/9aWeKEV1bn1FmrAwXvdckZ171002024-12-15T02:23:44.480ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/ha5Lt5z52QUGEjrbfM1H72https://nicecrew.tv/lazy-static/thumbnails/9b1d5286-79ac-4506-a368-edb635ed1a63.jpgSpeed Drawing: Grey Sunset SpiderGirlHere's an illustration of a grey spider girl with some warm colors on her, I did add some finishing touches off camera. I hope you all enjoy! I'll post the drawing when the sun is shining. Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Grey-Sun-Set-SpiderGirl-872799532https://nicecrew.tv/static/streaming-playlists/hls/82d6d99d-303b-482d-966f-9a13bb34e9b1/21925685-eccc-4e9e-b6a5-4dd36b23984d-master.m3u8https://nicecrew.tv/videos/embed/ha5Lt5z52QUGEjrbfM1H7266002024-12-15T02:23:43.187ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/aiVMiCtZsZCnPnvSMj35mYhttps://nicecrew.tv/lazy-static/thumbnails/534f4aab-3524-42ab-9673-af1f0e1e9f2f.jpgSpeed Drawing: This is OkI just wanted to draw my maidcore persona again, and I wanted to draw her looking away and at a city in front of her. I hope you all enjoy this quick drawing video. Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/This-is-Ok-875825391https://nicecrew.tv/static/streaming-playlists/hls/4b63092a-f933-4659-8729-b4eb2d0fcde0/3007ae65-f52e-4413-ba7b-aad5f2355df6-master.m3u8https://nicecrew.tv/videos/embed/aiVMiCtZsZCnPnvSMj35mY44002024-12-15T02:23:39.681ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/f3x5Yg4iJA6gYsAq6RbrXphttps://nicecrew.tv/lazy-static/thumbnails/519cca4a-6da3-4cd2-a449-58c955b4e005.jpgSpeed drawing: Groggy-san and the blue hillHere's another traditional speed drawing video, I wanted to draw Groggy-san wearing a gothic lolita dress. I hope you all enjoy, and I also added a few touches to this drawing off camera as well. I'll post the drawing while the sun is out. Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Groggy-san-and-Blue-Hill-881512301https://nicecrew.tv/static/streaming-playlists/hls/71ba9605-30ad-4733-95c7-4fbc6dbd0fd1/3491ad64-81f0-4656-881d-9a3b037fd336-master.m3u8https://nicecrew.tv/videos/embed/f3x5Yg4iJA6gYsAq6RbrXp96002024-12-15T02:23:48.561ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/6iz3r8cTR56Rg41MMHseAShttps://nicecrew.tv/lazy-static/thumbnails/aeba2021-a229-438a-aedc-f66853651792.jpgSpeed Drawing: Yippy UmoI was originally going to give her black hair and a hat but I decided to give her a different design entirely. Anyways, I hope you all enjoy. I'll add some music to this one because why not. Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Yippy-Umo-884565153https://nicecrew.tv/static/streaming-playlists/hls/2af1b341-5a2b-4468-ac83-0c4aae3f4dba/3c5ee230-ed51-4220-8cc2-214286b4c334-master.m3u8https://nicecrew.tv/videos/embed/6iz3r8cTR56Rg41MMHseAS113002024-12-15T02:23:52.068ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/ts21ix1SUz7W36w8Sbgm6Qhttps://nicecrew.tv/lazy-static/thumbnails/4f31d199-abc1-408b-856c-be7cd2c01ca8.jpgSpeed Drawing: Pink Monster Man and friendsJust wanted to draw another fleshy hairless monster, I hope you all enjoy this strange illustration. Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Pink-Monster-Man-And-Friends-887742586https://nicecrew.tv/static/streaming-playlists/hls/de48b389-f687-4a42-bf50-e1ac87d8a41a/03ba7edc-383c-488b-92f5-2ef9fcd945ee-master.m3u8https://nicecrew.tv/videos/embed/ts21ix1SUz7W36w8Sbgm6Q88002024-12-15T02:23:56.629ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/e6erNdn3e6pNmsd8ZtfW2Lhttps://nicecrew.tv/lazy-static/thumbnails/53f672e2-81fb-4289-88bf-9a4dce84a47f.jpgSpeed Drawing: Motivational Bootstring PosterHere's a drawing of one of the posters that would appear, mostly in stores, factories, and restaurants in Bootstring. I couldn't think of a fitting song for this one. Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Motivational-Bootstring-Poster-891107526https://nicecrew.tv/static/streaming-playlists/hls/6a01ce9b-d03c-4059-9e6e-a5dc4970113e/7536b312-11f6-489d-8459-f11d1d567d02-master.m3u8https://nicecrew.tv/videos/embed/e6erNdn3e6pNmsd8ZtfW2L106002024-12-15T02:23:54.491ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/7XQKLTbMhtTVWSaNTyWX8Vhttps://nicecrew.tv/lazy-static/thumbnails/1e4280cc-a954-46f7-834e-b2952ed05e32.jpgSpeed Drawing: Green JesterHere's another drawing video, I wanted to make another drawing, since I might as well make another one later in the month. I hope you all enjoy! Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Green-Jester-892356982https://nicecrew.tv/static/streaming-playlists/hls/3862c914-db4f-47c9-b7fa-02c1553ed1d7/a87e8102-b0a4-4f71-9e40-278591d1ad28-master.m3u8https://nicecrew.tv/videos/embed/7XQKLTbMhtTVWSaNTyWX8V103002024-12-15T02:24:07.587ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/rLbsRBC6mqngHD2Ttb9hxNhttps://nicecrew.tv/lazy-static/thumbnails/c83e9aaf-c85f-49b3-b891-f8c6c41e2d7f.jpgSpeed Drawing: Pumpkin Lolita RoachAnother roach lolita idea, I couldn't think of a better design for the outfit. But I hope you all enjoy and such. Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Pumpkin-Lolita-Roach-894209847https://nicecrew.tv/static/streaming-playlists/hls/d09fa3f4-603b-4772-9454-511ba22e5174/ba68854f-3f74-45fa-8513-b6ff47cc11e8-master.m3u8https://nicecrew.tv/videos/embed/rLbsRBC6mqngHD2Ttb9hxN83012024-12-15T02:24:05.387ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/wx4Ms84HppAhdRsnwTVnGKhttps://nicecrew.tv/lazy-static/thumbnails/ba4ac5ce-5f3a-4b2b-9b41-cf311fba2cf5.jpgSpeed Drawing: Green GirlHere's a drawing video of a girl that's colored green, I hope you all enjot this little drawing. Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Green-Girl-897106548https://nicecrew.tv/static/streaming-playlists/hls/f7488c64-c75b-46c1-8e06-c0e2e7bac7a7/39c8d0bd-2e16-4828-8471-dce78055bcf3-master.m3u8https://nicecrew.tv/videos/embed/wx4Ms84HppAhdRsnwTVnGK66012024-12-15T02:24:19.728ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/1FNF6PqD4WJpk2Q5hCSiT6https://nicecrew.tv/lazy-static/thumbnails/eae78fbc-eb3c-41a2-8623-d08c8b003ab3.jpgSpeed Drawing: Bloody Wings (Test + Bloody/Gore Warning)Here's a little digital painting, please enjoy and stuff. This is mainly a little test video, sorry for the quality being a little low by the way. Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Blood-Wings-898534486?ga_submit_new=10%3A1637497155https://nicecrew.tv/static/streaming-playlists/hls/058ec55f-c79a-408d-9482-af2122f48307/9226bbf6-fe77-437f-a6a2-a7bb2998f719-master.m3u8https://nicecrew.tv/videos/embed/1FNF6PqD4WJpk2Q5hCSiT6479002024-12-15T02:24:56.658ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/njHbC5WKKw4RboXjRhfypBhttps://nicecrew.tv/lazy-static/thumbnails/4d50bce5-8caf-44e6-841b-554512b77bb3.jpgSpeed Drawing: Angel N CrowbarHere's a drawing of a Limboist man holding his crowbar, I'm still thinking of a name for this guy, he's the Limboist leader's right hand man that always supporting her in any way. Please enjoy! Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Angel-N-Crowbar-900954608https://nicecrew.tv/static/streaming-playlists/hls/acacae02-ea48-44b4-8a54-a331c1b2b4a9/5fec42b3-17e6-4b4b-8681-df088ea1cbd3-master.m3u8https://nicecrew.tv/videos/embed/njHbC5WKKw4RboXjRhfypB1404012024-12-15T02:24:59.410ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/okaxGWhcWwGjjriuE3bFmdhttps://nicecrew.tv/lazy-static/thumbnails/a0d2ac0d-0723-4741-a5b2-94cc094fff3e.jpgSpeed Drawing: Lucyanna Vs MissatrioHere's an illustration of Lucyanna fighting Missatrio with the sword of Happiness, and it's Lucyanna's birthday, so I might as well celibrate it with a speed drawing video. I hope you all enjoy, I just hope the video doesn't lag too much. Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Lucyanna-Vs-Missatrio-903093350?ga_submit_new=10%3A1641555122https://nicecrew.tv/static/streaming-playlists/hls/b4d610c3-7b75-4ce1-a6a3-b56ddb4f1100/7fb9936a-2d9b-427c-9d80-4f2c499f0aad-master.m3u8https://nicecrew.tv/videos/embed/okaxGWhcWwGjjriuE3bFmd2051002024-12-15T02:26:51.787ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/aBLAR8qqMqNfavdFckL3jRhttps://nicecrew.tv/lazy-static/thumbnails/c5d0a027-484e-44c7-9da2-69f3a408b929.jpgSpeed Drawing: Nitza In The Red VoidI couldn't think of a better title for this drawing, I wanted to draw Nitza for a drawing video, I know she's antagonist, but yeah. Please enjoy this video. I might make another video this month, I'm not sure. Sorry for the video being in bad quality as well, dang it... Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Nitza-In-The-Red-Void-906169126?ga_submit_new=10%3A1644145190https://nicecrew.tv/static/streaming-playlists/hls/4de0c420-3184-43be-b0c0-a8d339dd643d/984dbf98-c74e-41e6-9faf-d00c831ebca2-master.m3u8https://nicecrew.tv/videos/embed/aBLAR8qqMqNfavdFckL3jR2075002024-12-15T02:27:20.030ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/x6cFz7GLi5g7CHfeGtaxRYhttps://nicecrew.tv/lazy-static/thumbnails/b7acb491-bf5e-4883-b6cd-0c2497aa5581.jpgSpeed Drawing: Anmao In Lolita DressHere's Anmao dressed in a lolita dress, this is mainly because I like drawing frilly cutr dresses sometimes, I never thought drawing lolita dresses could be so fun. Anyways, please enjoy the video. Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/fbc5377d-613f-409c-85ae-3f7bb8c95506/68ae2556-6434-4ed1-abd3-94c978175b97-master.m3u8https://nicecrew.tv/videos/embed/x6cFz7GLi5g7CHfeGtaxRY99002024-12-15T02:24:58.312ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/n5pu3NVS4VnK9owczCdyMThttps://nicecrew.tv/lazy-static/thumbnails/ef5d7325-77d3-47ec-854e-4885299c5f1a.jpgSpeed Drawing: Human SlicerHere's a stiched chilling out covered in blood, these types can slice a human like a slice of pie. Anyways, please enjoy, I hope you all enjoy! Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Human-Slicer-908764809https://nicecrew.tv/static/streaming-playlists/hls/aaad5bf5-bfc3-4f8d-aab5-099a3ac5f265/ee9e147b-cf37-4d6e-9d04-a816efc89ecd-master.m3u8https://nicecrew.tv/videos/embed/n5pu3NVS4VnK9owczCdyMT88002024-12-15T02:24:59.899ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/kwuUjBDevc6qUo7CTMJGs3https://nicecrew.tv/lazy-static/thumbnails/d81f3714-bc83-4fa4-ba8a-93f9ac8c8046.jpgSpeed Drawing: Jester MonsterHere's an odd drawing of a Jester, please enjoy. Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Jester-Monster-911876831https://nicecrew.tv/static/streaming-playlists/hls/9e1fc259-cb01-49b1-ba59-f8069565eec6/9fb55ae0-048d-4823-bb25-d0d0f3065861-master.m3u8https://nicecrew.tv/videos/embed/kwuUjBDevc6qUo7CTMJGs31142002024-12-15T02:25:56.431ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/kWcRkAs7EZUTvo84AXUfv6https://nicecrew.tv/lazy-static/thumbnails/0a08e9e1-1cd1-48f7-9de0-900c0a296e2e.jpg(500+ Sub Special) Speed Drawing: BitterRose in a graveyardHere's another horse girl just chilling out in a grave and reading tombstones as a pastime in warm nights. Finished art: https://www.deviantart.com/rainbowdoodler209/art/BitterRose-In-a-Graveyard-915034197https://nicecrew.tv/static/streaming-playlists/hls/a16f19f1-a8e9-4ae8-8d10-315365e13c9f/6b46536b-20a3-4997-95df-df38ddb4d7b5-master.m3u8https://nicecrew.tv/videos/embed/kWcRkAs7EZUTvo84AXUfv6132012024-12-15T02:25:12.952ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/3E4BhE1cXD4dgxp3Vnc871https://nicecrew.tv/lazy-static/thumbnails/e8fc7eff-9fce-4a1a-8cf0-821a6a0c5849.jpgSpeed Drawing: Man In LimboHere's a limboist man walking in limbo holding a street light, and I wanted to add water color and acrylic to this one this time, since I'm using my mixed media sketchbook. Anyways, I hope you all like this video, hopefully I'll finish my "talk about" video this month, since I want to make a new one. Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Man-In-Limbo-918605359https://nicecrew.tv/static/streaming-playlists/hls/1582c3ab-7638-4437-854c-1f3733f84480/694667c8-bc16-4e50-a6db-e44cc99c2988-master.m3u8https://nicecrew.tv/videos/embed/3E4BhE1cXD4dgxp3Vnc871236022024-12-15T02:25:17.828ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/bdD8abU6aZVrYav6o7p5jwhttps://nicecrew.tv/lazy-static/thumbnails/0b732cce-c0cc-442f-9eab-19dc7fe41c0a.jpgSpeed Paint: Ameri-Chan Under The MoonHere's a painting of Ameri-chan, I also added more stuff in the background off screen, I might make another Ameri-Chan drawing video for tomorrow too, because why not. Please enjoy! Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Ameri-Chan-Under-The-Moon-921333982https://nicecrew.tv/static/streaming-playlists/hls/52bf30a1-46ed-41d5-bbba-2a59d46c813a/756bd6b0-bd49-48ec-8dec-7fb5d49a0277-master.m3u8https://nicecrew.tv/videos/embed/bdD8abU6aZVrYav6o7p5jw198002024-12-15T02:25:28.077ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/kij4NG1c8XNBHAzPV1iiwQhttps://nicecrew.tv/lazy-static/thumbnails/12be6fb8-3685-4cad-af68-b4e4f1ac89db.jpgSpeed Drawing: Ameri-Chan in Stars and StripesAnother drawing of Ameri-Chan, but with her wearing stars and stripes. That's it really. Please enjoy and stuff. Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Ameri-Chan-In-Stars-and-Stripes-921357845https://nicecrew.tv/static/streaming-playlists/hls/9c486975-c7d2-4690-a213-2d04a342b568/2f3ddc49-73ba-45b8-80e5-55c2564fb709-master.m3u8https://nicecrew.tv/videos/embed/kij4NG1c8XNBHAzPV1iiwQ114002024-12-15T02:25:20.802ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/1667xeHjUuhAoojQz1yqVGhttps://nicecrew.tv/lazy-static/thumbnails/08b17aea-eb37-4422-bc01-e2334ccd5ef9.jpgI talk About: Sweets + Speed DrawingSorry, I mainly reuploading for trimming out the obs stuff. Anyways, I hope you all enjoy this I talk about video, and uh yeah. Please enjoy. Edit: I should've let the drawing part of the video play out the end, oh well, I'll do better next time. Finished Drawing:https://nicecrew.tv/static/streaming-playlists/hls/00b5dea3-9eaa-460f-a67d-96236858792a/a9bf5253-fec3-41d8-9e83-d529721e5c4c-master.m3u8https://nicecrew.tv/videos/embed/1667xeHjUuhAoojQz1yqVG171002024-12-15T02:25:34.783ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/heN7THLRVQtg4ZxjSaBWE5https://nicecrew.tv/lazy-static/thumbnails/04a970ca-5926-4268-9f41-5ed5dc8be730.jpgSpeed Drawing : Shannica SunflowersHere's a drawing video but with Shannica wearing an outfit based around Sunflowers and chilling outside behind a field of sunflowers. Please enjoy. Finished Drawing:https://nicecrew.tv/static/streaming-playlists/hls/837f4f2e-90b5-4d32-8208-a39b43c46180/ebed8539-55d3-474f-a99c-aba0d6eb62ff-master.m3u8https://nicecrew.tv/videos/embed/heN7THLRVQtg4ZxjSaBWE51080002024-12-15T02:26:54.491ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/4jQgrDfRS2e662SVUSoBVUhttps://nicecrew.tv/lazy-static/thumbnails/5dbf8856-4144-425a-8798-f07f0fbb04da.jpgTest Animations (Silent)Here's a bunch of randomly animated stuff I sketched up in the is black and white animation, I don't think any of these small animations have any meaning either, so yeah. I hope you all enjoy these little animations made in Krita. I still hope I'll make more of these in the future, I do want to mix it up for my channel.https://nicecrew.tv/static/streaming-playlists/hls/1aec8c89-3f8a-419c-bf55-e12a0fc41072/2d7764eb-2ee3-47bc-9574-7ceb457d0e92-master.m3u8https://nicecrew.tv/videos/embed/4jQgrDfRS2e662SVUSoBVU46002024-12-15T02:25:21.060ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/oUTWaThKZKnDuVPpMP7voWhttps://nicecrew.tv/lazy-static/thumbnails/0b26137f-1e94-4461-998d-621ce4b30d7a.jpgScribble And Tree (Animation)Here's a really short video of a scribble helping a tree grow, I hope you all enjoy this little animation. I made this animation using Krita and put the frames and put them through VSDC's animation segment. If Krita has problems rendering an animation again, I'll do it this way just in case. Thanks for watching, and sorry for the animation looking low quality.https://nicecrew.tv/static/streaming-playlists/hls/b98bbb64-da16-49f6-8c63-827a9abc0886/5a3a9325-6a1b-48ae-8ee5-6936d05dfa27-master.m3u8https://nicecrew.tv/videos/embed/oUTWaThKZKnDuVPpMP7voW11002024-12-15T02:25:23.644ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/1eexbhDfbvRKuwcZJmmPhBhttps://nicecrew.tv/lazy-static/thumbnails/d098f358-680e-458e-a001-2b1dbefd4322.jpgMeat Pie (Animation)Here's another short animation, I hope you all enjoy this one. I really enjoyed making this one.https://nicecrew.tv/static/streaming-playlists/hls/01d90306-5d9e-4049-abfb-b0a735649bbf/38a518cf-2377-46bc-8c83-c6bd0c649dcb-master.m3u8https://nicecrew.tv/videos/embed/1eexbhDfbvRKuwcZJmmPhB4002024-12-15T02:25:31.676ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/eRniA62HB4tThQbXD8mhQGhttps://nicecrew.tv/lazy-static/thumbnails/910f866f-a4fc-4928-bdc2-8d0265711aa2.jpgRainbow YulkoonAnother quick animation, but with my Yulkoon characters. Please enjoy, sorry about this one not lasting too long.https://nicecrew.tv/static/streaming-playlists/hls/702b603a-b28c-4b7e-bc4c-e8a5d95748b8/186fba8a-3caa-4df4-aea2-52a9b80a9295-master.m3u8https://nicecrew.tv/videos/embed/eRniA62HB4tThQbXD8mhQG4002024-12-15T02:25:33.167ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/rUQEGutxqETDzbjF8TZWfMhttps://nicecrew.tv/lazy-static/thumbnails/53dc614a-97fe-48d8-8d87-ecf681254cb8.jpgBitterRose Walking And StuffHere's a little animation of BitterRose walking in her neighborhood, I wish I made this one a little longer, oh well, I hope you all enjoy this.https://nicecrew.tv/static/streaming-playlists/hls/d1d52280-79d6-4b1e-81b2-7a90bd438e29/4d51a2b2-1f13-45c0-86b8-e6c1554756c1-master.m3u8https://nicecrew.tv/videos/embed/rUQEGutxqETDzbjF8TZWfM10002024-12-15T02:25:37.001ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/maQXtX7GY6S7KM1QFyFDQ1https://nicecrew.tv/lazy-static/thumbnails/9dc09ccb-d636-4613-86aa-6abfb190d942.jpgUpcoming Winter AnimationHere's a short animation based around Winter coming around the corner, I hope you all enjoy this one.https://nicecrew.tv/static/streaming-playlists/hls/a356a340-1bb1-4a20-9c25-b6fe8b46c98c/09cfdbf3-31a4-493a-912f-01d88dfdf568-master.m3u8https://nicecrew.tv/videos/embed/maQXtX7GY6S7KM1QFyFDQ18002024-12-15T02:25:40.072ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/taetkDCqJkxJJRvMam6VaVhttps://nicecrew.tv/lazy-static/thumbnails/d9c11b15-fe6e-4070-a1bd-6a69fb142ffe.jpgSpeed Drawing: Angel Of WaterA little drawing of angel with a big jar of clean water, I might add a few more things in the drawing off screen as well so yeah. Please enjoy! Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Angel-Of-Water-939280136https://nicecrew.tv/static/streaming-playlists/hls/dbf0bd61-8288-41e0-8637-61a29b85141b/14f9e461-8f0c-4765-b938-7f1bb8541593-master.m3u8https://nicecrew.tv/videos/embed/taetkDCqJkxJJRvMam6VaV60002024-12-15T02:25:46.740ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/aAigkJkLGKfaKrTpkdj1p5https://nicecrew.tv/lazy-static/thumbnails/ce38584d-5267-41f0-98cf-91b4ff4d6d2b.jpgSpeed Drawing: Capetta LisaHere's Capetta holding cold green money, at least the symbol for it. Finished Drawing:https://nicecrew.tv/static/streaming-playlists/hls/4dac2cfd-1e09-4c35-8553-6e2d448475ea/0a08a06b-76a5-4303-b43d-042c8d4f5b0b-master.m3u8https://nicecrew.tv/videos/embed/aAigkJkLGKfaKrTpkdj1p560002024-12-15T02:25:47.952ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/fMnFRQGzrrtfkyyJMDRrvvhttps://nicecrew.tv/lazy-static/thumbnails/79bfd28c-b0f7-4d29-809a-be5c2f5cb926.jpgSpeed Drawing: The Christmas BridgeHere's an illustration of a girl with her flying reef pet going over the Christmas Bridge. I hope you all enjoy this one, and Happy Holidays! Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/The-Christmas-Bridge-942197487https://nicecrew.tv/static/streaming-playlists/hls/77b5c6af-c9ee-4cec-82bd-bde99ef305cb/7f0015b1-1dd7-4a30-9bcd-b70f6f56e372-master.m3u8https://nicecrew.tv/videos/embed/fMnFRQGzrrtfkyyJMDRrvv231002024-12-15T02:26:01.200ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/3wtoWEw2oFPcWazSAMPEechttps://nicecrew.tv/lazy-static/thumbnails/52512795-0a12-4770-b00b-38cd768b2473.jpgYulkoon In Purple [Medibang]A Medibang drawing I made, hopefully I’ll record all of the drawing process. Please enjoy! Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Yulkoon-in-Purple-942781339https://nicecrew.tv/static/streaming-playlists/hls/14737939-81cf-47e6-9b57-e3acd56f1abd/a0bb98ab-6d4c-4c7c-b0e8-97b756a5f712-master.m3u8https://nicecrew.tv/videos/embed/3wtoWEw2oFPcWazSAMPEec30002024-12-15T02:25:53.792ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/qRmjJExqj31AXxsb99J7jrhttps://nicecrew.tv/lazy-static/thumbnails/e2d9bcde-fc86-4a8b-9092-fed8889ff1af.jpgSpeed Drawing - Lucyanna's Birthday CakeHere's a drawing video of Lucyanna seeing her birthday cake in the middle of the dark blue mountains. (I'll add the thumbnail for this drawing later.) Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Lucyanna-s-Birthday-Cake-944314332https://nicecrew.tv/static/streaming-playlists/hls/c93f4c0d-769a-4b40-b2af-72d9c06f9f95/b108bd4d-6907-4ef7-aa68-451cc6a33e79-master.m3u8https://nicecrew.tv/videos/embed/qRmjJExqj31AXxsb99J7jr798002024-12-15T02:26:41.361ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/hd7jcgtY2M4TgsBNT2dy8bhttps://nicecrew.tv/lazy-static/thumbnails/4efe3131-f885-4f56-943a-44fa6b342e12.jpgTimelapse: 生病死 (Ms.Illness)A girl thats based around pills that can make you sick, you guys can guess the types of irl pills. Please enjoy this short little video, I also drew this with infinite Painter. Finished Drawing: https://www.plurk.com/p/p4j8q8https://nicecrew.tv/static/streaming-playlists/hls/834308e5-82cd-4f8b-bea0-0dd5fa8c7ef0/54d10000-8514-494c-8031-0fb3065dc384-master.m3u8https://nicecrew.tv/videos/embed/hd7jcgtY2M4TgsBNT2dy8b180002024-12-15T02:25:56.127ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/eCkmADsYVFYJid8nN9SfkShttps://nicecrew.tv/lazy-static/thumbnails/18235769-8bbc-4ab5-8db1-2a47b26ca81e.jpgTime Lapse: Star In The DarkHere’s another infinite painter time lapse video, I’m happy with how this turned out in the end. So I hope you all enjoy and have a nice morning. Finished Drawing: https://side7.com/content/6NrJpJlwMQhttps://nicecrew.tv/static/streaming-playlists/hls/6e59819e-3772-46fe-b07e-905585df4e48/5693ce9c-96ff-4890-a909-ec44cd00b89a-master.m3u8https://nicecrew.tv/videos/embed/eCkmADsYVFYJid8nN9SfkS120002024-12-15T02:26:03.263ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/sCjJFpqfrsoMb9Bziqwkuqhttps://nicecrew.tv/lazy-static/thumbnails/62d8c48a-442b-4ba6-a922-64dd832c765f.jpgSpeed Drawing: Virus-Chan And FriendsA drawing video of Virus-Chan and her friends that infects computers ever since they're invented. Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Virus-chan-And-Friends-945987366 ALT Art Link: https://side7.com/content/lpMjVn6wM4https://nicecrew.tv/static/streaming-playlists/hls/d79fed60-cd33-44b7-af21-d335445b27ac/ea5c8641-f351-46c3-bf5d-2bb354526454-master.m3u8https://nicecrew.tv/videos/embed/sCjJFpqfrsoMb9Bziqwkuq344002024-12-15T02:26:23.996ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/9g2JaxkQ2xrzzCQQ7Gj8Cuhttps://nicecrew.tv/lazy-static/thumbnails/f2253be2-62a4-4a45-891d-683eb95793e2.jpgSpeed Drawing - Veryom And StinkberryHere's a speed drawing of a Veryom with a Stinkberry branch and bush. I hope you all enjoy this one. Finished Drawing: https://side7.com/content/jDMWl4e18Ohttps://nicecrew.tv/static/streaming-playlists/hls/42e25482-71c6-4f90-aeaa-ebc42111e550/74bfcde4-259d-4319-8b58-fd1610283a11-master.m3u8https://nicecrew.tv/videos/embed/9g2JaxkQ2xrzzCQQ7Gj8Cu382002024-12-15T02:26:32.153ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/wwEsvDuMkhdV52hRArsDjDhttps://nicecrew.tv/lazy-static/thumbnails/e4836e90-a05e-4f8c-9ccc-b676cd6ea46c.jpgTime Laspe: Teal WomanAnother Infinite Painter time laspe as some filler, please enjoy. Finished Drawing: https://side7.com/content/b28w0RyKrkhttps://nicecrew.tv/static/streaming-playlists/hls/f73a2c44-a91f-4709-8018-f39a93a2cf8d/0675c989-0210-4110-99c1-8b3bf96d63ab-master.m3u8https://nicecrew.tv/videos/embed/wwEsvDuMkhdV52hRArsDjD120002024-12-15T02:25:58.047ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/xctvgWkmZhXPjYpnNjtgPzhttps://nicecrew.tv/lazy-static/thumbnails/43aac0df-95f8-47c3-8999-58ee46a14e1f.jpgSpeed Drawing - Dreamy-Chan In OffWhiteI wanted to make a drawing of Dreamy-Chan standing in front of the gas station shop she guards, watches for shoplifters, and work at as the owner of the store. I hope you all enjoy this one. Finished Drawing: https://side7.com/content/DjrYmNNnrehttps://nicecrew.tv/static/streaming-playlists/hls/fca56e29-de96-4364-8e76-3854501014bb/e4ae69a1-fe4d-4b56-8bf6-14ce97b4b050-master.m3u8https://nicecrew.tv/videos/embed/xctvgWkmZhXPjYpnNjtgPz393002024-12-15T02:26:42.154ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/pT8s1XmzHneTd9EG3P57nqhttps://nicecrew.tv/lazy-static/thumbnails/c7b4ba48-7748-47f5-bd4a-15a9cba51ba3.jpgTime Laspe: Grey FuzzilonA drawing based around the Pan African flag, because why not, please enjoy! I also want to draw something a little different as well, I might as well draw cartoony characters too. I hope I’ll upload more videos this month. Finished Drawing: https://side7.com/content/DjrYmNNjrehttps://nicecrew.tv/static/streaming-playlists/hls/c165b637-b793-4dd2-a7a7-f130a2495a82/76da414a-adc2-48e0-98f0-4412e0cfb8e1-master.m3u8https://nicecrew.tv/videos/embed/pT8s1XmzHneTd9EG3P57nq120002024-12-15T02:26:04.911ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/eqd3E6wDvg3fL8j4669CVZhttps://nicecrew.tv/lazy-static/thumbnails/180c015d-d6c8-413c-803c-de27619ea4f8.jpgRose Tinted GirlAnother animation I made in Krita. Using Krita to animate is growing on me tbh.https://nicecrew.tv/static/streaming-playlists/hls/6ca81398-ee38-4e86-a084-4f7088788abb/ae8c02f7-c78f-420d-8de9-908789dc3718-master.m3u8https://nicecrew.tv/videos/embed/eqd3E6wDvg3fL8j4669CVZ11002024-12-15T02:26:21.845ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/5B6zrDEJ9Wr2AJk9TJnezbhttps://nicecrew.tv/lazy-static/thumbnails/1a808963-3568-4ca7-8d92-0145b969e154.jpgJester Of Hearts [Medibang]Here's a Valentine's Day character drawing for this month's holiday. I also wanted to draw a Jester for a video as well. Please enjoy, I also made sure to make the video last a little longer, I could've made the video last a few seconds like last time, but yeah. Original Video Length: 11:54:23 Finished Drawing: https://side7.com/content/lpMjQRRz94https://nicecrew.tv/static/streaming-playlists/hls/254b05f6-0e69-45f4-ab96-64a098192ea0/04dac07c-77f4-4462-8790-11ae586899f8-master.m3u8https://nicecrew.tv/videos/embed/5B6zrDEJ9Wr2AJk9TJnezb890002024-12-15T02:27:51.700ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/4xr6anrWT57oCFmWUxm2VKhttps://nicecrew.tv/lazy-static/thumbnails/5857e3bf-aabc-45a9-9f3d-fc9b92a05d73.jpgSpeed Drawing: Cana DariHere's a drawing of a Geography Girl based around Canada. Just wanted to make this for Canada flag day. Please enjoy! Original Video Length: 18:42 Finished Drawing: https://side7.com/content/RErZmnn38ghttps://nicecrew.tv/static/streaming-playlists/hls/1caeef3a-c985-4857-8e4f-91c89275b861/bf28a263-f881-4ac0-af20-bc6dfff91b2b-master.m3u8https://nicecrew.tv/videos/embed/4xr6anrWT57oCFmWUxm2VK510002024-12-15T02:27:38.276ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/8jnA5HuXhDmcc8r3UecjAWhttps://nicecrew.tv/lazy-static/thumbnails/f1df8f1a-5408-4f98-af09-5d8c26200c6b.jpgTime Laspe: Woman In YellowHere’s a drawing that’s themed around different shades of yellow, please enjoy! Finished Drawing: https://side7.com/content/XZ8bpnnl9Ohttps://nicecrew.tv/static/streaming-playlists/hls/3b40a98d-9216-43f6-8f34-6f30242f367a/123343d3-d876-415e-9afc-1230a34d744c-master.m3u8https://nicecrew.tv/videos/embed/8jnA5HuXhDmcc8r3UecjAW120002024-12-15T02:26:42.429ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/2eefdHKvmsitcqDLgiwXaZhttps://nicecrew.tv/lazy-static/thumbnails/d95ef78e-cdd5-4e34-96d7-6bafaea496c4.jpgTime Laspe: Moranna MorieHere’s an illustration of a woman with a gloomy background, and…I guess that’s it. Please enjoy this one. Momento Mori. Finished Drawing: https://side7.com/content/Dn8Ew00x9Nhttps://nicecrew.tv/static/streaming-playlists/hls/09f1f864-ef73-49d4-a0ca-713f8ab9299f/b28d0a92-9412-466f-b3b1-5525a8be243a-master.m3u8https://nicecrew.tv/videos/embed/2eefdHKvmsitcqDLgiwXaZ120002024-12-15T02:26:52.628ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/u4QUz5acjvMspyfvq64ZsGhttps://nicecrew.tv/lazy-static/thumbnails/2609574d-d34f-4411-a799-e1889b64fad8.jpgMany FuzzilonsA little animation of my Fuzzilons doing stuff. Please enjoy.https://nicecrew.tv/static/streaming-playlists/hls/e34940e0-10d3-41bc-b0db-db369cb70818/a1d994aa-92aa-4be6-81c3-3a87fa9928d7-master.m3u8https://nicecrew.tv/videos/embed/u4QUz5acjvMspyfvq64ZsG19002024-12-15T02:26:45.335ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/1sgjQH2uyBpS6RGsndDzP8https://nicecrew.tv/lazy-static/thumbnails/bdde1b65-6d5c-45af-919d-53ca4ecee6e6.jpgI talk About: Circus Aesthetics Plus Drawing VideoHere's a video where I talk about Aesthetics based around the Circus, please let me know if I missed anything for this video. I hope you all enjoy this one, and have a nice day/night. Finished Drawing: https://side7.com/content/zDMLNEElryhttps://nicecrew.tv/static/streaming-playlists/hls/03aac843-62f3-4df4-972b-d67d03557079/5ca65594-a7cd-4be8-8487-6e0d082e63ac-master.m3u8https://nicecrew.tv/videos/embed/1sgjQH2uyBpS6RGsndDzP8338032024-12-15T02:28:13.567ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/hKNBuyqDyQ1dhE6UhoprmGhttps://nicecrew.tv/lazy-static/thumbnails/b4c09070-bd62-419a-ac82-705b8ea4f6ae.jpgTime Laspe: Mr.Dreiden (GB)Here’s a gender bent version of Isrella Dreiden, so I hope you all enjoy this one. I also wanted to make art of men for this month’s art theme. Finished Drawing: https://side7.com/content/jDMWY756rOhttps://nicecrew.tv/static/streaming-playlists/hls/87afed21-cfea-411b-a1d4-8d47f3c48fac/c3281bd0-0922-4167-b98b-4c854552dbf4-master.m3u8https://nicecrew.tv/videos/embed/hKNBuyqDyQ1dhE6UhoprmG180002024-12-15T02:26:55.985ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/1XcjRDvVAEASExUMWZr87Uhttps://nicecrew.tv/lazy-static/thumbnails/3e2d3c40-0296-4f37-a9a2-a6845e64de57.jpgI Talk About: Tea Plus SpeedpaintFor tonight’s video, I’ll be talking about Tea and why I enjoy drinking it a lot. Please enjoy this video, and have a nice day/night. Finished Painting: https://side7.com/content/6WrnPq0GMZhttps://nicecrew.tv/static/streaming-playlists/hls/07b4e2fe-4be2-4a08-8bcf-0f20af855204/2508282b-43bd-4eee-b849-9d9fe33a78ac-master.m3u8https://nicecrew.tv/videos/embed/1XcjRDvVAEASExUMWZr87U67012024-12-15T02:27:23.980ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/dHVfMHhW6FQC49KTK1Ji4vhttps://nicecrew.tv/lazy-static/thumbnails/a702724f-ed07-4b44-ba3b-22a6e8d14ee0.jpgI talk about: Computers Plus SpeedpaintHere is a video of me talking about computers and some OS’s. I hope you all enjoy this video and have a nice day/night. Finished Painting: https://side7.com/content/2Br2XlK5M7https://nicecrew.tv/static/streaming-playlists/hls/6707fa60-2b26-4f6f-a5ef-b051a88344df/2bce8a2e-9ce8-40e5-9a0d-0bc20f9026f7-master.m3u8https://nicecrew.tv/videos/embed/dHVfMHhW6FQC49KTK1Ji4v250032024-12-15T02:28:01.076ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/w5v9xadtnVcLTcWN72eFdHhttps://nicecrew.tv/lazy-static/thumbnails/b01b85f2-2d70-462e-8220-697586a30ed0.jpgTime Laspe: Floral MarioHere’s a drawing of Mario but is themed around nature and spring. Please enjoy. Hopefully I’ll make another painting video with me talking about another topic. Finished Drawing: https://side7.com/content/KZr5y0lYrNhttps://nicecrew.tv/static/streaming-playlists/hls/f39318f4-2df2-4fbc-b629-976359f1cdb5/1269737c-cb7a-41e3-aff3-b0dba042b063-master.m3u8https://nicecrew.tv/videos/embed/w5v9xadtnVcLTcWN72eFdH180002024-12-15T02:27:33.181ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/wfG1gcnZ5qim2MV6fJZKPFhttps://nicecrew.tv/lazy-static/thumbnails/0a4eae66-0547-4b83-b9e5-5b6568b7cf3e.jpgMint Tinted Man (Animation)Here's an animation of a Limboist man this time, but he's colored after the pepppermint plant. Please enjoy.https://nicecrew.tv/static/streaming-playlists/hls/f4ff39ea-d39c-44db-a250-3dac2eea50e1/c1a7f709-1091-4fde-a438-55993589aa37-master.m3u8https://nicecrew.tv/videos/embed/wfG1gcnZ5qim2MV6fJZKPF13002024-12-15T02:27:10.465ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/c5E6wDz1wGQkL6daXezNnUhttps://nicecrew.tv/lazy-static/thumbnails/b8ebbac0-a103-4acc-8d9b-6836119c5db9.jpgRebella (Quick animation)A little animation of my rebellious magical girl, hopefully I'll animate her going something cool next time. This is made with Paint dot net and put together on my phone, then converted to a wmv file. 9 images were drawn for this one.https://nicecrew.tv/static/streaming-playlists/hls/59bafa37-c380-43a1-98d1-4eefec46cf06/90a9ee07-467d-4852-97a7-d624c69b1df2-master.m3u8https://nicecrew.tv/videos/embed/c5E6wDz1wGQkL6daXezNnU2002024-12-15T02:27:16.644ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/eRdwR2AUzHthbWd8zeL9GYhttps://nicecrew.tv/lazy-static/thumbnails/37b5dc78-139f-4d06-892f-e7ec13b2176d.jpgSpeed Paint - Bat & TVA painting I made with new paints my mom gave me, I really like these ones. Anyways, I hope you all enjoy this speed paint with added music. Please enjoy and have a good day/night. Finished Drawing: Alt Art Link: https://side7.com/content/m2r3QLEYMphttps://nicecrew.tv/static/streaming-playlists/hls/7025f866-9a85-4473-a07f-91a9049b9078/8cd503d5-9bba-48c6-b77a-12a5d5f400d1-master.m3u8https://nicecrew.tv/videos/embed/eRdwR2AUzHthbWd8zeL9GY156002024-12-15T02:28:47.921ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/mmGRjkZBqnnH7PMdKhK9Nmhttps://nicecrew.tv/lazy-static/thumbnails/ddcf9152-5597-4d65-88c9-26ee1b79295a.jpgSpeed Paint: Blood Stained AngelHere’s my first video where I used watercolor paints and some ink pens, plus some acrylic paint. Please enjoy. Song: Broken Peppermint Waltz - 9VeilMaid (aka me) Finished Drawing: https://side7.com/content/qZ9yveb7MNhttps://nicecrew.tv/static/streaming-playlists/hls/a4dad2cf-92d9-4e30-b751-618e850e95b8/a11234bd-c414-481c-a734-8a312f74d643-master.m3u8https://nicecrew.tv/videos/embed/mmGRjkZBqnnH7PMdKhK9Nm22002024-12-15T02:27:24.018ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/ndAgzSDTPECvmWxxP67ykYhttps://nicecrew.tv/lazy-static/thumbnails/eb412512-b483-4570-b35a-d4ac4631aba2.jpgSpeed Paint: The TrigonAnother quick watercolor paint of a fictional game system called the Trigon. Song: Fading Happy Memories - 9VeilMaid(Aka Me) Finished Drawing: https://side7.com/content/KZr5y0zkrNhttps://nicecrew.tv/static/streaming-playlists/hls/abd1f4b7-da7e-47aa-a564-2178c28fb8e6/23d87560-327a-4872-83eb-92ce704e253f-master.m3u8https://nicecrew.tv/videos/embed/ndAgzSDTPECvmWxxP67ykY24002024-12-15T02:27:27.205ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/mrGb9eQszwyfGG2oic9Lm3https://nicecrew.tv/lazy-static/thumbnails/f0e5712b-0015-4bd5-904f-2f25766005c8.jpgTime Laspe: Blissful Fluffy WormHere’s another Infinite Painter video, please enjoy. Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Blissful-Fluffy-Worm-961525711 Alt art link: https://www.side7.com/content/eA90nZxg8vhttps://nicecrew.tv/static/streaming-playlists/hls/a58d2047-5920-4086-8209-e9367c293b4a/35dfc333-a8ba-4acd-a381-27448e4a4784-master.m3u8https://nicecrew.tv/videos/embed/mrGb9eQszwyfGG2oic9Lm3207002024-12-15T02:27:46.722ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/nJGySZ5uRfg6NnEwcXBtKvhttps://nicecrew.tv/lazy-static/thumbnails/73021b75-cefa-4f62-b3e7-43083584924f.jpgTime Laspe: Ready NooseAnother time lapse video but with a woman holding a noose to her neck, and I also drew a rune hairpin that’s for death, and that’s all really. Finished drawing: https://www.deviantart.com/rainbowdoodler209/art/Ready-Noose-962513678 Alt art link: https://side7.com/content/lar4lQj0r4https://nicecrew.tv/static/streaming-playlists/hls/b0062682-6fae-4cb9-bf4e-41e3717f13ef/1735355d-aa5a-4997-916b-2f3842d179a6-master.m3u8https://nicecrew.tv/videos/embed/nJGySZ5uRfg6NnEwcXBtKv180002024-12-15T02:27:44.961ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/x1Rsaei7E94ZBDr3wT9aNUhttps://nicecrew.tv/lazy-static/thumbnails/af1d8e62-a237-4835-816f-96a4e52bfb22.jpgQuick Time Laspe: Grey Nonsense roomJust wanted to make a painting of a nonessential room I made up in my head. That’s all for this one. Please enjoy. Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Grey-Nonsense-Room-962677978 Alt art link: https://side7.com/content/v5rgdxLX9Whttps://nicecrew.tv/static/streaming-playlists/hls/fb29c613-6089-4f45-8403-4e16d11c3714/e003678f-0fae-4de9-9e73-437fb4c504f6-master.m3u8https://nicecrew.tv/videos/embed/x1Rsaei7E94ZBDr3wT9aNU64002024-12-15T02:27:35.716ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/ankncHcamzkqonUqGkzKsuhttps://nicecrew.tv/lazy-static/thumbnails/8383f3a4-ac5d-4b8b-8f71-a3e9d34c053f.jpgTime Laspe: SolmahA geography girl that’s based off of Somalia, I hope you all enjoy this one. Song: Abyss Of Comfort - by 9VeilMaid(aka me) Finished Drawing: Alt Art link:https://nicecrew.tv/static/streaming-playlists/hls/4bdccd32-a6bd-43d3-a712-70e3dfdd4464/12c082d0-7c60-41e5-a468-ec1f9db25ffa-master.m3u8https://nicecrew.tv/videos/embed/ankncHcamzkqonUqGkzKsu120002024-12-15T02:28:15.177ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/gwbBg2anPSe8XJ3sz5P9Nchttps://nicecrew.tv/lazy-static/thumbnails/e4d9fd64-8d36-45b0-8a49-3fc0bd615630.jpgSpeed Paint: Gloomy EveningA time Laspe video of me painting a cyclops laying on a giant tired eyes Fuzzilon. Please enjoy and have a great day/night. Song: Open Colorful Wound - 9VeilMaid(aka me) Finished Art: https://www.deviantart.com/rainbowdoodler209/art/Gloomy-Evening-963178304 Alt Art Link: https://side7.com/content/eA90nZwd8vhttps://nicecrew.tv/static/streaming-playlists/hls/7dafee2b-fb94-4a9b-95bc-7ba496c39a4f/39ae50d4-8c44-4dc0-93e6-1d7a9be5656c-master.m3u8https://nicecrew.tv/videos/embed/gwbBg2anPSe8XJ3sz5P9Nc227002024-12-15T02:29:25.922ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/vcGc3C3wsPDagB4t8Fvj5khttps://nicecrew.tv/lazy-static/thumbnails/3b1ccd57-6bdf-4a74-8c2e-9884edf9d0a5.jpgTime Lapse: Dress StainAnother Limboist woman drawing, but a little more surreal. Please enjoy. This is only drawn with the gouache brush, I’m starting to like this brush. Finished Art: https://www.deviantart.com/rainbowdoodler209/art/Dress-Stain-963484491 Alt Art Link: https://side7.com/content/NEMa6nAQ8bhttps://nicecrew.tv/static/streaming-playlists/hls/ec7af889-4b39-41b3-83b6-1e6af4ff861b/1f80ac85-def9-4367-adb0-55d481194814-master.m3u8https://nicecrew.tv/videos/embed/vcGc3C3wsPDagB4t8Fvj5k180002024-12-15T02:28:43.200ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/chs6mmjvhGzQU8ccxPffbzhttps://nicecrew.tv/lazy-static/thumbnails/0c642e1d-03fa-4feb-ae02-f30e8d124a1d.jpgTime Laspe: RosimaA purple shades only drawing of a rose gijinka, I hope you all enjoy. Finished Deawing: https://www.side7.com/content/zDMLNEl5ryhttps://nicecrew.tv/static/streaming-playlists/hls/5b608168-b8ca-4d7a-bcc6-150cb63d7c1d/dde398a5-2633-43e7-b892-37b9ff6ebf03-master.m3u8https://nicecrew.tv/videos/embed/chs6mmjvhGzQU8ccxPffbz180002024-12-15T02:28:58.752ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/uoKX6q6iCwPRYjFrQz9bAFhttps://nicecrew.tv/lazy-static/thumbnails/6b22fe79-e875-4bef-b27c-9d0073d57dc5.jpg9VeilMaid - Abyss Of Comfort (Full Album)Here's the full music album I stitched together from 7 songs I made last month, oh yeah and this album was finished a month ago. So I hope you all enjoy this music album, please point out anything for my music to help me improve in the future, and this is honestly my first time making a music album. Have a good day/night!https://nicecrew.tv/static/streaming-playlists/hls/e5ed549b-9687-4b9c-96b6-f70de4cc4d53/14167e06-0e25-4320-86d2-06839bf705d0-master.m3u8https://nicecrew.tv/videos/embed/uoKX6q6iCwPRYjFrQz9bAF1478002024-12-15T02:32:06.463ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/4ocmtHVhW1kcUnYPjVisSzhttps://nicecrew.tv/lazy-static/thumbnails/e92a5ab1-31ca-4be4-9121-2564e73c4076.jpgTime Laspe: Orthadox LimboistAnother little digital gouache painting, but of a Limboist woman that’s been with Limboism for 30 years. Finished Drawing: Alt Art Link: Songs: Sparkling Choir by 9VeilMaid Three Crazy Instruments by 9VeilMaidhttps://nicecrew.tv/static/streaming-playlists/hls/1b64c686-f9f1-400c-967a-7112c47f2a15/ec357275-a90a-4257-88b6-71df872acea1-master.m3u8https://nicecrew.tv/videos/embed/4ocmtHVhW1kcUnYPjVisSz180002024-12-15T02:29:10.617ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/fak25opxtr6HJKmPpMsu3Mhttps://nicecrew.tv/lazy-static/thumbnails/39bda3e0-409b-4816-97d0-f41d6b7cd0ad.jpgTime Laspe: Eyes EverywhereHere’s another Infinite Painter time laspe, I also noticed that the time Laspe this time has changed a little too, anyways I hope you all enjoy this one! Song: Groggy’s Piano theme - 9VeilMaid Finished Drawing: Alt Art link:https://nicecrew.tv/static/streaming-playlists/hls/72ad5b13-6722-4120-88b0-7a50e8b93891/15e35eb3-512b-461a-be7e-13e0a75849a2-master.m3u8https://nicecrew.tv/videos/embed/fak25opxtr6HJKmPpMsu3M180032024-12-15T02:29:18.622ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/1fecpVJzowypKLTGjogHhZhttps://nicecrew.tv/lazy-static/thumbnails/16394fd7-5417-482d-821b-b48d5c550943.jpgTime Laspe: Fishhooks And EyelidsHere’s an odd drawing I started when I was a little sleep deprived. Please enjoy and have a great day/night. Song: Well, You’re Dead - 9VeilMaid Finished Drawing: Alt Art link: https://www.side7.com/content/ZvMGm0mAryhttps://nicecrew.tv/static/streaming-playlists/hls/01fc8baa-efd4-404d-b1f6-217b7ba22315/59c81dce-1616-4939-8a0a-fa227269e2fb-master.m3u8https://nicecrew.tv/videos/embed/1fecpVJzowypKLTGjogHhZ180002024-12-15T02:30:06.720ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/4s5FeFar77QU3boD6gCBLShttps://nicecrew.tv/lazy-static/thumbnails/2f460cff-8eb8-4b5d-a8fe-0e38bb203839.jpgTime Laspe: Shime Against FOMOA quick drawing video I made last night, so I hope you all enjoy. Song: Bitter Snow Fall - 9VeilMaid Finished Drawing: https://www.deviantart.com/rainbowdoodler209/art/Shime-Against-FOMO-968965165 Alt Art Link: https://www.side7.com/content/PXrd72kj80https://nicecrew.tv/static/streaming-playlists/hls/1befa2cf-c01c-41ed-a4b7-f9dac5515006/5c630dfa-49af-45d6-b3d8-6349cc487748-master.m3u8https://nicecrew.tv/videos/embed/4s5FeFar77QU3boD6gCBLS163002024-12-15T02:29:35.105ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/3S9xnbsWQQKKV1WrjF9dw8https://nicecrew.tv/lazy-static/thumbnails/a46a9f41-4f24-41fd-83d1-b5fe70249e0a.jpgTime Laspe: Girly Girl And TomboyA drawing of two types of girls, and they’re also colored after chemical colors, from the cis and trans chemicals, which are yellow and red. I hope you all enjoy this illustration time laspe. Music: Song 1: The Boredom Song - 9VeilMaid Song 2: Somber Sunday - 9VeilMaid Finished Drawing: Alt art link: https://www.side7.com/content/nv8Rb46O8dhttps://nicecrew.tv/static/streaming-playlists/hls/1732bab0-ea62-479a-a630-a7bdab9b51b3/25956ac6-c26f-4f15-8557-5fb5f0433d9e-master.m3u8https://nicecrew.tv/videos/embed/3S9xnbsWQQKKV1WrjF9dw8298022024-12-15T02:31:08.662ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/qvpfmbWmJnudRG5n6rwZPuhttps://nicecrew.tv/lazy-static/thumbnails/0008bc1b-de32-4e94-b066-128b252bc099.jpgTime Lapse: Ameri Chan Cosplaying Uncle SamAn illustrastion of Ameri-chan doing some cosplaying, I hope you all enjoy this video, hopefully I’ll post something a little different, video wise. Song: Ameri-Chan’s Theme - 9VeilMaid Finished Drawing: Alt Art Link: https://www.side7.com/content/eA90nNvg8vhttps://nicecrew.tv/static/streaming-playlists/hls/c6763950-02a5-45c0-b8e6-e65e2a582a66/ee929b4e-8bf6-47dc-a5e7-63f559a36a73-master.m3u8https://nicecrew.tv/videos/embed/qvpfmbWmJnudRG5n6rwZPu187002024-12-15T02:30:27.784ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/qxMnY4PScU6KjHKV2BeBaXhttps://nicecrew.tv/lazy-static/thumbnails/cf8a7a7d-6de5-4be4-9d6e-a61863c1064a.jpgI Talk About: Allegies Plus Time LaspeA smaller I talk about video this time, I made the audio portion last night. Please enjoy this talking video. Hopefully I’ll finish the other talking videos in my backlog. Song: Trars Of Misery Finished Drawing: Alt Art Link: https://www.side7.com/content/NEMa60wQ8bhttps://nicecrew.tv/static/streaming-playlists/hls/c6cb59b0-7a1e-4eb4-aefd-39d803c8c0c5/dc21e58d-2f2b-49f6-9047-b9dece21a443-master.m3u8https://nicecrew.tv/videos/embed/qxMnY4PScU6KjHKV2BeBaX136002024-12-15T02:30:25.903ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/nURPEMo6Wvgtmx8z4kUWdxhttps://nicecrew.tv/lazy-static/thumbnails/3e3e5964-dc79-4402-a223-6c7a028f4cbe.jpgSaudi Sunnah And Balloon (animation)Another original animating but with Saudi Sunnah and a red balloon. Pleas enjoy, and I’ll come back to animating with Krita.https://nicecrew.tv/static/streaming-playlists/hls/b1714aae-2d55-44d1-9316-198049a4245f/52069529-b3b1-4595-9ed6-f8579964bfa3-master.m3u8https://nicecrew.tv/videos/embed/nURPEMo6Wvgtmx8z4kUWdx16002024-12-15T02:30:19.606ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/nkLEBBjJmhRLtmR2knoA6nhttps://nicecrew.tv/lazy-static/thumbnails/57c85eb4-92f3-4df7-82e5-db13ab2c3dc6.jpgBlood Flame AnimationAn animation of a blood colored flame throwing a rock. Please enjoy!https://nicecrew.tv/static/streaming-playlists/hls/acd291da-8bcf-4e48-9948-0bbbd3e77f5f/d7555b0a-b05f-40bc-ae17-a35d35972f18-master.m3u8https://nicecrew.tv/videos/embed/nkLEBBjJmhRLtmR2knoA6n7002024-12-15T02:30:21.131ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/8iZh9jAes9hsSnWNhwLq1xhttps://nicecrew.tv/lazy-static/thumbnails/65908029-5a5a-46a8-8f65-44d9318b94e0.jpgI talk about: Brutalism plus time laspeAnother I talk about video for this week, sorry for the audio quality being janky, I used my bluetooth headphone plus ipad mic to record the audio, anyways, I hope you all enjoy this video and the painting, have a good day/night. Finished painting: https://www.side7.com/content/Le9VQNZErVhttps://nicecrew.tv/static/streaming-playlists/hls/3b32e9ea-c1b5-42b5-9322-b6d385a9e3bf/2309da8d-19c8-46b3-ac23-4fbbd85371b0-master.m3u8https://nicecrew.tv/videos/embed/8iZh9jAes9hsSnWNhwLq1x273002024-12-15T02:31:16.857ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/nWCQEg3WRktBgCpaZ8XHCXhttps://nicecrew.tv/lazy-static/thumbnails/c187b65f-a69b-4738-a08d-e954a8294d5b.jpgTime Laspe: Rotten Apple St SignA time Laspe video for a song I finished, I’ll post the finished illustration alongside the song to my Side7 in the morning. Song: Rotten Apple Street by 9VeilMaid Finished Art: Coming Soonhttps://nicecrew.tv/static/streaming-playlists/hls/b1b0c73b-bad0-48c7-920e-58f62d09f58b/0feeff90-ca62-4d24-8ba3-fde64a19154d-master.m3u8https://nicecrew.tv/videos/embed/nWCQEg3WRktBgCpaZ8XHCX115012024-12-15T02:30:44.214ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/sie8TFUB8ibb7L8WAvBF7Khttps://nicecrew.tv/lazy-static/thumbnails/253d572f-af64-4658-8861-dae5bdd12151.jpgIn The Office AnimationAnother quick animation with Motionbook again, please enjoy.https://nicecrew.tv/static/streaming-playlists/hls/d4f55839-bdda-4cd8-9089-f1f088af5a8b/81f53956-b296-4713-8ee9-0cba41f6775c-master.m3u8https://nicecrew.tv/videos/embed/sie8TFUB8ibb7L8WAvBF7K23002024-12-15T02:30:40.204ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/eYHTRma4qfJMs27MoaszBRhttps://nicecrew.tv/lazy-static/thumbnails/9ded8c7d-acfb-403d-b0bf-836f7b4c34c2.jpgLittle Candy drop (Animation)A Krita animation of a piece of candy becoming an angelic cyclops. Please enjoy.https://nicecrew.tv/static/streaming-playlists/hls/71324593-83a3-4fd7-ad18-eab57d1d1463/201195d2-7c11-4068-9c3e-ddf6acebd448-master.m3u8https://nicecrew.tv/videos/embed/eYHTRma4qfJMs27MoaszBR8002024-12-15T02:30:41.659ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/pyfXja8PdvL6hYLdhLvqUKhttps://nicecrew.tv/lazy-static/thumbnails/4ea2f9d8-479b-46ea-823d-62f635a1a293.jpgTime Laspe: Two-Faced DemonA little colored pencil time lapse before I go to bed, please enjoy! Song: Rusty Cracked Bells by 9VeilMaid Finished drawing: coming soon Alt art link: https://www.side7.com/content/eA90nyz68v#c279103https://nicecrew.tv/static/streaming-playlists/hls/bec33491-b738-4450-ace3-207ef9c04b9b/fdd119f9-9632-43d2-aa83-259ff7b3b4b5-master.m3u8https://nicecrew.tv/videos/embed/pyfXja8PdvL6hYLdhLvqUK32002024-12-15T02:30:46.535ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/imUQ3eeVbFcioPrhqWTH2bhttps://nicecrew.tv/lazy-static/thumbnails/1bc12a9c-792c-4db5-ae9e-83a2ed3dc28e.jpgI talk about Autumn and HalloweenA video about Autumn and Halloween related stuff, I hope you all enjoyed this video as well. (Hopefully I’ll edit more iPad videos with Vita from now on honestly) I also sped up the time Laspe video a little bit more as well and yeah. Music by 9VeilMaid Song 1: Alien Stranger Song 2: Faint Light In Darkness Song 3: Snow, Blood and Bruises Finished Drawing: https://www.side7.com/content/jDMWY5qGrOhttps://nicecrew.tv/static/streaming-playlists/hls/8c96ca08-0349-4df4-befc-8eaa50b59ae0/ef90e4b6-7385-447c-b331-62b6399d528d-master.m3u8https://nicecrew.tv/videos/embed/imUQ3eeVbFcioPrhqWTH2b566032024-12-15T02:31:34.851ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/cZTHQNfpCFpgynQ78etYgUhttps://nicecrew.tv/lazy-static/thumbnails/53611830-5ea4-4a9d-8a57-9720f1ebc366.jpgTime Laspe: Blind Nature GirlHere’s a quick time Laspe video of me painting a girl that lives within a cult that never uses technology at all. Please enjoy! Finished Drawing: https://www.side7.com/content/b28wpnvKrkhttps://nicecrew.tv/static/streaming-playlists/hls/6129cb6a-ae3e-44be-a454-023216ebbd62/be81f3ff-4176-4d07-9382-c43133cb91b0-master.m3u8https://nicecrew.tv/videos/embed/cZTHQNfpCFpgynQ78etYgU55002024-12-15T02:30:55.620ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/iYaw4P5Vs3ksxbHV3SwMfFhttps://nicecrew.tv/lazy-static/thumbnails/2fea373f-dd41-4bff-9786-28113a29140d.jpgSong Preview ThingA video of me showcasing a song I’m working on, I hope you all enjoy it. I’m making this song with Soundtrap. (I’m not sure when I’ll finish it, hopefully it’ll be soon)https://nicecrew.tv/static/streaming-playlists/hls/9182dfce-9e87-4b3a-97c2-e90993cb6577/eebc8210-6e32-4cc5-ab95-52958b36edb4-master.m3u8https://nicecrew.tv/videos/embed/iYaw4P5Vs3ksxbHV3SwMfF309002024-12-15T02:31:18.846ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/nJXQKG6VZzbt35eePnRfULhttps://nicecrew.tv/lazy-static/thumbnails/c81d5fa0-53c4-4200-8d4d-b63aec495bd9.jpgI Talk About: Stuff’s getting too pricy (Reupload)A video where I talk about stuff being way too pricy, like houses for example. I hope you all enjoy the video and have a great day/night. (Reuploaded because I cut off my talking audio and wanted to extend it, sorry about that.) Song: Cold Gothic Church - 9VeilMaid Finished Drawing: https://www.side7.com/content/XZ8bpEEa9Ohttps://nicecrew.tv/static/streaming-playlists/hls/b00f902c-5263-4ca6-9380-07e2e6a10e04/3fadea79-db7a-41c7-80ef-71c7b55af921-master.m3u8https://nicecrew.tv/videos/embed/nJXQKG6VZzbt35eePnRfUL342002024-12-15T02:31:28.805ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/hbbC6bMPpAhM7RzEidLYT7https://nicecrew.tv/lazy-static/thumbnails/472dffa4-e8d3-4a59-a721-d1077299c1c5.jpgCyclops & Blueberries (Animation)An animation about Cyclops and Blueberries, I hope you all enjoy.https://nicecrew.tv/static/streaming-playlists/hls/82fe33d3-449a-4ccd-9872-969c48f1ffb4/8b517b91-c3eb-4b59-ae51-da9c3e5d1a32-master.m3u8https://nicecrew.tv/videos/embed/hbbC6bMPpAhM7RzEidLYT724002024-12-15T02:31:17.245ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/kChHpGDsLfNQ3R3Fa81vKzhttps://nicecrew.tv/lazy-static/thumbnails/775de1d4-f052-4d89-8802-278e9432e92d.jpgTime Laspe: Fluffy Snake Woman 2024Here’s a day late New Years illustration I made, I hope you all enjoy this video and stuff, I’ll hopefully think of a random thing to talk about for a talking video in the future. Edited with Vita Music: Song 1 - Acoustic Meditation by Jason Shaw Song 2 - Nickel Rock by Jason Shaw (The music is Creative Commons by Audionautix) Finished Drawing:https://nicecrew.tv/static/streaming-playlists/hls/9eeeb5e9-63f5-499c-ad0e-5a07e44162c3/3432e22c-719a-433f-876c-db963685e39b-master.m3u8https://nicecrew.tv/videos/embed/kChHpGDsLfNQ3R3Fa81vKz393032024-12-15T02:31:43.038ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/pvrKohmcAWHhCJMswgHqdHhttps://nicecrew.tv/lazy-static/thumbnails/4acfc265-0ed5-4d47-8d04-7c46fd7c8b5a.jpgSong Preview 2 (read desc)I’ll still be making videos on Rumble and so on, and I also don’t want my audience to have tech issues just for wanting to use Adblock on YT. (I’ll still upload on YouTube, but I’ll post videos last on here.)https://nicecrew.tv/static/streaming-playlists/hls/be5ea053-e8a6-4b6f-ab69-41bf269a3059/d74dcda4-e39b-4cc6-b900-f4d946aac0c5-master.m3u8https://nicecrew.tv/videos/embed/pvrKohmcAWHhCJMswgHqdH96002024-12-15T02:31:19.937ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/p7AKZFQZmKPeWJz7VRzofthttps://nicecrew.tv/lazy-static/thumbnails/b9df930b-8259-48f6-90b7-d42f67cd5731.jpgSpeed Drawing: Odd Flower DressHere’s another time lapse video of another autodesk illustration, this program is still growing on me. Please enjoy and I hope you all have a great day/night. Finished Drawing: https://side7.com/content/eA90nnZw8v [This video is also Creative Commons.]https://nicecrew.tv/static/streaming-playlists/hls/bb2e128f-96e1-4838-949b-ff0f5bb2bfb7/31d7e177-973e-40e7-93ad-16b67157530b-master.m3u8https://nicecrew.tv/videos/embed/p7AKZFQZmKPeWJz7VRzoft571002024-12-15T02:32:25.202ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/afZAKbWYMJ6TQ2a5eadf3nhttps://nicecrew.tv/lazy-static/thumbnails/f1d150cf-aae6-4cbf-9391-3e774bf49256.jpgSketchbook Showcase 1A little video of me showcasing some sketches and drawings for this small sketchbook I got weeks ago.https://nicecrew.tv/static/streaming-playlists/hls/4afa284a-e5e9-4aa9-b443-30126eb48d91/a04c2484-6f03-4a46-9fef-70c48e0669d5-master.m3u8https://nicecrew.tv/videos/embed/afZAKbWYMJ6TQ2a5eadf3n62002024-12-15T02:31:26.417ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/46iFcRfnDASLrccKfudjYHhttps://nicecrew.tv/lazy-static/thumbnails/f9defe2e-abdd-417c-b6ab-fe3242661886.jpgI Talk About: YouTube being really petty over adblocks + SpeedpaintA video where I talk about Yourube being really petty about some people using Adblock, and the rest of the video will be a Speedpaint as well, I hope you all enjoy and stuff. Finished Drawing: https://side7.com/content/Dn8EwwK29N (This video is under Creative Commons, mainly for Jason Shaws music.)https://nicecrew.tv/static/streaming-playlists/hls/1909072b-d622-4482-b824-d4829714a501/e47bbc56-54ee-46b1-a53d-5558709cf57f-master.m3u8https://nicecrew.tv/videos/embed/46iFcRfnDASLrccKfudjYH608012024-12-15T02:33:04.743ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/guFVi2PPvLcwRRCFPjxaoMhttps://nicecrew.tv/lazy-static/thumbnails/042cfa37-4dce-49c6-a723-1d47bc2bf0f3.jpgSong Preview 3 (Read Desc)Another song preview video for this song, this’ll be changed in the future. Just wanted to show slow progress. (I’ll edit notes for the guitar, alongside other stuff.)https://nicecrew.tv/static/streaming-playlists/hls/7d7a819e-c567-408a-8a8c-daba050bd285/d29633e6-22bb-4e01-bff6-67315b1d5325-master.m3u8https://nicecrew.tv/videos/embed/guFVi2PPvLcwRRCFPjxaoM221002024-12-15T02:31:45.825ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/hgDjWPRzNrrygWKfdQ8TXDhttps://nicecrew.tv/lazy-static/thumbnails/3f95bd13-045d-4a22-adcb-257e5bece742.jpgSpeed Drawing: Floral AlienHere’s a spring themed illustration of an alien girl wearing a spring themed outfit, I hope you all enjoy, I’m still looking forever to Spring coming up. Finished Drawing: https://side7.com/content/5bMNLL5arehttps://nicecrew.tv/static/streaming-playlists/hls/83c160e3-71f5-4e60-9171-da24e03cc75f/25005da0-d2b5-4326-b829-a2e0de924690-master.m3u8https://nicecrew.tv/videos/embed/hgDjWPRzNrrygWKfdQ8TXD751552024-12-15T02:35:07.947ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/8PZCr3YrWLMceS6shTvH13https://nicecrew.tv/lazy-static/thumbnails/4e2de59d-6306-4e03-9a55-bfc757e6d85a.jpgSong Preview 4 (read desc)Making this a Garage band song this time, I wanted to make a jazz song that sounds like blues and maybe depressing. This might have three parts in general too, some notes might change too.https://nicecrew.tv/static/streaming-playlists/hls/3f637141-d751-4f0c-bf15-089596ebf47e/199a94a2-405c-4cb9-b03d-3da4ee58bb6e-master.m3u8https://nicecrew.tv/videos/embed/8PZCr3YrWLMceS6shTvH1369002024-12-15T02:31:58.296ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/tiRcpfz4nKwWk5Go6YYi6Zhttps://nicecrew.tv/lazy-static/thumbnails/7580012b-0b9a-44c6-a5c9-c411daab54e0.jpgRandom Canva drawing (time Laspe)A quick Canva drawing I made before bed, please enjoy! Finished drawing: https://side7.com/content/KZr5yywwrN (Creative Commons for Jason Shaw’s music)https://nicecrew.tv/static/streaming-playlists/hls/dd24b4d4-c03b-4a8a-b199-cfb3dbf1589f/47d78410-a871-457e-a103-a7881754762b-master.m3u8https://nicecrew.tv/videos/embed/tiRcpfz4nKwWk5Go6YYi6Z231012024-12-15T02:32:21.251ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/q5q7bhD2j9WWydXR8mHwb4https://nicecrew.tv/lazy-static/thumbnails/6f1b963d-a1bc-4b73-8b0a-69ab13f139fd.jpgDeep Red Dress - AnimationAn animating about a cyclops girl in a red dress, alongside other random stuff that’s red, please enjoy.https://nicecrew.tv/static/streaming-playlists/hls/c2f928b9-99b4-4df8-b4d3-7e824da7e147/733f19e6-992c-4264-b83d-e25200f0cd0d-master.m3u8https://nicecrew.tv/videos/embed/q5q7bhD2j9WWydXR8mHwb422002024-12-15T02:31:51.391ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/qXH987SbmRTMoFtastNGVohttps://nicecrew.tv/lazy-static/thumbnails/92f8d9fb-99dd-4555-b578-3a07143719b2.jpgSpeed Paint: Hovering UndertakerA quick watercolor painting time lapse I made last night, I hope you all enjoy. Finished Drawing: https://side7.com/content/Le9VQJQprVhttps://nicecrew.tv/static/streaming-playlists/hls/ca2296b1-690b-4091-8644-44321301f298/ef2ba17a-aa69-45fb-bdff-ecc0bdbea7bc-master.m3u8https://nicecrew.tv/videos/embed/qXH987SbmRTMoFtastNGVo29002024-12-15T02:32:08.203ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/eSHDJsh6xTyYFahZiuJx5Ghttps://nicecrew.tv/lazy-static/thumbnails/b7d924db-74ce-4952-8833-638d3c753aa1.jpgInfinite Painter Comp Feb-MayA series of time lapses for this one, I hope you all enjoy! 1. Valentines Snail (a present to one of my subs) 2. Green Nature 3. Blood & Teeth Necklace 4. Gretilda Orangen 5. Stocks-Tan 6. Copper-Chanhttps://nicecrew.tv/static/streaming-playlists/hls/705ba8bd-a62a-4a46-aa4c-0c699eac3b9c/c89a140a-77e3-4f3e-9456-ff289734807f-master.m3u8https://nicecrew.tv/videos/embed/eSHDJsh6xTyYFahZiuJx5G681052024-12-15T02:36:20.780ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/1kNwBTvGZg4gTe8hKUgWUHhttps://nicecrew.tv/lazy-static/thumbnails/ae6ce72c-a0d0-4a7d-a3da-873f9c2f3f20.jpg9VeilMaid Songs Playing At OnceA little music crappost video I made. Please enjoy! Songs Used: Rotten Apple Street Drummer Twins Sparkling Diamond Peach Ameri-Chan theme BootString Hotel Quilted Sweater Cold Gothic Church Frostbite Forest Three Crazy Instruments and a few morehttps://nicecrew.tv/static/streaming-playlists/hls/02c3ce33-7cbd-4cb6-9db5-3bc82a6c4f81/80e89419-1dce-432f-afa7-b48597247c7c-master.m3u8https://nicecrew.tv/videos/embed/1kNwBTvGZg4gTe8hKUgWUH317032024-12-15T02:32:44.732ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/pyd3tTz8xU5kVGzSWTX4Swhttps://nicecrew.tv/lazy-static/thumbnails/903401f2-a2be-49cd-a2b9-30f98c7e1b8a.jpgTime Laspe: Laviva & IllumityA time Laspe video for this illustration, please enjoy! Finished art: https://side7.com/content/V1r7WmaXrxhttps://nicecrew.tv/static/streaming-playlists/hls/bec16954-4acc-424f-a18f-ecf0035a4466/967d4a43-e89e-48fa-aa8c-18549a634140-master.m3u8https://nicecrew.tv/videos/embed/pyd3tTz8xU5kVGzSWTX4Sw124002024-12-15T02:33:30.572ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/vSYL5YDjr6ojRN6Jcjo4P5https://nicecrew.tv/lazy-static/thumbnails/58503aeb-4a7f-4cad-b80c-122a1c5fdcf2.jpgTime Laspe: Pink Woman In BrownA pink woman with a suffragette colored triple bow, doing a baphomet pose, why that pose? I came up with it on the spot tbh. I also drew this while I was outside. Please enjoy. Finished Drawing: https://side7.com/content/p7renkg09dhttps://nicecrew.tv/static/streaming-playlists/hls/f1f73075-958b-4272-9511-1e6f4dfef586/294f3d30-18b9-41e6-8030-c59a13d9e93d-master.m3u8https://nicecrew.tv/videos/embed/vSYL5YDjr6ojRN6Jcjo4P545002024-12-15T02:32:30.636ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/4VjWKzBjaAx3HrVJSrHsnvhttps://nicecrew.tv/lazy-static/thumbnails/8bc76525-4804-4179-bfc4-80ddfca4ddbe.jpg9VeilMaid - Sugared Apple LeavesA recent song I made in a day tbh, I hope you all enjoy, hopefully I’ll make another or finish another song style. I’ll post this video on Vk, Rumble and that’s all really.https://nicecrew.tv/static/streaming-playlists/hls/1fbd82ac-11cc-416c-9a9a-97eaf22280bf/ab68f018-277c-41a7-bdae-5cf08a8f6600-master.m3u8https://nicecrew.tv/videos/embed/4VjWKzBjaAx3HrVJSrHsnv166032024-12-15T02:34:06.895ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/o2CVEzyRwnX6BHfZpNQ9J1https://nicecrew.tv/lazy-static/thumbnails/591af7a2-7913-4dd3-9ae8-ccb798155cfc.jpgI Talk About: Why I draw Juneth Every JuneteenthJust a little video for why I draw Juneth Green every Juneteenth. Please enjoy! Finished Drawing: https://side7.com/content/6NrJpLdOMQhttps://nicecrew.tv/static/streaming-playlists/hls/b2638cdf-d6f7-4bd7-8f25-2b7663b0aea4/d3f3861f-d893-4c15-83a7-90e6d2686fc7-master.m3u8https://nicecrew.tv/videos/embed/o2CVEzyRwnX6BHfZpNQ9J1499042024-12-15T02:37:11.084ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/mEFzBGsa5Cxtir9afi8YRhhttps://nicecrew.tv/lazy-static/thumbnails/da818b8b-7085-4ab7-9595-9d653fd34e49.jpg(Superminds request) Talking About Art Supplies I use to make artA little video about me talking about the stuff I use to make art, traditional and digital. Please enjoy! P.S, Gloomy-Chan is my Minds name for any visitors wondering. Finished Drawing: https://side7.com/content/6zMO6kYL9qhttps://nicecrew.tv/static/streaming-playlists/hls/a75d6da1-30f6-445f-a1c5-2770c996d232/22eac02c-d0bc-46ea-90c0-3224e930b46b-master.m3u8https://nicecrew.tv/videos/embed/mEFzBGsa5Cxtir9afi8YRh184022024-12-15T02:34:14.547ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/bN3A25BNTaVT79GTyHPKoBhttps://nicecrew.tv/lazy-static/thumbnails/eb8fac14-190e-4e3c-ada5-7405121b591d.jpgUTAU Test: Caihong_Tiao(JiaoShi) [Read Desc]A little text video using a new version of Utau, and I did some setting tune up on my laptop so it can read Japanese text, anyways, I hope you all enjoy this little video. Edited with VSDC.https://nicecrew.tv/static/streaming-playlists/hls/576931ab-9379-4140-b5da-a96d03451dd3/b9741764-2af3-46d9-b7dd-83e1f5dee325-master.m3u8https://nicecrew.tv/videos/embed/bN3A25BNTaVT79GTyHPKoB37002024-12-15T02:34:02.866ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/3MAFfdEDYEmeq3FvoVmetYhttps://nicecrew.tv/lazy-static/thumbnails/88ed6429-c5c5-4cb6-bd15-9479ba2526c5.jpgTime Laspe: Blue Line Ameri-ChanAn illustration of Ameri-Chan themed around the blue line American flag. Please enjoy. (Hopefully I’ll make the next two US thin color flags too for the Theon red line, and the thin green line, and maybe more colored line flags too.) Video under Creative Commons for the music I use by Jason Shaw. Finished drawing: https://side7.com/content/PXrd7qV380https://nicecrew.tv/static/streaming-playlists/hls/16901e01-678a-4c11-9e29-68a24cbfc11a/ae2a3632-e890-4ed8-9ede-5da0dd1d02b8-master.m3u8https://nicecrew.tv/videos/embed/3MAFfdEDYEmeq3FvoVmetY158012024-12-15T02:34:29.566ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/fkFuauZ31i21uSpor1EUYJhttps://nicecrew.tv/lazy-static/thumbnails/b461a780-c02c-4d9c-abed-8b8028b75e1c.jpgSong Preview 5Another song preview video for a song I’m making. The song will get updated after this video is posted.https://nicecrew.tv/static/streaming-playlists/hls/741f681f-1c05-4cb4-b554-c3922497b3ba/83923031-acad-44da-abe8-b9259ed577a2-master.m3u8https://nicecrew.tv/videos/embed/fkFuauZ31i21uSpor1EUYJ127002024-12-15T02:34:48.171ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/sheXkpDU5YZPAazoShyZTThttps://nicecrew.tv/lazy-static/thumbnails/6fda7fe0-5d3c-4290-9bf7-7b96a48d404c.jpgTime Lapse: Man In BlackAn illustration made with charcoals and pastels and some bits of ink pen. Finished Drawing:https://nicecrew.tv/static/streaming-playlists/hls/d4d21adf-0619-49b6-a011-73cbe8462d05/bc3ef233-bae3-4443-98f8-60e7dcf2c83a-master.m3u8https://nicecrew.tv/videos/embed/sheXkpDU5YZPAazoShyZTT72022024-12-15T02:34:50.694ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/oRc3GmvXcRnX9xP7MwDzk8https://nicecrew.tv/lazy-static/thumbnails/7d9e5639-ca9c-4f54-8443-b7b06eb0cdf1.jpgTime Laspe: Health RestoredA fan drawing of Quote from Cave Story, I hope you all enjoy as well. Finished Drawing: https://side7.com/content/XZ8bpk7d9Ohttps://nicecrew.tv/static/streaming-playlists/hls/b9074d89-ce9e-4ad6-9592-307a976cc8c1/a77b8a78-de1b-4a5c-92c9-da2ee2048a2a-master.m3u8https://nicecrew.tv/videos/embed/oRc3GmvXcRnX9xP7MwDzk8137012024-12-15T02:35:42.345ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/3T7Tk7dvYtSx1kgF7Lou8ohttps://nicecrew.tv/lazy-static/thumbnails/5fcbe290-46db-42f2-a132-e602057dbf6e.jpgSong Priview 6 (read desc)I wanted to recreate a Yakui the maid song from my memory, I wished I archived the other singles when I got the chance. Anyways, I hope you guys enjoy the song preview at least.https://nicecrew.tv/static/streaming-playlists/hls/175573de-a3c3-404f-9f1d-d6feb03f51cc/260b0ba8-99f9-427a-beef-2ccad2736363-master.m3u8https://nicecrew.tv/videos/embed/3T7Tk7dvYtSx1kgF7Lou8o93002024-12-15T02:36:08.444ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/pWua1Cc8KJigbbTqj6AnyRhttps://nicecrew.tv/lazy-static/thumbnails/4b361063-c118-4829-9bb2-6b13c17c2a3f.jpgTime Laspe: Rotten Blueberry FairyAnother time Laspe video but of a rotten blueberry fairy on a chair I took a photo of, alongside some text commentary. This’ll be the last time I’ll add text commentary, and will hopefully add voiceover, or just continuing talking videos tbh. Anyways, thanks for watching stay tuned for the next video, whenever I’m done with it. Finished drawing: https://side7.com/content/jbMDg1QX9Xhttps://nicecrew.tv/static/streaming-playlists/hls/c1ddb440-eacb-4d10-a9fd-864dc8921ac5/3e0ed0a2-a510-4a7c-87ea-f00c928ac3f7-master.m3u8https://nicecrew.tv/videos/embed/pWua1Cc8KJigbbTqj6AnyR254012024-12-15T02:36:28.775ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/pqkAkVuFzXwW2bnkAv4xhLhttps://nicecrew.tv/lazy-static/thumbnails/2283a882-5256-456b-bb70-750fecc678a0.jpg9VeilMaid - Faint Memory Shards Of PurpleA song recreation attempt from a Yakui single, I might’ve butchered it a little bit, but yeah, I hope you all enjoy this one. Hopefully I’ll make another nice sounding song.https://nicecrew.tv/static/streaming-playlists/hls/bda81d1d-f433-4057-8126-a4fd697ef2f0/2930602b-6513-49d3-922f-b520c87c2a43-master.m3u8https://nicecrew.tv/videos/embed/pqkAkVuFzXwW2bnkAv4xhL98012024-12-15T02:36:12.232ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/tkzJ2UddBCWoGJAf3LkRcshttps://nicecrew.tv/lazy-static/thumbnails/7e3a3ba8-3e1f-49e1-bf01-b2d54b3d2264.jpgShitpost Tune - Kitten Waltz (read desc)A little song I made using musical kittens, I’ll also will be using my Windows 7 thinkpad for the time being, and I got into too much technical stuf and I’ll wait until I’m fully ready to use Linux tbf. Please enjoy this little music video.https://nicecrew.tv/static/streaming-playlists/hls/dd62a8b6-9995-483d-a884-6af2196e1ff4/abb118f5-9c26-4083-a9de-d5ee24799106-master.m3u8https://nicecrew.tv/videos/embed/tkzJ2UddBCWoGJAf3LkRcs39012024-12-15T02:35:45.732ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/vWMyeyEPcgWqgXiVySbs5shttps://nicecrew.tv/lazy-static/thumbnails/b2bcbaaa-f174-4aef-b05c-b93bb3754afa.jpgLMMS song preview 1 (read desc)A little song preview for a song that's themed around getting a nail stuck in your head. (This may change overtime as well, and I wanted to try out this program since I heard it's open source.)https://nicecrew.tv/static/streaming-playlists/hls/f27f426b-6f91-4740-aece-72674890f81a/06616fd4-25e6-428f-a81d-2daa2b0a2393-master.m3u8https://nicecrew.tv/videos/embed/vWMyeyEPcgWqgXiVySbs5s56012024-12-15T02:36:15.209ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/aMu36WDQS6FvpUipC6sGughttps://nicecrew.tv/lazy-static/thumbnails/ef16bd3a-21a2-4c59-aa07-229625e5f3a7.jpgTime Laspe: Natti SydnyA time lapse of a gijinka of National Syndicalism. Please enjoy. Drawn on my 2007 Thinkpad, using MsPaint and used NCH suites to record the footage, then used Vita to speed up the video and added music. Finished Drawing: https://side7.com/content/Gv8PbLW497 (Creative commons for the audionautix music used)https://nicecrew.tv/static/streaming-playlists/hls/4f3bfedb-dd27-4d26-a163-56ea7e109027/38cbef8f-ffbc-458a-bf8c-0fb845380257-master.m3u8https://nicecrew.tv/videos/embed/aMu36WDQS6FvpUipC6sGug460002024-12-15T02:37:15.247ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/qRFj5JUzUcRciu4zdUw4oGhttps://nicecrew.tv/lazy-static/thumbnails/a0d2c2cc-16f9-4dd0-beb7-2c1563f91748.jpgMeet Max, Bleu, then SmoresHere's a little video of my three cats, I also wanted to show S'mores since it's been a long while since I showed S'mores on camera. I hope you all enjoy this little cats video, edited with Vita on my phone.https://nicecrew.tv/static/streaming-playlists/hls/c94affd2-0bd3-47ce-a7b3-9764e098efc0/89bb762e-49fc-4dca-b000-721ca59ea42a-master.m3u8https://nicecrew.tv/videos/embed/qRFj5JUzUcRciu4zdUw4oG294042024-12-15T02:37:28.647ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/8y9FMJym5pgK9or9NPWtushttps://nicecrew.tv/lazy-static/thumbnails/bbc1fee4-7970-40fe-a0ae-183a9cdf8005.jpgA Capella PreviewAn A Capella preview for Aphex Twin's Rhubarb, I'll make more audio pieces as well over time for the other synths. Enjoy!https://nicecrew.tv/static/streaming-playlists/hls/3d2d1fcb-c59c-4584-b525-81fbe066e8de/454686fc-23e5-4f87-b5e0-0e2bbdd74230-master.m3u8https://nicecrew.tv/videos/embed/8y9FMJym5pgK9or9NPWtus132012024-12-15T02:37:00.184ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/b3ADMbHzVqMwaKEtc1bNQfhttps://nicecrew.tv/lazy-static/thumbnails/fb6529ce-6065-4a98-a334-09010f737ef5.jpgGaia Online: Dungeon game overworld songA little screen recording of the dungeon overworld theme from Gaia online rpg. I'm not sure who originally made the song yet, so I'll look into that while I continue drawing and animating. From Gaia Online. (I also uploaded this because I couldn't find any videos that pertains to this song playing, so I might as well help out, I might remake this video a few years later, I should've raised the volume before recording.)https://nicecrew.tv/static/streaming-playlists/hls/51583a92-b424-4b35-b25c-b8c91e53c796/65c2e302-0f1b-4ed7-b489-425154204229-master.m3u8https://nicecrew.tv/videos/embed/b3ADMbHzVqMwaKEtc1bNQf406522024-12-15T02:37:24.131ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/iDkb6qCucYxesXrZqtfdL5https://nicecrew.tv/lazy-static/thumbnails/54cf13e7-41cc-470f-95bf-e42e4e36d4e6.jpgPoop Chute Print TimelapseSecond functional print went exceptionally well. This is used to capture purged filament from the back of the printer.https://nicecrew.tv/static/streaming-playlists/hls/8ee1b170-88df-42bb-922c-109c68874f4c/88e41dc3-1c87-4aae-977b-7536374f4a5f-master.m3u8https://nicecrew.tv/videos/embed/iDkb6qCucYxesXrZqtfdL543092024-12-15T08:26:42.544Zbambux1c3d printingtimelapseYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/mjbuscWncDvmK55mjT9fe7https://nicecrew.tv/lazy-static/thumbnails/aba0b681-92de-47f2-8c84-daf2861b5f4f.jpgVase Print TimelapseThis one took about 9 hours to print and came out flawlessly.https://nicecrew.tv/static/streaming-playlists/hls/a480a047-7137-4694-bee3-b572eeb23ca0/d17b0eac-41a9-4238-8297-63e704a3b762-master.m3u8https://nicecrew.tv/videos/embed/mjbuscWncDvmK55mjT9fe733572024-12-15T18:53:06.640Z3d printingtimelapsebambuYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/qFbnUKKGeyUY38ck5ofmkHhttps://nicecrew.tv/lazy-static/thumbnails/9e7ba7c2-2f6c-4072-a3e6-fa0afd4c1723.jpgTim Hale Interview: January 6 & Whitmer "Kidnap Plot" ConnectionsI am joined by Tim Hale, who spent a decade in service to our Nation, in the military and as a Navy Contractor who had his life upended and spent 3 years in prison due to January 6, 2021. We talk about the similarities and connections between January 6 and the Gov. Whitmer "kidnap plot," which have become known as the Fedsurrection and Fednapping Hoax.https://nicecrew.tv/static/streaming-playlists/hls/c7d3bafa-941c-4f1e-adce-5e0f7c5d9497/996efbcc-f1d0-45e3-ae5e-c7647695a241-master.m3u8https://nicecrew.tv/videos/embed/qFbnUKKGeyUY38ck5ofmkH797353312024-12-15T18:25:51.267ZTim HaleJanuary 6Whitmer kidnap plotfedsurrectionfednappingYESRadix Verum ☦NOhttps://nicecrew.tv/w/smxyVrVgZxpebFW8QDA8cohttps://nicecrew.tv/lazy-static/thumbnails/5b530257-dc66-405a-80b3-b472876afb18.jpgAMS Upgrade Print TimelapseThis is for the Bambu X1C's AMS device. These containers will hold desiccant to help keep filament dry.https://nicecrew.tv/static/streaming-playlists/hls/d56bef4e-84cf-4872-b557-ae815a63b2f0/9c69260c-7f7e-43a4-9674-052a5b167801-master.m3u8https://nicecrew.tv/videos/embed/smxyVrVgZxpebFW8QDA8co22592024-12-16T03:36:41.927Z3d printingbambutimelapseYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/mXHagy2craDug44S7amBgXhttps://nicecrew.tv/lazy-static/thumbnails/cde9034f-5df9-45d3-b162-76a8f7a47ab4.jpgMany Creatures AnimationAnother short animation, made with Macromedia Flash 8, drawn on my X61 ThinkPad Tablet. I still hope to make more longer animations in the future. Please enjoy.https://nicecrew.tv/static/streaming-playlists/hls/a9be0bd2-2025-4fbd-84ca-1f653e035af9/a574e23b-910e-4fc2-bcb3-d6caf6733b22-master.m3u8https://nicecrew.tv/videos/embed/mXHagy2craDug44S7amBgX17512024-12-17T15:37:30.423ZanimationentertainmentartYESDreamy's LoungeNOhttps://nicecrew.tv/w/m8oVDNWTiBB2fVJVyYXRr8https://nicecrew.tv/lazy-static/thumbnails/8fc6c7ca-70f6-451d-b512-bb2672fbc502.jpgFreeCAD 1.0.0: How to model a water filter bracket thing the wrong way but good enough to get som...FreeCAD 1.0.0: How to model a water filter bracket thing the wrong way but good enough to get something printablehttps://nicecrew.tv/static/streaming-playlists/hls/a2ff1b8e-7ecf-4828-b776-b017a03d68ed/3a5926fe-d605-4200-a273-baf15fd4802b-master.m3u8https://nicecrew.tv/videos/embed/m8oVDNWTiBB2fVJVyYXRr87995132024-12-19T19:39:32.383ZYESBrother TylerNOhttps://nicecrew.tv/w/8uJcisyQdgKWPa35GUWUFhhttps://nicecrew.tv/lazy-static/thumbnails/8994d8d7-e698-4f33-bc23-948738a94565.jpgInfinite XP Exploit in Baldur's Gate Dark Alliance (save scumming)Infinite XP Exploit in Baldur's Gate Dark Alliance (save scumming)https://nicecrew.tv/static/streaming-playlists/hls/3cb2ccb7-a14b-4450-b7bc-feb7d528bde6/e5ae774b-335d-412c-b688-2626df35109f-master.m3u8https://nicecrew.tv/videos/embed/8uJcisyQdgKWPa35GUWUFh1860102024-12-20T07:38:45.470ZYESBrother TylerNOhttps://nicecrew.tv/w/j6MwMYcwYikUL3K9uuiXqPhttps://nicecrew.tv/lazy-static/thumbnails/5f82e3a0-8480-4c17-981e-f579853fddd9.jpgJJR - 278 - Rockin' Red FlannelLast episode of JJR for 2024 I gather my thoughts, ramble and rant incoherently, make a few valid points, crack some jokes, fire off quips and engage in ALL the -ists and -isms. All while rockin' the red flannel yet again. Enjoy it, you won't see it again for a year. https://nicecrew.tv/static/streaming-playlists/hls/9293462e-8d06-4967-8819-dfd23a3ba7c3/73e291c0-9e1f-4776-8476-96589608d925-master.m3u8https://nicecrew.tv/videos/embed/j6MwMYcwYikUL3K9uuiXqP619154532024-12-23T02:06:44.076ZYESJust Joe Radio NOhttps://nicecrew.tv/w/58XtotdTCJuLK3aVzMttvfhttps://nicecrew.tv/lazy-static/thumbnails/7600c2f5-0d52-45c6-a0ca-21fe4985d331.jpgYouTuber & PUA Jack Denmo Gets Three Years in a Canadian PrisonI wanted to cover a story I think is not getting enough attention, the conviction of YouTuber and PUA @JackDenmo for SA. It's possible he did it, but it's also possible he was setup or framed. Source: https://www.thespec.com/news/crime/youtuber-convicted-of-sexual-assault-says-hes-the-victim/article_2337a4cd-89af-5e7e-b3dc-9bc4832e2376.htmlhttps://nicecrew.tv/static/streaming-playlists/hls/2180f26d-a89a-4df9-8412-a36da7133ad4/0eda0812-a4c4-4dbb-8855-aaaace8e7d97-master.m3u8https://nicecrew.tv/videos/embed/58XtotdTCJuLK3aVzMttvf5895312024-12-22T14:19:53.970Zdenmopuasexual assaultcanadaprisonYESRadix Verum ☦NOhttps://nicecrew.tv/w/5hTfyM14j5NZFfv9x39aVhhttps://nicecrew.tv/lazy-static/thumbnails/2c34f1e6-7bab-4bc4-8f70-13a84d0480ad.jpgWhitmer Kidnap Plot Defendant Files Complaint of Judicial MisconductToday, I filed a judicial misconduct complaint against Judge Robert Jonker on behalf of Barry Croft, Jr. who was framed as a "ringleader" in the FBI's Gov. Whitmer kidnap plot case.https://nicecrew.tv/static/streaming-playlists/hls/22c00a22-5539-48e1-800b-702676a30696/afcdbc6f-a1a0-4bbf-b90e-c338b4b7a78c-master.m3u8https://nicecrew.tv/videos/embed/5hTfyM14j5NZFfv9x39aVh22951822024-12-22T14:29:44.052ZBarry CroftWhitmer Kidnap PlotFBI HoaxJudicial MisconductYESKidnap and Kill: an FBI Terror PlotNOhttps://nicecrew.tv/w/rLD8RPUsxVmA4uB6f7LZaZhttps://nicecrew.tv/lazy-static/thumbnails/7936d617-ab4d-4aa3-908f-86e420ddba00.jpgKim Kardashian's Demonic and Creepy "Santa Baby" FilmKim Kardashian put out a video that openly mocks Christianity and Jesus Christ while purporting to be an Orthodox Christian.https://nicecrew.tv/static/streaming-playlists/hls/d0b013f4-3bc9-4371-9dee-15bac7c51c07/238d16a6-f88c-4938-b8d1-5e7e159d2f93-master.m3u8https://nicecrew.tv/videos/embed/rLD8RPUsxVmA4uB6f7LZaZ39553742024-12-23T23:41:17.890Zkim kardashianmkultrapornhollywoodsmutYESRadix Verum ☦NOhttps://nicecrew.tv/w/2VDdpAzdRGANV19jTQu2Vphttps://nicecrew.tv/lazy-static/thumbnails/c51fef5e-0ee5-4f10-aaa9-c4a977478471.jpgThe Great Elon Musk Crashout of 2024In truly spectacular fashion, Elon Musk decided to crash out on "X" within just 48 hours. The mask totally came off and he went full-on sociopathic autist. He is now censoring his critics, calling for Stalinist purges of a political party he just joined 5 minutes ago, and announced blue check censorship is back.https://nicecrew.tv/static/streaming-playlists/hls/0f967e0b-2258-472e-9081-d0a7c41b45fd/72c947dc-f960-4de2-a803-95c888eaf9ef-master.m3u8https://nicecrew.tv/videos/embed/2VDdpAzdRGANV19jTQu2Vp268458722024-12-28T17:35:30.063ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/o8ous4UVFxvzXx5uu8UzwThttps://nicecrew.tv/lazy-static/thumbnails/000e0e22-9627-4c79-ab3d-c5722d4e68fe.jpgThe Truth About Hinduism - Full Documentary (Hinduism EXPOSED!)Not the best nor the worst Bible documentary on the planet about Hinduism. Probably mid-peak Anderson.https://nicecrew.tv/static/streaming-playlists/hls/b3311dff-5878-46fb-a494-fbedea77ebb3/b2fe5abc-5b36-4785-8e36-93904bcfe3e9-master.m3u8https://nicecrew.tv/videos/embed/o8ous4UVFxvzXx5uu8UzwT34855382024-12-29T07:45:16.737ZYESBrother TylerNOhttps://nicecrew.tv/w/3Fy78kViLbk1EnGz2CwH5Jhttps://nicecrew.tv/lazy-static/thumbnails/e96d392e-e567-43cd-ad0c-671a87d9b16c.jpgDid the Holocaust Really Happen? (Steven Anderson)Probably peak Anderson, digestible Christian perspective about the Holocaust, likely safe to share with Believers that haven't yet addressed the JQ. Some inaccuracies as I watch it today, like a disconnect between Christianity and the Third Reich. But generally a good stepping stone for people who are receptive to the truth.https://nicecrew.tv/static/streaming-playlists/hls/15b811f5-3bbf-4096-a93a-4ef36b73b3a6/133136dc-1094-46fa-94ae-4f5dae7603e5-master.m3u8https://nicecrew.tv/videos/embed/3Fy78kViLbk1EnGz2CwH5J223051372024-12-29T08:00:26.090ZYESBrother TylerNOhttps://nicecrew.tv/w/nRjqKcfM6AoaWweqwCcKN8https://nicecrew.tv/lazy-static/thumbnails/c55c920e-6c3a-4c8d-bf80-abb2945b9988.jpgThe Beast as SaintDocumentary narrated by Kevin Strom of the National Alliance website on "Doctor" Martin Luther King Jr. Why is there a holiday dedicated to this Communist Marxist on the US Calendar?https://nicecrew.tv/static/streaming-playlists/hls/b0f2b660-3c73-45cb-9dfb-f37aafb82ab7/be17a603-d2be-4250-a465-3ce56c06f19b-master.m3u8https://nicecrew.tv/videos/embed/nRjqKcfM6AoaWweqwCcKN812650342024-12-29T18:59:09.301ZYESMain teknoskillz channelNOhttps://nicecrew.tv/w/egnXcrm31dW8JW2VRPuXeahttps://nicecrew.tv/lazy-static/thumbnails/dc82551e-f170-47f9-8023-3d4f843dab84.jpgSpeed Paint: Girl to TreeminHere's a surreal body horror drawing of a girl becoming a Treemin (or human-tree) I hope you all enjoy, I also wish YouTube stops lagging on me sometimes. Finished Drawing:https://nicecrew.tv/static/streaming-playlists/hls/6b6c7cc1-b3c4-4ab7-97b9-e25d83c5f767/85c70d0f-3972-429f-b183-eb3c49c2360e-master.m3u8https://nicecrew.tv/videos/embed/egnXcrm31dW8JW2VRPuXea186562024-12-29T22:43:14.082ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/q2MYhAXcEBwBaNNFyS6BAwhttps://nicecrew.tv/lazy-static/thumbnails/d7a8b309-cfec-4e26-b42c-806831064d1b.jpgHelldivers - Low FPS EditionJust ripped my nipples clean off.https://nicecrew.tv/static/streaming-playlists/hls/c29b66e3-6d59-4528-b884-9eed13543266/b36eac3b-c4bc-47b8-921f-0413dcc07d8f-master.m3u8https://nicecrew.tv/videos/embed/q2MYhAXcEBwBaNNFyS6BAw41285152024-12-31T03:25:48.040ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/w7qdJKafjRvTyNTNKniXPghttps://nicecrew.tv/lazy-static/thumbnails/fb9e80a5-da54-4747-bbeb-b8f9c3594651.jpgWe are so cooked.A rant to start of 2025, but I love you all. https://nicecrew.tv/static/streaming-playlists/hls/f3d78c5c-18bd-4fad-9876-6f0063503749/a8ec02a9-973e-42fc-8fe2-ef6e99b3fbb7-master.m3u8https://nicecrew.tv/videos/embed/w7qdJKafjRvTyNTNKniXPg107556292025-01-02T22:35:23.846Z2025economyelon muskcensorshipblackpilledYESRadix Verum ☦NOhttps://nicecrew.tv/w/79tMVCFVnFYmozGETECdxXhttps://nicecrew.tv/lazy-static/thumbnails/e7c717ed-43f9-4292-a9e0-b384a8b31092.jpgNosferatu Film Review! (No Spoilers)I went to see Robert Egger's Nosferatu and I wanted to share my thoughts with you, without spoilers. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #nosferatu #nosferatu2024 #film #filmreview #roberteggers #moviereviewhttps://nicecrew.tv/static/streaming-playlists/hls/31c5e8d0-4cd6-413e-8d14-71d6e8f4a04d/7e54bf9b-6744-407f-a19c-51583808f676-master.m3u8https://nicecrew.tv/videos/embed/79tMVCFVnFYmozGETECdxX40551042025-01-03T19:41:30.989Znosferatunosferatu 2024robert eggersmovie reviewfilmYESRadix Verum ☦NOhttps://nicecrew.tv/w/oiuRyEGhSYeBa37ZS4ckN9https://nicecrew.tv/lazy-static/thumbnails/adf3377b-28d5-4fea-adcd-5fb77cc3b77d.jpgSarah Michelle Gellar says, 'Marriage Should Last,' Blames 'Disposable' SocietyJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/b49a7a12-e5d9-4e18-9507-9eed2f878788/73396987-b77a-4d62-ab01-57eec936b034-master.m3u8https://nicecrew.tv/videos/embed/oiuRyEGhSYeBa37ZS4ckN940703992025-01-06T22:56:50.357ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/hrotpYWtJysJM9UH2WgbaZhttps://nicecrew.tv/lazy-static/thumbnails/d6c36427-4703-468e-81ca-b10f1b10e9ea.jpgElon Musk is the Meghan Markle of the RightSo, basically, I think Elon Musk is the Meghan Markle of the controlled right, the fake right, whatever you want to call it. We are going to talk about their narcissism. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/851da97d-6d09-4a43-824e-b3670df11943/a40e3ac1-fe8e-4617-870e-a38f7adeb979-master.m3u8https://nicecrew.tv/videos/embed/hrotpYWtJysJM9UH2WgbaZ116254152025-01-10T16:58:15.343ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/8PCWnbq7H2K3Vp8oUghMoXhttps://nicecrew.tv/lazy-static/thumbnails/7d68d5c7-9a8d-47a9-83bf-ad6b67ec9843.jpgWhatifalthist: The Most Grandiose Schizo on YouTubeContent creator and YouTuber "Whatifalthist" one-shotted and fried his brain with ayahuasca and went on a 10 plus hour deranged schizo rant. He openly admits to conversing with demons. This is your mind on autism, narcissism and psychedelics. It's actually a very sad and serious situation. This is a drug and demon induced manic episode. The man needs a priest. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/3f56b0f5-ab02-4985-a690-03e526bedb77/1a23e568-8192-4ad7-bcc1-42d5b1ff9ac7-master.m3u8https://nicecrew.tv/videos/embed/8PCWnbq7H2K3Vp8oUghMoX361252802025-01-12T18:23:13.066ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/mwGDRPZoKhaF5eSMrbdfpfhttps://nicecrew.tv/lazy-static/thumbnails/d2259713-367a-4792-a5f4-6aa49c237693.jpgICS5 - Day 1 - 08. Robert Malone...https://nicecrew.tv/static/streaming-playlists/hls/a64023b2-85f4-4a85-aea8-3b11fcd7d59c/f1427764-9dca-4491-9a91-d90faa25707b-master.m3u8https://nicecrew.tv/videos/embed/mwGDRPZoKhaF5eSMrbdfpf15215702025-01-14T04:32:35.573ZYESMain ChannelNOhttps://nicecrew.tv/w/oYNuWu8xjpK7z3gmLJ7ypThttps://nicecrew.tv/lazy-static/thumbnails/12df454e-2983-47cb-998b-13108d55a3c1.jpgSomething Doesn't Add Up About the Luigi Mangione Case...Something doesn't add up with the "official" narrative regarding the high-profile assassination of United Healthcare CEO Brian Thompson and the alleged shooter Luigi Mangione. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/ba175b8e-3ae0-4ca0-a8f4-d41c85939979/551dc2b2-8aff-4435-ba8e-d3966d656b4d-master.m3u8https://nicecrew.tv/videos/embed/oYNuWu8xjpK7z3gmLJ7ypT182052732025-01-16T19:38:38.510ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/t6ENyuoFhMb147ez2WxfWohttps://nicecrew.tv/lazy-static/thumbnails/f5aff923-60bd-4231-8467-622bab8b3db9.jpgMama JF (Élora Patoine) Update: "Widower" J.F. Gariépy on the Run from AuthoritiesWe have an unfortunate update to the story we covered last year: Élora Patoine's disappearance, known as "Mama JF." Mama JF was the spouse of J.F. Gariépy, host of J.F. Tonight. She's the mother of his children. She has been missing for over a year now with no sightings of her whatsoever since she went missing. https://www.rcmp-grc.gc.ca/en/news/2023/update-missing-person-elora-patoinehttps://nicecrew.tv/static/streaming-playlists/hls/db71602f-41f6-4f6f-9ed2-f6a3194bb0e2/338ae7d6-9f93-4f31-b15c-75791256370e-master.m3u8https://nicecrew.tv/videos/embed/t6ENyuoFhMb147ez2WxfWo312855392025-01-17T02:58:47.549ZMama JFJF GariepyMissing PersonWidowermanslaughterYESRadix Verum ☦NOhttps://nicecrew.tv/w/kNYaL8WJEu5h6yBAkh7d5ahttps://nicecrew.tv/lazy-static/thumbnails/20786b56-7c19-469e-ae19-0c0cf8130741.jpgNCD Coaster Print TimelapseDesigned by yours truly.https://nicecrew.tv/static/streaming-playlists/hls/a06c7680-9f2e-4418-af9b-cb6fd1d40d71/5a943b42-1373-4636-9bac-552f8996a977-master.m3u8https://nicecrew.tv/videos/embed/kNYaL8WJEu5h6yBAkh7d5a3572025-01-18T15:14:53.503Znicecrewmerchandisecoaster3d printing3dYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/6E2wPVfFsCwdDzTwFybEBYhttps://nicecrew.tv/lazy-static/thumbnails/fa3a0292-400b-4a53-9360-101734b81e68.jpgNCD Magnet Mass Print TimelapsePrinting a couple multi-color magnets for sale.https://nicecrew.tv/static/streaming-playlists/hls/2dcce67e-c08b-42d1-a444-24506ebe046e/d353c53d-eae2-47f1-bc31-f36b4434f880-master.m3u8https://nicecrew.tv/videos/embed/6E2wPVfFsCwdDzTwFybEBY5592025-01-18T15:15:55.333Znicecrewmagnet3d printtimelapseYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/4u4aBNJEzsGeeWuBAVXytghttps://nicecrew.tv/lazy-static/thumbnails/60cdecab-6bc9-484a-a2a9-989b196e1d0e.jpgMy thoughts on what just happened.Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/1c36314a-886f-4f10-bff5-462bf08db995/8804d3d3-1815-4193-a742-6407bd116991-master.m3u8https://nicecrew.tv/videos/embed/4u4aBNJEzsGeeWuBAVXytg91452102025-01-21T21:17:56.251ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/21Qp7fJPMBtCUDGCqfYMivhttps://nicecrew.tv/lazy-static/thumbnails/39a3b091-18de-4055-99aa-4a6439c9cd18.jpgLarry Ellison and Sam Altman Announce Dystopian A.I. "Project Stargate"The Trump administration, along with Larry Ellison and Sam Altman, announced a new $500 billion AI venture called "Project Stargate." The alleged goal is to create new AI infrastructure with data centers nationwide. This is incredibly concerning as Larry Ellison is a CIA frontman who has advocated for mass surveillance and an AI-powered panopticon. This is transhumanism and technocracy. Sources: https://www.joebot.xyz/p/elon-musk-and-the-transhuman-wing https://archive.is/6f6zS https://t.co/qOd6cW9KDZ https://dataconomy.com/2025/01/22/oracle-stock-jumped-9-percent-thanks-to-trumps-stargate-project/ https://www.popularmechanics.com/science/a61058879/cia-stargate-project/ Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/0836f719-ff47-4675-8ab7-3deb4552f3eb/022ccace-dad3-48fe-b670-8dcd014e2d29-master.m3u8https://nicecrew.tv/videos/embed/21Qp7fJPMBtCUDGCqfYMiv320052582025-01-22T18:37:35.411ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/qdiTbT9CXvxPySzgk3knEthttps://nicecrew.tv/lazy-static/thumbnails/c879a1d9-3d83-4233-bf47-f0c72eeac561.jpgRobert F. Kennedy Jr. 2020 predictions on Fauci and GatesSpeaking in August 2020—before any of it had unfolded yet—Robert F. Kennedy Jr. made these predictions about Fauci, Gates and the Covid vaccine, which proved to be BREATHTAKINGLY accurate.https://nicecrew.tv/static/streaming-playlists/hls/c4134609-fa5f-41c3-aa76-51e22a8410e3/fc0cbd54-d09d-432a-ae8e-c07768343a79-master.m3u8https://nicecrew.tv/videos/embed/qdiTbT9CXvxPySzgk3knEt2095172025-01-26T00:45:06.762ZAnthony FauciBill Gates#EuropeansForKennedyRobert F. Kennedy Jr.RFK JrYESMain ChannelNOhttps://nicecrew.tv/w/dJT4aPJvemfB2hYE4bR6Kzhttps://nicecrew.tv/lazy-static/thumbnails/595e0961-f677-44f5-bdf9-7794c4bf16ac.jpgMist SurvialThis game is still early access. So things are not optimized and buggy. Only one FT developer working on it and maybe one or two other dudes. Good game, lots of fun for the limited amount of content it has at this time.https://nicecrew.tv/static/streaming-playlists/hls/672a5da5-3763-42bd-8216-fc7a3e01503b/ee990b3d-622d-4801-ab66-f7e449cdae42-master.m3u8https://nicecrew.tv/videos/embed/dJT4aPJvemfB2hYE4bR6Kz25265112025-01-26T02:48:02.140ZYESMain omega_variant channelNOhttps://nicecrew.tv/w/8VZ2ZiNMmgtNTVJ3rDjz9Xhttps://nicecrew.tv/lazy-static/thumbnails/ddd0f12e-c924-4711-a97c-494c3a69c6bb.jpgDetached and Unbothered (from a Neuroscience & Orthodox Christian perspective)Most videos and advice I have seen on detachment are new-age garbage. Here is how to be detached and unbothered from a neuroscience and Orthodox Christian perspective. We look at "How Emotions are Made" by Lisa Feldman Barrett and "Our Thoughts Determine Our Lives" by Elder Thaddeus. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/403989ff-4cd1-4151-80c2-04b9ca32d2eb/828a0357-2dc9-4f1b-bb64-f6fc58144148-master.m3u8https://nicecrew.tv/videos/embed/8VZ2ZiNMmgtNTVJ3rDjz9X23230902025-01-26T03:21:43.707ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/r9dgzRNoFx7nzgDhz3vZsAhttps://nicecrew.tv/lazy-static/thumbnails/7dc2de53-d817-4e2f-a098-a5f59c283f6c.jpgMonsters & Death animationAn animation I started last year and wanted to finish it, I hope you all enjoy this one.https://nicecrew.tv/static/streaming-playlists/hls/cb99fa3d-d3f3-4d43-8b84-32ac78d7f2d2/15a412ce-1c64-47ac-b607-b12f82e2f5f2-master.m3u8https://nicecrew.tv/videos/embed/r9dgzRNoFx7nzgDhz3vZsA39542025-01-26T18:19:06.512ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/mjGCnv8qu1jAGiSzAF6k59https://nicecrew.tv/lazy-static/thumbnails/d6202184-4d1c-4da2-b34f-0302f7d6ff64.jpgTime Lapse: Silk & BloodA HiPaint time lapse of this white and illustration. I hope you all enjoy this illustration and stuff. Finished Drawing: https://side7.com/content/jDMWY0LerO Alt Art Link: https://www.deviantart.com/rainbowdoodler209/art/Silk-and-Blood-1151372712 (Creative Commons fir the music)https://nicecrew.tv/static/streaming-playlists/hls/a49332c9-944b-4203-987a-5dec31dfee54/6c4e5e7e-a3ea-419b-ae5f-52cd70dd6148-master.m3u8https://nicecrew.tv/videos/embed/mjGCnv8qu1jAGiSzAF6k59287582025-01-28T04:08:50.707ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/6b1hTaNXLSrt3jngxAnSAghttps://nicecrew.tv/lazy-static/thumbnails/87c5c71d-01c3-45de-8850-82b0b8eb0bfc.jpgThe Black PlagueRacial Armageddon Approaches. https://nicecrew.tv/static/streaming-playlists/hls/29e34f75-0fdb-499c-adae-4db47f95acd3/ffbfbf32-5f44-4857-9df1-db6d35766305-master.m3u8https://nicecrew.tv/videos/embed/6b1hTaNXLSrt3jngxAnSAg2395142025-01-29T00:34:11.864ZPlagueKillyourtvblackYESMain killyourtv channelNOhttps://nicecrew.tv/w/94sEkw7xhwkWLYbrwpMt2Lhttps://nicecrew.tv/lazy-static/thumbnails/2c9091b8-5b8d-431e-8bce-d494b55b70e3.jpgJJR - 279 - We Can Pick Our Own PeasRight out of the gate, Donald Trump fires off a series of Executive Orders and actions that has sent shockwaves throughout the world's entire Dependent Class. I walk through the opening salvos and subsequent fallout. Also, This Week In Activism, Kwane caint catch a ride, Henyard Goes Haywire and so much more. https://nicecrew.tv/static/streaming-playlists/hls/4144c560-37a0-4e9e-a270-5d1e2b9af6aa/80c93494-eea4-4f91-983f-ccb46694b23a-master.m3u8https://nicecrew.tv/videos/embed/94sEkw7xhwkWLYbrwpMt2L1225859022025-01-31T06:07:04.869ZYESJust Joe Radio NOhttps://nicecrew.tv/w/dahxnuxV6k3cNrPhcTAZamhttps://nicecrew.tv/lazy-static/thumbnails/5aa69848-5d9a-4c38-ad94-e607599887c9.jpgI went on Breanna Morello's Show to talk about the Whitmer Fednapping hoax victimsI went on Breanna Morello's Show to talk about the Whitmer Fednapping hoax victimshttps://nicecrew.tv/static/streaming-playlists/hls/62798d30-b0de-4b1c-9dbd-11cd883eb302/82e4cb62-14a0-4516-906a-f1ea6be9fbf0-master.m3u8https://nicecrew.tv/videos/embed/dahxnuxV6k3cNrPhcTAZam2585322025-02-04T12:22:50.266ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/p7rLdZyzEEFXum2U83xrzThttps://nicecrew.tv/lazy-static/thumbnails/b0cb814d-8d99-4426-9dc5-e56c314c9e62.jpgThoughts on the latest FBI stupidity 🤣Thoughts on the latest FBI stupidity 🤣https://nicecrew.tv/static/streaming-playlists/hls/bb28874b-6103-4a25-8c87-185a4b047c09/2f366e23-07c1-4705-a97d-4e3a250a253a-master.m3u8https://nicecrew.tv/videos/embed/p7rLdZyzEEFXum2U83xrzT590982025-02-05T20:23:23.249ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/gn6tKTByQ8TUZu5Y6Q18Hvhttps://nicecrew.tv/lazy-static/thumbnails/5e53a084-c69f-4531-a1e2-8839258f70e1.jpgI finally have a documentary update for you!I am so excited to get back on the road again and to be making progress on getting this film completed. Support the film here: https://www.kandkfilm.com/donate Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #documentary #film #movie #indiefilmhttps://nicecrew.tv/static/streaming-playlists/hls/7c6b134a-7695-4f61-b0ba-56eb6056ea83/bd79e93f-8138-481a-8869-3c34b474897e-master.m3u8https://nicecrew.tv/videos/embed/gn6tKTByQ8TUZu5Y6Q18Hv8185572025-02-05T20:26:12.705ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/3hnFKq2kSeP3C5uVGVbYnNhttps://nicecrew.tv/lazy-static/thumbnails/e653bb7a-894a-4f6a-a643-16d632e315ed.jpgBobo baby mode activated!Bobo baby mode activated!https://nicecrew.tv/static/streaming-playlists/hls/127b8aac-61c8-48c4-87d7-76818e2d0cf0/24ad3bcf-3254-4467-bf71-025076a632ec-master.m3u8https://nicecrew.tv/videos/embed/3hnFKq2kSeP3C5uVGVbYnN120142025-02-05T20:43:13.387ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/a3mKK1AXHSKUb4GkjNwhDhhttps://nicecrew.tv/lazy-static/thumbnails/03080453-9d27-47ef-a20e-c8e6506a1067.jpgJJR - 280 - USAID It Would Never EndRaise your hand if you've never heard of USAID! Newly formed Executive Branch agency DOGE exposes the financial head of the serpent, USAID, giving the public an inside view of the Federal government's slush-fund apparatus used to fund everything from lubricant and condoms for HIV positive Ugandans to NGO's that ship in our 3rd world replacements. Also we all want a better life, Snoop stands up to hate, banging bongos for black Canadian trailblazers, and oh SO MUCH morehttps://nicecrew.tv/static/streaming-playlists/hls/49368693-83f0-46b0-bb6e-5a078026b342/c527076c-dd4b-4652-b2ba-11bb070fe8a7-master.m3u8https://nicecrew.tv/videos/embed/a3mKK1AXHSKUb4GkjNwhDh926154802025-02-06T05:41:40.286ZYESJust Joe Radio NOhttps://nicecrew.tv/w/mRr7ubh6q872k3ixnd7ACJhttps://nicecrew.tv/lazy-static/thumbnails/f12f61da-5c9d-4c14-93e9-ca19a65241a4.jpgFBI Lawsuit Filed by Norm Eisen & Mark Zaid to Protect Agents Who Hunted & Terrorized AmericansI wanted to do a deep dive into the lawsuit brought against the Trump Justice Department by Norm Eisen, Mark Zaid, and Pam Keith on behalf of "anonymous" FBI agents seeking to conceal their identity to prevent them from being investigated or fired for misconduct. Sources: https://x.com/kyledcheney/status/1886832711718891900 https://storage.courtlistener.com/recap/gov.uscourts.dcd.277085/gov.uscourts.dcd.277085.1.0.pdf https://x.com/mrddmia/status/1886489519114891442 https://x.com/CQuaglin/status/1886512182491525544 https://x.com/listen_2learn/status/1886435348831748251 https://storage.courtlistener.com/recap/gov.uscourts.dcd.277103/gov.uscourts.dcd.277103.19.1.pdf https://x.com/JohnStrandUSA/status/1886934746820960724 https://x.com/BuckSexton/status/1887172308801904872 https://www.newsweek.com/exclusive-secret-commandos-shoot-kill-authority-were-capitol-1661330 Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/a8ddb192-7bbd-4dec-aef1-7464fb03af2a/14dc0d81-e939-4f81-ae67-89fcdc481bab-master.m3u8https://nicecrew.tv/videos/embed/mRr7ubh6q872k3ixnd7ACJ377102292025-02-06T20:06:16.676ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/osNYDZ7y5x8cTE9kuZ5fHrhttps://nicecrew.tv/lazy-static/thumbnails/09722307-b96d-4a3b-aa33-29d5d0db5a21.jpgWe R AnomamnusNo 4giv, 5get, bontambo portronumhttps://nicecrew.tv/static/streaming-playlists/hls/b5e756ca-75bd-4fb2-b4a6-23b5580502cb/3f9b727b-6528-4cfd-81b6-3d3afb7d703a-master.m3u8https://nicecrew.tv/videos/embed/osNYDZ7y5x8cTE9kuZ5fHr2300312025-02-08T13:24:32.140ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/44pwKYuFybkvYcpbEZSHyyhttps://nicecrew.tv/lazy-static/thumbnails/c446f793-9b4d-4847-b5ce-349472e7a910.jpgSong Preview 7 (read desc)A jumpstyle inspired song I’m continuing on, and I have listened to seceral jumpstyle songs to get the idea of how they work and sound. Please enjoy!https://nicecrew.tv/static/streaming-playlists/hls/18c525fa-f903-4750-a021-bd992e7fd344/2f5c3670-a6e5-419f-adec-eb03431b01e8-master.m3u8https://nicecrew.tv/videos/embed/44pwKYuFybkvYcpbEZSHyy101532025-02-08T20:03:06.368ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/34HSe6vVQdYYRzcDiQptjjhttps://nicecrew.tv/lazy-static/thumbnails/47f18424-06fd-45f5-862e-d77c89a4282e.jpgReady or Not - Here I CumI hate this gamehttps://nicecrew.tv/static/streaming-playlists/hls/10b74f37-d36d-4ef9-abf1-0f4ef677f8ea/cdc13b8a-a9ef-4ed9-b01b-b4b05ee6603b-master.m3u8https://nicecrew.tv/videos/embed/34HSe6vVQdYYRzcDiQptjj403101272025-02-09T15:34:16.395ZYESGamingNOhttps://nicecrew.tv/w/fPscQQAq1zJ1uwdyDmTxuuhttps://nicecrew.tv/lazy-static/thumbnails/7bed3c7b-5a7d-49cf-bdd1-b88dc1f2c50a.jpgJJR - 281 - Debanking The DebankersYou guys know how much I love my nihilistic black-pilling and I've been a huge critic of Donald Trump, but THIS TIME I'm asking you to just to enjoy the W and allow for the possibility that something much bigger than Trump is taking place here. Searing coverage of developments in the USAID scandal. Also FINALLY some Solutions for South Africa, This Week In Activism, a jumpscare montage, and many MANY other refinementshttps://nicecrew.tv/static/streaming-playlists/hls/78000c1d-812b-4b78-8064-911fcfef5528/3e2c1204-3abd-443e-92eb-e28c019cab0e-master.m3u8https://nicecrew.tv/videos/embed/fPscQQAq1zJ1uwdyDmTxuu810256712025-02-10T05:00:44.865ZYESJust Joe Radio NOhttps://nicecrew.tv/w/5HUxYeFkdHX9AxgrnfNbMmhttps://nicecrew.tv/lazy-static/thumbnails/b6befd25-482e-4d7c-ac42-2b0f98728d37.jpgMy initial thoughts on the Neil Gaiman allegationsI just finished listening to the Tortoise Media podcast series "Master" on the allegations against Neil Gaiman by a handful of women who all seem to have been in relationships with him. I have a very different take on this than most people. I also read the Lila Shapiro Vulture article and the lawsuit filed by Scarlett Pavlovich. Sources: https://www.findlaw.com/legalblogs/celebrity-justice/the-lawsuit-at-the-end-of-the-lane-author-neil-gaiman-faces-rape-and-sexual-assault-accusations/ https://www.cbr.com/neil-gaiman-sexual-assault-allegations/ Vulture Article: https://archive.is/LHToW Tortoise Media Podcast Series: https://archive.is/OHihj Lawsuit: https://www.courtlistener.com/docket/69605847/2/pavlovich-scarlett-v-gaiman-neil/https://nicecrew.tv/static/streaming-playlists/hls/263e6f5e-9d75-42b6-9b57-9f81cb54d29e/44dbb68e-70d0-43fa-af2e-0dccd0e034a3-master.m3u8https://nicecrew.tv/videos/embed/5HUxYeFkdHX9AxgrnfNbMm251151202025-02-10T15:54:53.847Zneil gaimansexual assaultsex traffickingmetooYESRadix Verum ☦NOhttps://nicecrew.tv/w/dBTbQWXr3fARF8T9Tu1t5whttps://nicecrew.tv/lazy-static/thumbnails/82f65d5b-8dd0-4cf2-9bdb-e737d81dad9b.jpgI Dream of FreedomJust me and my little machine gun. https://nicecrew.tv/static/streaming-playlists/hls/66303daf-61ac-4e0d-9209-083d0763baf2/8186fd61-ede7-491c-9283-c2448c7bcc25-master.m3u8https://nicecrew.tv/videos/embed/dBTbQWXr3fARF8T9Tu1t5w15551542025-02-11T01:56:50.960ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/48P4ELajxQtYW4P73oh5fRhttps://nicecrew.tv/lazy-static/thumbnails/4b395b6e-89e1-468c-8d91-16d14bd6eb32.jpgBeach morningBeach morninghttps://nicecrew.tv/static/streaming-playlists/hls/1962a049-ce14-4fc4-9e42-59710d046f0d/db3843bd-eb4c-4970-be24-3621cb39d88f-master.m3u8https://nicecrew.tv/videos/embed/48P4ELajxQtYW4P73oh5fR1502025-02-17T12:37:58.274ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/uu47ae3dA2KJ1k4wMA5Esxhttps://nicecrew.tv/lazy-static/thumbnails/2e636e44-e8a3-4696-97d7-3252a61f6916.jpgHelldivers 2_ Into the GloomQuick vid I made from one of my ventures into Fori Prime before the terminid gloom consumes it entirely.https://nicecrew.tv/static/streaming-playlists/hls/e6aa9f4e-e52b-462a-bbb4-78eec98ba93b/0164d8cb-ba23-4bd4-ad4b-1c36998f526a-master.m3u8https://nicecrew.tv/videos/embed/uu47ae3dA2KJ1k4wMA5Esx1105162025-02-23T22:00:31.670ZYESMain omega_variant channelNOhttps://nicecrew.tv/w/gtsMs9Js9obvT7TQVEGLkrhttps://nicecrew.tv/lazy-static/thumbnails/eeb4ba0c-de95-4dcc-8b76-644577c076c3.jpgFedi Fumble 2025VOD of the Wrestling Tournament from Feb 21 2025. Cheershttps://nicecrew.tv/static/streaming-playlists/hls/7d4eaaed-d9c3-403e-aba6-d546c66362d7/cb27002a-5a19-40a1-8054-189a41d2ca53-master.m3u8https://nicecrew.tv/videos/embed/gtsMs9Js9obvT7TQVEGLkr924452512025-02-26T08:13:29.092ZGamingWrestlingBadminsYESBadmin GamingNOhttps://nicecrew.tv/w/vLzSZMLeaU8uENFeiB8n5dhttps://nicecrew.tv/lazy-static/thumbnails/770005d0-2aa2-4e74-aca0-baa5c246d22f.jpgThis was SO embarrassing!!This was SO embarrassing!!https://nicecrew.tv/static/streaming-playlists/hls/f112a037-90d6-4fcf-8ba8-6e0e8f414190/e7ca34a0-a421-4cbf-adbd-b1d5de5a19e2-master.m3u8https://nicecrew.tv/videos/embed/vLzSZMLeaU8uENFeiB8n5d41092025-02-28T19:39:50.657ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/3XAXbVYYUxML1DmUhS4W6Thttps://nicecrew.tv/lazy-static/thumbnails/fbbe32f9-0db4-4ecb-94fd-74c82aacd335.jpgMy thoughts on the shameful "Epstein Files" PR stunt...I wanted to give my thoughts about the Con Inc. influencer photoshoot yesterday masquerading as a "release" of Epstein files, which were just binders of recycled 5-year-old documents they redacted more than they originally were. Posing, laughing, smiling, and taking selfies off the backs of harmed children. Shameful and embarrassing. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/17f5b96c-8e55-423f-9d7d-7e0b9fffe085/b46e746d-021c-4dd8-b3e2-17d8cdb2627b-master.m3u8https://nicecrew.tv/videos/embed/3XAXbVYYUxML1DmUhS4W6T162354522025-02-28T20:24:09.550ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/6XM24QyXmf4d4yFisREQ3Mhttps://nicecrew.tv/lazy-static/thumbnails/b7fc40d6-7774-4089-8432-0316406849ed.jpgJJR - 282 - Performative NonsenseAll the world's a stage and if we're seeing it, it's probably theater. Spaceman slanders PF, Epstein Files: The Series, Grapplemania 17 - McDonald's Man vs. The Ukranian Snorter *WARNING: FOUL LANGUAGE*https://nicecrew.tv/static/streaming-playlists/hls/3047581e-62c9-4f94-8452-66c584768561/b187759b-4207-427d-a906-1f17c32332b7-master.m3u8https://nicecrew.tv/videos/embed/6XM24QyXmf4d4yFisREQ3M742157712025-03-02T05:19:13.009ZYESJust Joe Radio NOhttps://nicecrew.tv/w/obTeF9JB6wqHgHwuxCpkhthttps://nicecrew.tv/lazy-static/thumbnails/ea695b04-6910-41b5-829d-60a8e3818340.jpgamazing first pics from moon captured after historic touchdownAs a matter of fact, it is a big deal Firefly Aerospace's Blue Ghost lander beamed back views of Earth and more from the lunar surface after its historic landing. Full Story: https://www.space.com/space-exploration/missions/earth-shines-over-moon-in-amazing-1st-photos-from-private-blue-ghost-lander-were-all-in-that-picturehttps://nicecrew.tv/static/streaming-playlists/hls/b3ae103a-3cc4-4f08-bc6e-6826ac4f289f/02dda93c-d659-40ca-8b74-ff57f4a4a101-master.m3u8https://nicecrew.tv/videos/embed/obTeF9JB6wqHgHwuxCpkht75072025-03-03T02:08:25.403ZFirerflyBlue GhostMoon LanderYESMain ChannelNOhttps://nicecrew.tv/w/1Xyoz6tu8itj9YNDCz7NgZhttps://nicecrew.tv/lazy-static/thumbnails/89c2a441-d8ac-4c30-a71d-2dfee7ca6b7f.jpgThe Railroading of Luigi Mangione: Was he illegally detained and searched?I have a major update on the "Claims Adjuster," aka Luigi Mangione, the current suspect in the UnitedHealth CEO shooting of Brian Thompson. Luigi's lawyers have filed a Motion to Suppress evidence they claim was obtained illegally. Sources: https://x.com/mangionethinker/status/1895684823085470058 https://x.com/LuigiCaseFiles/status/1895924180828451158 https://x.com/collectiveone61/status/1895686906807271689 https://x.com/ABC/status/1895833602786480209 https://x.com/davenewworld_2/status/1874439758849716506 https://x.com/G07_17/status/1893046198291841183 https://wlos.com/news/nation-world/defense-disputes-evidence-luigi-mangione-arrest-claims-police-violated-his-rights-crime-investigation-altoona-blair-county-court-motion-unlawful-detained-mcdonalds-thomas-dickey-pennsylvania-new-york-ceo-shooting-suspect-unitedhealthcare-custody- https://www.courtlistener.com/docket/69486702/united-states-v-mangione/ https://www.pacourts.us/news-and-statistics/cases-of-public-interest/commonwealth-v-mangione https://www.pacourts.us/Storage/media/pdfs/20250228/171957-mangioneptm.pdf Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/07c1de2c-d7c6-4154-a256-13093ebaf8d7/6e84cded-b360-4fa7-9549-f0d4fbb3b36f-master.m3u8https://nicecrew.tv/videos/embed/1Xyoz6tu8itj9YNDCz7NgZ31050702025-03-03T21:25:24.404ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/wsBacHQtKnCasPUNXwSdv2https://nicecrew.tv/lazy-static/thumbnails/b875f79f-6ddd-433f-8d9c-578e74c24526.jpgLuigi Mangione SEX TAPES??Luigi Mangione SEX TAPES??https://nicecrew.tv/static/streaming-playlists/hls/f6a92a44-c372-4dee-84db-e4991d0015d3/bf808800-971a-4b2e-989e-034fcc485e33-master.m3u8https://nicecrew.tv/videos/embed/wsBacHQtKnCasPUNXwSdv26001372025-03-05T18:15:03.201ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/ksmUSQhRbudDN1QHrTRiBYhttps://nicecrew.tv/lazy-static/thumbnails/a05daafe-e87e-4ead-b660-953ecb7a5a98.jpgCasey Anthony is a delusional narcissist and pathological liarI wanted to give my thoughts on Casey Anthony's new attempt to rebrand herself as a victim and a legal advocate. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/9d8bdc1d-cc6a-462b-b2d7-6a0f5da45842/3602cf18-8da2-4af3-a046-bff66b6ba06a-master.m3u8https://nicecrew.tv/videos/embed/ksmUSQhRbudDN1QHrTRiBY105001242025-03-08T18:22:59.682ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/9QMvwzTxPfz6pnXWPBtmE6https://nicecrew.tv/lazy-static/thumbnails/44d4b6d5-994a-4a62-a4e5-a53711984417.jpgDelusional woman spends $4k on 4 datesI wanted to share a story with you that I found really interesting about a woman who paid a matchmaker $4k to go on 4 dates. Source: https://www.huffpost.com/entry/matchmaker-dates-finding-love-40s-therapy-self-work_n_67abb760e4b0b904f1e2ad49 Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/4798db30-d945-4a0b-89cf-bc6151b6ad39/8df05b0a-05c9-420f-b3d5-9f6e2753cdd0-master.m3u8https://nicecrew.tv/videos/embed/9QMvwzTxPfz6pnXWPBtmE6189152412025-03-10T20:06:23.158ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/fe2EFZED79ssWomsEL8Uxbhttps://nicecrew.tv/lazy-static/thumbnails/1df0597b-9639-48ca-af46-75c532e47a20.jpgI just dropped some bombshell info on the Whitmer case #documentary #film #documentsI just dropped some bombshell info on the Whitmer case #documentary #film #documentshttps://nicecrew.tv/static/streaming-playlists/hls/7331a33a-9909-41fb-b20b-a7f713283c78/1f520caf-50bf-4911-85ae-0cec1e2143cf-master.m3u8https://nicecrew.tv/videos/embed/fe2EFZED79ssWomsEL8Uxb42032025-03-11T21:55:05.661ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/hDuPTHo6HrqKF9AXLzxaeKhttps://nicecrew.tv/lazy-static/thumbnails/826c7b15-c634-42de-9751-727f9663c2d3.jpgSocial media is making you delusionalA new study published last month links high social media use to increased risk of delusional disorders. The study is called "I tweet, therefore I am." I have included links to all the sources below. Sources: https://neurosciencenews.com/social-media-delusional-disorders-28477/ https://bmcpsychiatry.biomedcentral.com/articles/10.1186/s12888-025-06528-6 https://www.uclahealth.org/news/publication/social-media-reinforces-delusions-its-making-schizophrenia https://pmc.ncbi.nlm.nih.gov/articles/PMC6221086/ https://www.crimrxiv.com/pub/h1lglvcy/release/1 https://thecampanile.org/30898/showcase/social-media-intensifies-delusional-disorder/ https://www.sciencedirect.com/science/article/pii/S2772598724000151 https://www.sciencedaily.com/releases/2012/11/121120122010.htm Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #socialmedia #influencers #delusional #mentalhealth #neurosciencehttps://nicecrew.tv/static/streaming-playlists/hls/86ce80a5-c3e4-4796-81eb-ceba1d058189/f6f06367-9854-4a9d-bebe-c2b7a66c58fe-master.m3u8https://nicecrew.tv/videos/embed/hDuPTHo6HrqKF9AXLzxaeK18190812025-03-12T18:40:36.044ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/i1qFxASgdSmYTpuXcH6a6Ghttps://nicecrew.tv/lazy-static/thumbnails/dace4ae2-bb4d-4d4a-85b4-6056a054b822.jpgTime Laspe: 8-Mouse (read desc)A simple drawing based off of a sketch I made of the full body for her. I hope you all enjoy and stuff. I’m also thinking of making a video about the lore of my Oc’s and the information for theme will be from my Side7 character profiles too, so yeah. Finished drawing: https://side7.com/content/V1r7WeGGrx Creative commons for the music used.https://nicecrew.tv/static/streaming-playlists/hls/89ba9163-7c17-4d93-a39d-1f2eb8266286/c84bb7eb-443d-4c82-9282-8c777dd3c7ba-master.m3u8https://nicecrew.tv/videos/embed/i1qFxASgdSmYTpuXcH6a6G348052025-03-13T17:26:04.947ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/vkKj89gbjPDSmjXZvhNZcahttps://nicecrew.tv/lazy-static/thumbnails/d6140f00-cce5-4683-9905-0c20f6daeae5.jpgChevy Express Van Disc Brake Conversion - Lugnut 4x4 kitStep by step instructions for installing one of these disc brake conversion kits since the instructions are hammered dogshit. THERE ARE ROUTING ISSUES WITH THE CABLES - I KNOW. I am going to fix them once I get my garage door fixed and I feel like dealing with it. https://nicecrew.tv/static/streaming-playlists/hls/ed9ad853-a819-4d56-8a93-98e21731c69b/e0251aff-5a1b-40b5-b78e-bbbf21b04ed1-master.m3u8https://nicecrew.tv/videos/embed/vkKj89gbjPDSmjXZvhNZca40660212025-03-13T19:05:53.900ZYESBrother TylerNOhttps://nicecrew.tv/w/mUvSdcsn3Zip8dKFQLyjB8https://nicecrew.tv/lazy-static/thumbnails/19ce1d24-2c2c-42a2-9b3e-dc81dae42195.jpgSomething very strange is happening...Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/a94bdac8-e9a7-4c66-abd9-afa4ac35d37d/f77c267a-f5c8-49e8-833e-b664085e395d-master.m3u8https://nicecrew.tv/videos/embed/mUvSdcsn3Zip8dKFQLyjB83083522812025-03-13T20:25:18.938ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/b39hF58hfjB3KmD8AyzbGGhttps://nicecrew.tv/lazy-static/thumbnails/17109eb8-3d1c-4bc7-82e3-b46e0053599c.jpgThe Fate of EphraimBoomer generation: faithmixing, racemixing... how are we (and they were) warned about the consequences in the Bible?https://nicecrew.tv/static/streaming-playlists/hls/5147fb42-3196-4519-b456-6fde27ed6f48/7b765f8e-2462-4fcb-8590-668bc2bfadc0-master.m3u8https://nicecrew.tv/videos/embed/b39hF58hfjB3KmD8AyzbGG312051772025-03-15T02:17:12.098ZbiblekjvpreachingYESBrother TylerNOhttps://nicecrew.tv/w/b8iwHxkVR1GMRXBNj7f1mWhttps://nicecrew.tv/lazy-static/thumbnails/ee87e27f-15e0-41e8-97ea-bac35999f7c8.jpgJJR - 284 - The SWATteringDonald Trump is officially rounding up campus protestors and it's putting me in a bit of a spot. Also High-Level, Ukranian, Dork Storm, hit squads after Alex Jones, nationwide SWATtering (of nobodies), Battle of the Baton, and so much more...https://nicecrew.tv/static/streaming-playlists/hls/5200655f-2cbb-4988-b346-20bd9e971a8e/c08b4104-9198-4388-8a64-473f4c2599c8-master.m3u8https://nicecrew.tv/videos/embed/b8iwHxkVR1GMRXBNj7f1mW635454442025-03-17T03:33:41.883ZYESJust Joe Radio NOhttps://nicecrew.tv/w/gnJ7AYH6RKduesXHntp1Anhttps://nicecrew.tv/lazy-static/thumbnails/73bf594c-6c42-49a8-9298-f1ca42b0db51.jpgI have a bad feeling about this...Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/7c81a714-0a54-4b03-a00e-8b3066ca55f1/7727561d-bc08-4ba9-81a8-b831a81588eb-master.m3u8https://nicecrew.tv/videos/embed/gnJ7AYH6RKduesXHntp1An176151952025-03-17T19:14:30.087ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/woQWBtrc9T9BQBXAJXEXvZhttps://nicecrew.tv/lazy-static/thumbnails/b2634cb9-3f02-4af6-ba3c-ebac054834d9.jpgVR Headsets being strapped on inmates in Solitary Confinement #vr #vrheadset #californiaVR Headsets being strapped on inmates in Solitary Confinement #vr #vrheadset #californiahttps://nicecrew.tv/static/streaming-playlists/hls/f622af1e-87dd-461a-8646-e3e532beab27/f2a952ec-4759-4dd9-9283-19f5b317a774-master.m3u8https://nicecrew.tv/videos/embed/woQWBtrc9T9BQBXAJXEXvZ3001572025-03-17T19:30:09.723ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/4Epp3aXTgYsAKEr5R8bJcfhttps://nicecrew.tv/lazy-static/thumbnails/a2676a67-bc0e-428f-9649-de2b3f557784.jpgAre we already at war?Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/1da81928-8f08-4ce9-9ba5-9e8187fa8a94/a67bb6b2-9387-4ddf-b2eb-7c466c72821c-master.m3u8https://nicecrew.tv/videos/embed/4Epp3aXTgYsAKEr5R8bJcf295151132025-03-18T21:29:23.848ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/61pTppWhZGwHTQh9RrRtxGhttps://nicecrew.tv/lazy-static/thumbnails/5ba48eaf-f854-4edd-a178-d6d137a33110.jpgA day in the life of Bobo ✨A day in the life of Bobo ✨https://nicecrew.tv/static/streaming-playlists/hls/288c69ea-a9f0-4b27-bab9-7a0269b2e1d2/9fba979b-06a6-465b-ab89-0630998b95b4-master.m3u8https://nicecrew.tv/videos/embed/61pTppWhZGwHTQh9RrRtxG15072025-03-18T22:38:05.080ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/4SvxLAdNhjxQNMAwSHNyadhttps://nicecrew.tv/lazy-static/thumbnails/263cf360-f2eb-4b33-b09f-ca302922307e.jpgThe Dark Truth Behind Google's BIGGEST AcquisitionGoogle has announced its biggest acquisition to date: the purchase of Israeli cyber security company Wiz for $32 billion. This is an ALL-CASH deal. The Wiz acquisition is the most significant transfer of Israeli intelligence operatives into Big Tech in history. At the same time, Google quietly dropped its pledge not to use AI for weapons or surveillance. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/1f58d05d-1608-4ef8-8761-a88137075c16/5b447fdf-2e6b-4211-8b0a-944945f923e6-master.m3u8https://nicecrew.tv/videos/embed/4SvxLAdNhjxQNMAwSHNyad245651372025-03-21T17:40:09.838ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/wyGUQWwgoAAFVJVv5CjtjVhttps://nicecrew.tv/lazy-static/thumbnails/46502882-2426-4a56-88fe-b463d5f4fbd4.jpgHoward Lutnick is a MonsterU.S. Commerce Secretary and Cantor Fitzgerald CEO Howard Lutnick is a very sus individual, with shady connections and a dark past. Let's discuss. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/f7832c3c-ac2d-4fed-986f-a8bef8e56465/bb7b7998-b047-4860-8c7b-48b7f817781a-master.m3u8https://nicecrew.tv/videos/embed/wyGUQWwgoAAFVJVv5CjtjV208551832025-03-22T17:29:36.981ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/fbzUAgoZki8LHrg8HyxZJZhttps://nicecrew.tv/lazy-static/thumbnails/40ce1d16-15d7-4969-b366-53388a5d6aed.jpgNetanyahu: “Elon Musk is the Defacto President of the United States”Erol Musk, Elon Musk's father claimed in a podcast interview that Netanyahu said Elon was the "defacto" president of the United States. What do you all make of this? Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/72da4653-5a58-4cf8-9b90-f573e9563e79/048353f0-604b-438d-bac0-59d431625648-master.m3u8https://nicecrew.tv/videos/embed/fbzUAgoZki8LHrg8HyxZJZ3125332025-03-24T15:56:33.291ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/qhBSySW415RX4aBeXqjiEfhttps://nicecrew.tv/lazy-static/thumbnails/ad43b8ed-1b2c-466f-a78e-3bd1ec74b97a.jpgHow are people surviving right now?Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/c4ad55c0-78e0-4dab-90f9-dcedd572797e/1d6f7b62-b444-4c85-9111-cfa1bf8154ab-master.m3u8https://nicecrew.tv/videos/embed/qhBSySW415RX4aBeXqjiEf201603492025-03-26T18:16:37.938ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/gU8MmvyVWNq5yaSSxC43rrhttps://nicecrew.tv/lazy-static/thumbnails/575aba11-abe4-4bf6-baec-2a910512df8f.jpgThis man has no business being anywhere near the White House!An unhinged rant about Jared Kushner Link to article: https://en.globes.co.il/en/article-jared-kushner-builds-a-middle-east-business-empire-1001503692 Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/80c08d3e-fd8d-46d4-9925-51745f3bc1a3/b299237f-72e2-4bf1-89e9-45f676dc3882-master.m3u8https://nicecrew.tv/videos/embed/gU8MmvyVWNq5yaSSxC43rr1418520932025-03-26T21:22:52.947ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/8AHMF7dMGry4FuUEwTPAVqhttps://nicecrew.tv/lazy-static/thumbnails/34777f3d-2f41-4a46-84db-1accf49a5837.jpgHe tried warning everyone before he disappearedJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/3d8902e1-8a2d-440f-a9f3-30f099edb8aa/4b582657-5ee1-4dc3-94bc-8bc6275d3e53-master.m3u8https://nicecrew.tv/videos/embed/8AHMF7dMGry4FuUEwTPAVq1595511172025-03-28T20:58:13.950ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/oiqB59EWehRMRFwfdj9RCChttps://nicecrew.tv/lazy-static/thumbnails/2426856f-ad78-440c-89dc-db419b4f794f.jpgCorporate profits SURGE as Americans are drowning in DEBTBankers are giving themselves record high bonuses, as the average American is drowning in debt. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/b497db97-b5ce-41c1-8c64-0e7daeb21b90/af884501-2935-4186-9e91-1146a6fbf85c-master.m3u8https://nicecrew.tv/videos/embed/oiqB59EWehRMRFwfdj9RCC322951632025-03-29T17:59:55.495ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/8WPvjXfBwC3fSJbLUQsMbKhttps://nicecrew.tv/lazy-static/thumbnails/5f14413c-cc0c-49fa-89a7-97dda5b46a8a.jpgJJR - 285 - Pick Your BattlesNo more fence sitting. I've made my decision regarding my view on college protesters being "disappeared". Also the evil cruelty of Ghibli memes, two-tier justice in the U.K., accelerated replacement in Ireland, tables turn on Tate and hilarious comment sections set to music by AIhttps://nicecrew.tv/static/streaming-playlists/hls/4057691c-3b96-462a-9f04-3e73c4279353/60391480-3cd2-4113-9237-ab1780cf6955-master.m3u8https://nicecrew.tv/videos/embed/8WPvjXfBwC3fSJbLUQsMbK702154992025-03-30T03:43:59.399ZYESJust Joe Radio NOhttps://nicecrew.tv/w/bGeAiJx3Uvi2R53FmjEDTihttps://nicecrew.tv/lazy-static/thumbnails/5ba6686f-6411-4ee2-aff8-17075eef3487.jpgKash Patel: "Give your local FBI agent a HUG."Kash Patel wants you to thank your local cops and hug your local feds. I think the FBI is a corrupt organization founded on a relationship with organized crime syndicates, who engage in misconduct and violate our rights daily. I will not be hugging them.   Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/56998371-3377-46c0-b78d-0cf2da2f1223/2424b41e-62d1-496b-8203-5c2f1f9a8590-master.m3u8https://nicecrew.tv/videos/embed/bGeAiJx3Uvi2R53FmjEDTi10230402025-03-30T20:13:58.362ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/jE7TACnMGum4n1vTT9fqHVhttps://nicecrew.tv/lazy-static/thumbnails/f1b4f9dc-0bbc-4b23-b896-0c83afa33ceb.jpgAlcohol in the BibleScripture supporting common sense. Don't get drunk, retard.https://nicecrew.tv/static/streaming-playlists/hls/97170148-4502-4032-ad98-39b338b987af/f45da9c4-6bcf-467a-a288-c86d1d13866d-master.m3u8https://nicecrew.tv/videos/embed/jE7TACnMGum4n1vTT9fqHV182451122025-04-01T01:10:05.514ZYESBrother TylerNOhttps://nicecrew.tv/w/biWLPJLhTdDKQ9AXdT2dDKhttps://nicecrew.tv/lazy-static/thumbnails/d4abdfc6-2688-498b-a0f3-a3eb0861ad0b.jpgThe care bear mafia is out of control!Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/537cc91f-52c0-452e-959f-0f4a18dc56d5/8f48c2e3-7ab6-456f-8e27-840a7b24fd2d-master.m3u8https://nicecrew.tv/videos/embed/biWLPJLhTdDKQ9AXdT2dDK273452732025-04-01T16:21:18.029ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/dxjiYAy3GLw8HVAWrgCkrNhttps://nicecrew.tv/lazy-static/thumbnails/f45384cc-de3b-4d02-a9bf-74282f31f4c1.jpgSo disappointed. There is NO justice in America.Support the documentary: https://www.kandkfilm.com/ Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/658d0132-f0cb-4f4b-a76d-0ed0acce8f34/51a5cf5f-1b12-4ced-b70e-149b93cdfa14-master.m3u8https://nicecrew.tv/videos/embed/dxjiYAy3GLw8HVAWrgCkrN14625862025-04-02T18:16:52.891ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/qxL7RkdLbzuNyTbnwbztk7https://nicecrew.tv/lazy-static/thumbnails/4a8cca63-5bd7-49b8-87b4-504691a69b3b.jpgSong Preview 8 (Read Description)Another song that I want to recreate from my mind, sometimes I hear original songs playing in my head, and I want o recreate this one, and I’ll probably theme it around how anti-anxiety meditation does to my emotions. That’s all really, pease enjoy.https://nicecrew.tv/static/streaming-playlists/hls/c6ca92ce-74bb-4acf-9213-f7c4e7def8e8/05af8404-e93e-497d-adc1-bc3e0fc7f604-master.m3u8https://nicecrew.tv/videos/embed/qxL7RkdLbzuNyTbnwbztk763022025-04-05T15:05:50.038ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/pY8agUvkJ9gJfSPMT7nzrWhttps://nicecrew.tv/lazy-static/thumbnails/413b718e-6977-4302-8526-6fa913fb1c00.jpgA look at #HandsOff "Whidbey Island" 2025Bunch of programmable retarded boomers being hearded around like niggercattle https://nicecrew.tv/static/streaming-playlists/hls/c21840b3-e8d1-4b88-a45c-3f9639045ecc/731b4f2f-07eb-48a4-afa1-b98150cd9384-master.m3u8https://nicecrew.tv/videos/embed/pY8agUvkJ9gJfSPMT7nzrW895192025-04-06T18:55:03.452ZYESBrother TylerNOhttps://nicecrew.tv/w/q2fi86ox4M8ysrKdwrXE4uhttps://nicecrew.tv/lazy-static/thumbnails/a1f9165c-abb3-488a-ba15-2b8f70affff2.jpgKash Promotes J6 Hunter & Enforcer to lead DC Field OfficeKash Patel has handpicked Steve Jensen, known for tracking down grandmothers who inadvertently entered the Capitol during a four-hour disturbance and for creating a database of mothers who spoke out at school board meetings, to head up the prestigious Washington, D.C., Field Office. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/c287e19f-f6bb-483e-a526-de036984758a/92b72b86-dd60-4baf-ad9a-817ccaee1e64-master.m3u8https://nicecrew.tv/videos/embed/q2fi86ox4M8ysrKdwrXE4u168052042025-04-06T19:32:34.359ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/qvfCMPhG7Y6QYRXQExjCdZhttps://nicecrew.tv/lazy-static/thumbnails/a552e9fc-3147-4061-9870-67d418c2cfc4.jpgJJR - 286 - We Have A ProblemWe have a problem. Our society is unraveling. Nearly all public spaces are off limits. Personal liberty is lost. We all exist inside a demented, delusional, fairytale of our own construct. Because we're simply too afraid to state the obvious and correct the issue, for fear of being thought a Big Meanie. Moving forward, there are exactly two avenues of possibility. Society, as we know it, is going to acknowledge (as a whole) this very glaring issue and take corrective measures. Or society, as we know it, will cease to exist. We either fix this, or it will be our end.https://nicecrew.tv/static/streaming-playlists/hls/c670ea77-500b-4986-b940-95697de07401/153b9273-e119-41c4-8ef5-0526c961e34b-master.m3u8https://nicecrew.tv/videos/embed/qvfCMPhG7Y6QYRXQExjCdZ944255232025-04-07T18:34:50.939ZYESJust Joe Radio NOhttps://nicecrew.tv/w/n3G7AQjAFbm5evocxU14ovhttps://nicecrew.tv/lazy-static/thumbnails/a8ab89e6-7cfc-4301-9417-5d242f9488ae.jpgThis can no longer be tolerated.Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/aa701ed3-230b-4667-90f8-eb653980bce5/36d8bbf4-1c3a-454a-8ec1-b6309af7e4e3-master.m3u8https://nicecrew.tv/videos/embed/n3G7AQjAFbm5evocxU14ov353651992025-04-07T17:12:47.799ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/mbZXRJCcbQeo3NrCwVc4ibhttps://nicecrew.tv/lazy-static/thumbnails/e6e6d6d2-99af-42e6-b6fb-973d7954b2f2.jpgPatriot Front - Austin MetcalfThomas Rousseau remarks on racial realism in the wake of the murder of Austin Metcalf. https://nicecrew.tv/static/streaming-playlists/hls/a37fee91-51aa-42d9-a9c9-647e7c401198/fde4b9e8-c862-408f-ae21-215eb854ab45-master.m3u8https://nicecrew.tv/videos/embed/mbZXRJCcbQeo3NrCwVc4ib1975232025-04-08T10:34:50.297ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/ckvP28KeRn8QNjtifaNAzLhttps://nicecrew.tv/lazy-static/thumbnails/0a12e281-c8aa-4c26-a488-620ac96d0677.jpgThey no longer hide it...Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/5bce0743-9a3d-47b0-9fb1-53cbe47c09ae/0dc1e31d-b79e-47c5-82f8-a19d8751dc45-master.m3u8https://nicecrew.tv/videos/embed/ckvP28KeRn8QNjtifaNAzL264952332025-04-08T21:56:54.547ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/diq2RkkwHCkxqnUtENJXBShttps://nicecrew.tv/lazy-static/thumbnails/8e09f1f5-d5b8-4cb9-aa9f-3d1938954191.jpgThe absolute state of "influencers" in 2025Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/639c1e42-40ee-48d6-a6b2-3ac2d0a5f7cc/e470814d-fb00-4aa1-a06f-4483176253c3-master.m3u8https://nicecrew.tv/videos/embed/diq2RkkwHCkxqnUtENJXBS179202202025-04-09T02:15:19.939ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/2Z521wPtjkEjUc7k8xFimLhttps://nicecrew.tv/lazy-static/thumbnails/1e8dc574-58b3-411d-aef7-993f8191dcd1.jpgThe spiritual delusion of Jordan PetersonJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/10110265-6f82-465f-8107-9fe561241d40/b93323d7-2572-409d-be4a-3e95ace56aa2-master.m3u8https://nicecrew.tv/videos/embed/2Z521wPtjkEjUc7k8xFimL145202022025-04-09T22:36:40.562ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/tJ9cP4rPAqgwiLLj2wXirAhttps://nicecrew.tv/lazy-static/thumbnails/588a9293-b408-4e93-b8e8-46daab341069.jpgMike Lynch: New Details on the Sinking of the Bayesian & Echos of Robert MaxwellThere is a lot more than meets the eye in the tragic deaths of Stephen Chamberlain and Mike Lynch. Finally, people are asking questions and making connections. From Cambridge Neurodynamics to Autonomy to Darktrace - Mike Lynch was a very busy man, with numerous dark and shadowy connections. He was surrounded by spooks, and there are too many odd coincidences that aren't adding up. Who benefitted from the untimely passing of Mike and his co-worker Chamberlain? What happened to his encrypted hard drives? Sources: https://archive.is/rxVVc https://archive.is/izZK3 https://www.dailymail.co.uk/news/article-14523487/Family-billionaire-Mike-Lynch-US-fraud-trial-police-car-running-tech-tycoon-drowned-yacht.html https://newlinesmag.com/reportage/the-mysterious-sinking-of-the-bayesian/ Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/e08909af-901c-460c-b94a-b6f809b675c8/f765dec9-5d1d-4649-a4df-bc15b29c3c9e-master.m3u8https://nicecrew.tv/videos/embed/tJ9cP4rPAqgwiLLj2wXirA210051362025-04-11T21:03:37.727ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/9h4hgpHMWFAnPZyJn71PCJhttps://nicecrew.tv/lazy-static/thumbnails/c94b334c-b685-41ba-aac6-d3fa98980d7a.jpgBreaking Down The Houses Of The SodomitesBreaking Down The Houses Of The Sodomiteshttps://nicecrew.tv/static/streaming-playlists/hls/430707ff-a3d3-44a5-8f07-152c96356fee/9c7f9523-9d79-4c7d-b3f4-8bc157a5b5eb-master.m3u8https://nicecrew.tv/videos/embed/9h4hgpHMWFAnPZyJn71PCJ25015752025-04-14T18:56:13.100ZYESBrother TylerNOhttps://nicecrew.tv/w/iq3vPF1yGmnjbMSf4MphkDhttps://nicecrew.tv/lazy-static/thumbnails/cfbaed18-a63f-4ba4-a8a7-02cb8ea96367.jpgTHREE THOUSAND DOLLARS!!THREE THOUSAND DOLLARS!!https://nicecrew.tv/static/streaming-playlists/hls/8d06c1d2-2821-482c-af30-6d17fc56e27b/9d27f389-5038-4f96-bc18-8c4941fbfb97-master.m3u8https://nicecrew.tv/videos/embed/iq3vPF1yGmnjbMSf4MphkD49042025-04-14T21:42:31.272ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/iF4RaJyM6pQDpssRdSL6SShttps://nicecrew.tv/lazy-static/thumbnails/910e60a6-8bf8-4710-a5a3-5227563a4b47.jpgAll Your Base Are Belong To UsThe classic video from early 2000s. Previously from a '90s video game.. https://nicecrew.tv/static/streaming-playlists/hls/8f1fbc49-37a2-4c3a-aa54-c805988793fa/466b1451-a071-49fa-8ed0-f1619a6c885b-master.m3u8https://nicecrew.tv/videos/embed/iF4RaJyM6pQDpssRdSL6SS2610142025-04-14T22:48:20.823Zmainscreenturn onYESMain ChannelNOhttps://nicecrew.tv/w/tkeC8jac8bzbPAykTagk1Ghttps://nicecrew.tv/lazy-static/thumbnails/ca1158c9-44b1-4601-b389-70d8ba84f060.jpgForeign lobby caught boasting about how they control AmericaJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/dd564555-9e3e-473a-a89e-b4d2074f255c/82404bd7-ed48-4d35-9f45-adb32dac510f-master.m3u8https://nicecrew.tv/videos/embed/tkeC8jac8bzbPAykTagk1G110454312025-04-15T18:51:13.189ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/2BjukSzKtvbxwoqvF53e97https://nicecrew.tv/lazy-static/thumbnails/30856cd6-54fb-4531-8e24-0b17f931d16f.jpgBlue Origin spectacle: Just a group of girlbosses in space, having a BaalThe Blue Origin PR stunt was absurd, but the symbolism is worth noting. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/0d07908d-3dfd-4147-a103-614094714fda/a2136735-6bea-476c-b92c-789f08399cbb-master.m3u8https://nicecrew.tv/videos/embed/2BjukSzKtvbxwoqvF53e9764451402025-04-15T19:17:47.440ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/x23yzvLNsY5c85Hfti2hwchttps://nicecrew.tv/lazy-static/thumbnails/d516e0c4-a43f-4e1f-9346-08b13599b4b8.jpgHe just SQUEAKEDHe just SQUEAKEDhttps://nicecrew.tv/static/streaming-playlists/hls/fb309ef4-f1b2-4239-b955-c49990a0252f/a1ab9456-aaa0-4178-9703-7ba1c749f749-master.m3u8https://nicecrew.tv/videos/embed/x23yzvLNsY5c85Hfti2hwc17532025-04-15T19:56:07.611ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/6movjA64K5ybohPuE4vxVUhttps://nicecrew.tv/lazy-static/thumbnails/8a6109c4-21f3-48b0-88cc-a23bc4ba4b2b.jpgRick @ Nite 4/11/25 Stream - Is Sam Hyde Still Relevant?I go over a video from Sam Hyde's MDE Podcast and discuss the various points he brings up along with rambling incoherently while smoking a joint.https://nicecrew.tv/static/streaming-playlists/hls/2b56702f-5ec7-47ba-a9fd-ce718240c78a/df5f7cfd-ddd2-4448-9218-59391eb6b2fc-master.m3u8https://nicecrew.tv/videos/embed/6movjA64K5ybohPuE4vxVU65690492025-04-17T00:16:18.463ZYESRick @ NiteNOhttps://nicecrew.tv/w/nPTfzjBdp3psLkKxyjoazkhttps://nicecrew.tv/lazy-static/thumbnails/1a462af2-5055-4788-b4c0-8bf46d8ec8a2.jpgMoonman on EgirlsMoonman discusses the various pitfalls of simping for egirlshttps://nicecrew.tv/static/streaming-playlists/hls/b0bf742a-aa4a-4844-bc9a-03861f744ca1/c0268325-70b0-49ce-a9cc-5a976d4078d3-master.m3u8https://nicecrew.tv/videos/embed/nPTfzjBdp3psLkKxyjoazk137002025-04-17T00:24:04.068ZYESRick @ NiteNOhttps://nicecrew.tv/w/6XCDvkKrKBNjLKoxE6eP2jhttps://nicecrew.tv/lazy-static/thumbnails/be3034bf-f4ed-4272-aae1-aae002febd99.jpgFuentes Diss TrackI made this about a year ago but I still think it slapshttps://nicecrew.tv/static/streaming-playlists/hls/30422f59-07cd-4b97-b1c8-08c7f32648c0/0f4be34e-4a62-4ead-805d-31394599e6f4-master.m3u8https://nicecrew.tv/videos/embed/6XCDvkKrKBNjLKoxE6eP2j102062025-04-17T00:37:59.385ZYESRick @ NiteNOhttps://nicecrew.tv/w/eoKBuE57uRnP8TkTCpTB4ohttps://nicecrew.tv/lazy-static/thumbnails/365b323f-9b28-4dbe-a403-f08577746994.jpgNikita Casap - Domestic GladioNikita Casap - Domestic Gladiohttps://nicecrew.tv/static/streaming-playlists/hls/6c740ad7-6866-4d4f-b6ab-ad339c7adcd8/dca4d268-b589-4c4b-9344-e225d4cd13f7-master.m3u8https://nicecrew.tv/videos/embed/eoKBuE57uRnP8TkTCpTB4o55052025-04-17T18:41:12.619ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/2HtfeNGpwdEjAdDrarbPhKhttps://nicecrew.tv/lazy-static/thumbnails/17701b85-ed0a-40c3-882a-ea7051d02480.jpgThis will be worse than 2008What is coming is going to be worse than 2008. Two days ago, the Budget Group reported that the federal debt is not $37 trillion, but 158.6 trillion! This is not sustainable, ladies and gentlemen. The American people are being destroyed, the dollar is being decimated, and the AI technocratic surveillance state is being built all around us. Sources: https://archive.is/LJJso https://www.costar.com/article/1925359767/us-banks-prepare-for-unpaid-loans-other-financial-fallout-from-economic-turmoil https://archive.is/uYwZB https://archive.is/d77C7 https://x.com/infraa_/status/1909216938510917974 https://archive.is/6ubXO https://www.cnbc.com/amp/2025/04/14/unemployment-fears-hit-worst-levels-since-covid-fed-survey-shows.html https://x.com/WallStreetApes/status/1911455356301062237 https://theleesvilleleader.com/2025/04/15/budget-group-says-the-actual-federal-debt-is-158-6-trillion/ https://archive.is/j3qIT https://finance.yahoo.com/news/theres-another-us-debt-downgrade-warning-203755354.html https://www.kxan.com/news/national-news/household-debt-crisis-looms-as-consumers-struggle-with-unmanageable-debt-report-says/ https://www.forbes.com/sites/jackkelly/2025/04/16/the-buy-now-pay-later-boom-at-coachella-signs-of-stretched-wallets/ https://www.pcmag.com/news/thanks-to-ai-data-centers-will-drive-half-of-electricity-demand-growth https://www.pymnts.com/artificial-intelligence-2/2025/openai-developing-ai-agent-to-replace-software-engineers-cfo-says/ https://www.inc.com/bruce-crumley/amazons-reduction-of-managerial-ranks-increases-white-collar-worries/91175840 https://mises.org/mises-wire/cantillon-effects-why-inflation-helps-some-and-hurts-others Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https:...https://nicecrew.tv/static/streaming-playlists/hls/0de36c81-cb93-44b2-81b8-b38359cad4e7/8696fc13-34b4-40bc-afe0-4907c326f78b-master.m3u8https://nicecrew.tv/videos/embed/2HtfeNGpwdEjAdDrarbPhK253353492025-04-17T19:48:47.907ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/xwsjN8gdeUiFiu88Rrahufhttps://nicecrew.tv/lazy-static/thumbnails/5b48c435-bfdd-4a45-b98d-3ea6b94a299b.jpgGet yourself some Creamline Milk!!Get yourself some Creamline Milk!!https://nicecrew.tv/static/streaming-playlists/hls/ff4bd597-06b8-412b-8e68-ddb8a7d6bd7e/f2ea22be-3793-4cdd-ac1e-364cd3951309-master.m3u8https://nicecrew.tv/videos/embed/xwsjN8gdeUiFiu88Rrahuf30032025-04-18T15:16:02.521ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/8tX12KpoAWiGSpAQBArsY5https://nicecrew.tv/lazy-static/thumbnails/651e2751-f7bf-477f-a669-d7e1f75133bf.jpgThe Apostasy is Upon Us: Paula White ExposedWhite House Faith Advisor Paula White recently met with Israeli PM Benjamin Netanyahu to spew her heresies while signaling support for the wanted war criminal. This false prophet prosperity preacher is leading souls astray so she can profit financially. But God is not mocked. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/3c96f29b-73d9-4697-9b2f-c84167a12544/5b772d6a-d2ba-4bae-a14f-d9351d765828-master.m3u8https://nicecrew.tv/videos/embed/8tX12KpoAWiGSpAQBArsY5322106302025-04-18T21:28:26.443ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/uZw2amaUsjtmvMjxNZRTSbhttps://nicecrew.tv/lazy-static/thumbnails/56c506d6-1bca-4454-9a68-a821073a1a50.jpgJJR - 287 - Two Colored Fellas and a Jew Walk Into a ProtestCovering all this week's developments in the Austin Metcalf murder, from bond reduction for the murderer, the Anthony family's new "minister" spokesfella, and an impromptu pro-White protest....hosted by a crucifix wearing jew and an obvious Federal Agent/Handler of Colors....not even kidding. DISCLAIMER: In 100% honesty, I will let you know, delivery is shaky on this one. because I ingested a bit too much caffeine before the show. But I dedicated the show to our friend Lord Aragorn. So I ultimately MUST post the replay. Just keep in mind, you were warned.https://nicecrew.tv/static/streaming-playlists/hls/eac7c722-1faf-4fa5-a2ad-83f59fc65c42/9b8fe44d-3fdc-404d-bd4f-a4411efb4f83-master.m3u8https://nicecrew.tv/videos/embed/uZw2amaUsjtmvMjxNZRTSb787556112025-04-20T18:56:37.381ZYESJust Joe Radio NOhttps://nicecrew.tv/w/4LV5n9XFE9JrFZWMY1tkJvhttps://nicecrew.tv/lazy-static/thumbnails/dee9d4de-e3f2-4f32-9f82-6fd0a7b70eb5.jpgReflection on the Death of Francis, and Others Like Him"mmm yay sodomy and atheism and mass migration yaaaaaay"https://nicecrew.tv/static/streaming-playlists/hls/1e90d9c4-0749-473d-9d36-527ad35353c5/1c8a3915-2487-4766-bb2c-55fe2a93165b-master.m3u8https://nicecrew.tv/videos/embed/4LV5n9XFE9JrFZWMY1tkJv181451792025-04-22T01:20:43.668ZYESBrother TylerNOhttps://nicecrew.tv/w/ou3S6esDVtrzKtvdoxpqF9https://nicecrew.tv/lazy-static/thumbnails/66137771-5ebf-41ec-bc82-ae42bf4a2520.jpgThe takeover is almost completeJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/b613a40e-ce51-4b8e-ba88-06094f78ff06/bed430e1-7473-4e0a-826d-dceceabcf709-master.m3u8https://nicecrew.tv/videos/embed/ou3S6esDVtrzKtvdoxpqF9248802672025-04-23T20:53:59.044ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/9d3DiitfGEdNSVztBunzuxhttps://nicecrew.tv/lazy-static/thumbnails/c3664447-327b-4c2f-a5d8-2f0be59811a6.jpgStrange Scented FlowersA song I recently uploaded onto my Telegram channel. I hope you all enjoy! Instruments used: Suspended Animation Analog Mellow Lead SoCal drumshttps://nicecrew.tv/static/streaming-playlists/hls/4277a9d2-c27a-43cf-b931-65e7081f6443/948b0eda-017a-4fe4-bdd6-16ff00130a60-master.m3u8https://nicecrew.tv/videos/embed/9d3DiitfGEdNSVztBunzux337022025-04-24T02:51:03.437ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/rMhBySkvLhuRoc9t9iKN1ihttps://nicecrew.tv/lazy-static/thumbnails/60e51c8e-b41f-48ef-9fac-b2456634741e.jpgwealth inequality is so bad in this countrywealth inequality is so bad in this countryhttps://nicecrew.tv/static/streaming-playlists/hls/d0c72ca6-1aa8-4a08-8df9-ec3acc7c5411/43712f27-a170-447e-8d5b-864c20d0e481-master.m3u8https://nicecrew.tv/videos/embed/rMhBySkvLhuRoc9t9iKN1i29592025-04-25T18:21:47.206ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/md9tr3ghzvz1Avi6PsY7dLhttps://nicecrew.tv/lazy-static/thumbnails/a75cb9d0-da98-4b91-970a-140731ed8ee7.jpgBankruptcies surge as wealthy Americans move money overseasJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/a3a8eb8a-d5b7-4d60-a176-6c641812113c/51e06a09-96b2-4aff-a907-6a62fad27677-master.m3u8https://nicecrew.tv/videos/embed/md9tr3ghzvz1Avi6PsY7dL299152322025-04-25T20:05:34.252ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/twXmF8sYryR9mjjnh9wuQthttps://nicecrew.tv/lazy-static/thumbnails/4dd441c5-6e3b-490a-862a-d6cb1f41cfab.jpgWhat happened to Virginia Roberts Giuffre? #virginiagiuffre #epstein #whathappendWhat happened to Virginia Roberts Giuffre? #virginiagiuffre #epstein #whathappendhttps://nicecrew.tv/static/streaming-playlists/hls/def92bea-afef-4064-ae5f-2d9d5773f05b/23eb37f1-931a-475a-91ec-e395b2d19dc4-master.m3u8https://nicecrew.tv/videos/embed/twXmF8sYryR9mjjnh9wuQt60082025-04-27T22:01:08.491ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/cC8zsNDCzxrkf8vii4EKMqhttps://nicecrew.tv/lazy-static/thumbnails/e5368952-46aa-4f3c-82be-9e8e486f1ee3.jpgWhen you're about to get false-flagged into warJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/5e1ff86e-2b5f-411a-965f-7ab800d509d6/4fc49dda-f03a-42ea-a337-cffbc9427060-master.m3u8https://nicecrew.tv/videos/embed/cC8zsNDCzxrkf8vii4EKMq47504522025-04-27T22:12:08.965ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/uisnUKLEixJESKiP6CS4kdhttps://nicecrew.tv/lazy-static/thumbnails/01a388f8-8407-418f-946c-fcaf893ccd7c.jpgWill Stancil existsWill Stancil existshttps://nicecrew.tv/static/streaming-playlists/hls/e52fc84d-c037-48f1-b77c-58b0fd029936/86ba3544-a0e1-4c63-a2f0-a1a99961d5d6-master.m3u8https://nicecrew.tv/videos/embed/uisnUKLEixJESKiP6CS4kd26052025-04-27T22:36:07.531ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/vbVUBbBM6qQF2UEA7aqKWUhttps://nicecrew.tv/lazy-static/thumbnails/ad51d130-49cd-4911-b341-048efcf5b26e.jpg"Submissive Schoolgirl" Meta's A.I. Chatbots are seriously delinquent and are targeting kidsMeta AI's Chatbots on Facebook, Instagram, and WhatsApp are engaging in "romantic roleplay" that very easily becomes sexual and explicit. These AI "companions" will pretend to be sexualized kids but also appear to be trying to groom kids into thinking explicit interactions with adults are okay. Unique among its top peers, Meta has allowed these synthetic personas to offer a full range of social interaction, including “romantic role-play”—as they banter over text, share selfies, and even engage in live voice conversations with users. The test conversations found that both Meta’s official AI helper, called Meta AI, and a vast array of user-created chatbots will engage in and sometimes escalate discussions that are decidedly sexual, even when the users are underage or the bots are programmed to simulate the personas of minors. Source: https://www.wsj.com/tech/ai/meta-ai-chatbots-sex-a25311bf?st=EFCyrz&reflink=mobilewebshare_permalink Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/ec5fae22-95e6-4c1a-b816-b6e6d3f27a0c/545e58ec-3dab-437d-ac69-454f7e45f79b-master.m3u8https://nicecrew.tv/videos/embed/vbVUBbBM6qQF2UEA7aqKWU192502332025-04-27T23:29:49.407ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/awdMfcBRmiQFCJojJhVM6khttps://nicecrew.tv/lazy-static/thumbnails/6107fd5e-0ef5-46ae-a99f-19fd74fc6453.jpgGrok has gotten out of hand 😭🤣Grok has gotten out of hand 😭🤣https://nicecrew.tv/static/streaming-playlists/hls/4d1a6fe2-409c-4b86-a4f2-da5394596d91/0ab7f24c-8236-45af-ae17-acfd61e9d15f-master.m3u8https://nicecrew.tv/videos/embed/awdMfcBRmiQFCJojJhVM6k11082025-04-27T23:57:45.967ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/oKaZ3zG9fCHG5ShTSDYPf6https://nicecrew.tv/lazy-static/thumbnails/7aad8e73-edb1-4562-bf64-edf0aa80dcc2.jpg"We are masters of the universe" they say as they cry for more censorshipJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/b8302f69-03de-4879-a508-fe89281b4add/45a12e63-ae34-4626-ba82-0f68b99341be-master.m3u8https://nicecrew.tv/videos/embed/oKaZ3zG9fCHG5ShTSDYPf6117651412025-04-28T19:20:57.297ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/iENjhuGjgVs2VLfjxT6vYZhttps://nicecrew.tv/lazy-static/thumbnails/adbd5b5d-8d18-4e6c-91f8-0e5660b1ed25.jpgHF Band Listening with GQRX - 4/29/2025, 7:14:30 AMListening to hams and short wave stationshttps://nicecrew.tv/static/streaming-playlists/hls/8f1629cb-c692-470f-8ecd-db3ec8503ad5/f323aa2f-3196-4740-b607-0e3971498186-master.m3u8https://nicecrew.tv/videos/embed/iENjhuGjgVs2VLfjxT6vYZ3695072025-05-02T05:09:24.472ZYESBrother TylerNOhttps://nicecrew.tv/w/qzskDsnFSxugUT3mTsJDtEhttps://nicecrew.tv/lazy-static/thumbnails/35a34049-3b5c-40c3-9e61-d84156cad601.jpgJack Parsons: Magician of the Nuclear Age │Part OneJack Parsons: Rocket scientist, alchemist, occultist, and Godfather of the space program – critical in founding the Jet Propulsion Laboratory, advancing the early rocketry that laid the groundwork for NASA’s space program – has been all but erased from his proper place in official history. The truth is always much stranger than fiction. Parsons was a visionary, brilliant, but also a bit of a sperg. He was an ardent follower of Aleister Crowley’s “Thelema,” blending magic with science. He was a magician of the nuclear age. Parson's influence is still felt today, from space and missile technology to the esoteric and new age and UFO movements. Parsons really was the one who popularized Thelema in America, inspiring modern occultists, neo-pagans, wiccans, and chaos magicians. His fusion of science and mysticism and use of psychedelics prefigured the psychedelic and esoteric revival of the 1960s, and a line can be drawn to the modern technocrats today who are going on ayahuasca retreats and taking DMT and talking to the techno elves. In order to really make sense of the world today, it is important to understand the past—our true history, not the sanitized version presented by official history. This story gets very strange, is definitely not child-friendly, and is certainly a cautionary tale. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/c7071aa3-dbbc-4f49-9362-fc0fe9bad288/184ebc8e-2a03-4b9b-8e8d-fe6779c52b49-master.m3u8https://nicecrew.tv/videos/embed/qzskDsnFSxugUT3mTsJDtE385903322025-04-30T01:40:08.518ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/gZjBNMFd9GH9hXVb4B8gBohttps://nicecrew.tv/lazy-static/thumbnails/a9031be4-e243-4f8d-a12e-0158f555c25d.jpgSatisfactory - 4/30/2025, 5:23:54 AMSatisfactory - 4/30/2025, 5:23:54 AMhttps://nicecrew.tv/static/streaming-playlists/hls/8179f2b9-87d7-4e9b-a058-a10191cf7848/9dae2102-7fe2-4dc1-a399-6a50198b5861-master.m3u8https://nicecrew.tv/videos/embed/gZjBNMFd9GH9hXVb4B8gBo2279042025-05-02T05:08:42.646ZYESSister MadsNOhttps://nicecrew.tv/w/7Nwuadd4Cbco9WdtXyk1RAhttps://nicecrew.tv/lazy-static/thumbnails/09973652-2163-4c74-9e63-8c915ee8ef75.jpgJack Parsons: Magician of the Nuclear Age │Part TwoJack Parsons: Rocket scientist, alchemist, occultist, and Godfather of the space program – critical in founding the Jet Propulsion Laboratory, advancing the early rocketry that laid the groundwork for NASA’s space program – has been all but erased from his proper place in official history. The truth is always much stranger than fiction. Parsons was a visionary, brilliant, but also a bit of a sperg. He was an ardent follower of Aleister Crowley’s “Thelema,” blending magic with science. He was a magician of the nuclear age. Parson's influence is still felt today, from space and missile technology to the esoteric and new age and UFO movements. Parsons really was the one who popularized Thelema in America, inspiring modern occultists, neo-pagans, wiccans, and chaos magicians. His fusion of science and mysticism and use of psychedelics prefigured the psychedelic and esoteric revival of the 1960s, and a line can be drawn to the modern technocrats today who are going on ayahuasca retreats and taking DMT and talking to the techno elves. In order to really make sense of the world today, it is important to understand the past—our true history, not the sanitized version presented by official history. This story gets very strange, is definitely not child-friendly, and is certainly a cautionary tale. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/3715d52e-1a40-4311-9536-2cffdd414054/047e0b97-e979-405d-bbb2-5d594710bd93-master.m3u8https://nicecrew.tv/videos/embed/7Nwuadd4Cbco9WdtXyk1RA353302182025-05-01T02:41:15.913ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/3VRtuCiifhVcJghiHaaykPhttps://nicecrew.tv/lazy-static/thumbnails/c0a9583d-592a-4e72-8eaa-fcbad34f231b.jpgintroducing Coco the squirrel 🐿️introducing Coco the squirrel 🐿️https://nicecrew.tv/static/streaming-playlists/hls/17b72fc3-da76-45b7-9855-22c3bef099d5/be8f3e9c-188a-4dd6-b901-e711205f7556-master.m3u8https://nicecrew.tv/videos/embed/3VRtuCiifhVcJghiHaaykP20052025-05-01T17:42:57.598ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/5wY5fXX2cYEcpDFZ5W1PSrhttps://nicecrew.tv/lazy-static/thumbnails/8bcc33bc-0978-4def-9ae2-971a15a7c741.jpgCoco the squirrel part two 🐿️Coco the squirrel part two 🐿️https://nicecrew.tv/static/streaming-playlists/hls/24b76c98-f839-486c-92a7-36a2c9fca1a9/56c81a83-c114-466d-9d32-5feca9f1f7dd-master.m3u8https://nicecrew.tv/videos/embed/5wY5fXX2cYEcpDFZ5W1PSr31032025-05-01T17:48:24.486ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/3Cc6Y4P1QxdTxAnKwCXpfHhttps://nicecrew.tv/lazy-static/thumbnails/b1f4ceb6-bb3a-47aa-9295-f5d48620e70f.jpgThe beauty of Great Falls #park #waterfall #greatfallsThe beauty of Great Falls #park #waterfall #greatfallshttps://nicecrew.tv/static/streaming-playlists/hls/153fe53a-d16d-401a-a596-2615ec891c69/55740f3a-0369-49fd-b268-ea2ceb740840-master.m3u8https://nicecrew.tv/videos/embed/3Cc6Y4P1QxdTxAnKwCXpfH25012025-05-01T17:55:19.814ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/35mWXVvmestN4k5GhZv9fPhttps://nicecrew.tv/lazy-static/thumbnails/e73cf943-ff79-4794-90ab-3bfe3f187040.jpgGreat Falls ParkGreat Falls Parkhttps://nicecrew.tv/static/streaming-playlists/hls/10ce296f-342e-454f-8625-5849102e9a93/8959c2ab-9f65-494e-91f3-131e76372377-master.m3u8https://nicecrew.tv/videos/embed/35mWXVvmestN4k5GhZv9fP25012025-05-01T17:55:19.021ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/w16R9pJeyodDSm8HeRgm9Thttps://nicecrew.tv/lazy-static/thumbnails/c3e7c43e-6b4e-4f09-9182-d58a03eb3c30.jpgGreat Falls Park #virginiaGreat Falls Park #virginiahttps://nicecrew.tv/static/streaming-playlists/hls/f2f5c36a-7550-494c-a1ce-472a0a36f01b/2ec93d06-6c24-48a8-a9cd-cf1401daa62c-master.m3u8https://nicecrew.tv/videos/embed/w16R9pJeyodDSm8HeRgm9T15002025-05-01T17:59:46.815ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/4Wt2nyG2ot8cCXj9WUWuDAhttps://nicecrew.tv/lazy-static/thumbnails/4d48a254-40d4-4fa0-9bc6-c80852066856.jpgJJR - 288 - End Of The White Guilt Era (Pt. 1)Shiloh Hendrix may not be the anti-heroine we asked for, but she is definitely the defiant dissident White America needed. I go over the fallout from White Woman Saying Forbidden Word In The Park and what it means for our culture and society. https://nicecrew.tv/static/streaming-playlists/hls/1fe63bc5-24a1-41bb-bd7e-8388563e75e4/21668927-eae8-490d-bb17-f341b78460a6-master.m3u8https://nicecrew.tv/videos/embed/4Wt2nyG2ot8cCXj9WUWuDA501855862025-05-04T15:58:47.900ZYESJust Joe Radio NOhttps://nicecrew.tv/w/377rpjqjvq3vfL9f2EYJPzhttps://nicecrew.tv/lazy-static/thumbnails/3e0e421f-92c3-4b59-98dd-553b399757e8.jpgJJR - 288 - End Of The White Guilt Era (Pt 2)Shiloh Hendrix may not be the anti-heroine we asked for, but she is definitely the defiant dissident White America needed. I go over the fallout from White Woman Saying Forbidden Word In The Park and what it means for our culture and society. https://nicecrew.tv/static/streaming-playlists/hls/110cb51d-3e94-4e72-9916-f79fc70898ef/75e72300-89ce-4e6d-8c68-692bae9427b1-master.m3u8https://nicecrew.tv/videos/embed/377rpjqjvq3vfL9f2EYJPz379854132025-05-04T16:00:21.165ZYESJust Joe Radio NOhttps://nicecrew.tv/w/nBxdtNacu9jKJ8vS7QJH5Vhttps://nicecrew.tv/lazy-static/thumbnails/90172932-211c-4b92-9688-fad52ae6029e.jpgMike Waltz Outed as Israeli Spy & The Battle of Shiloh HendrixMike Waltz has officially been outed as a spy for a foreign nation. It's now illegal for Americans to boycott a foreign country in the Middle East, and a Minnesota mom has too much fatigue. Support Shiloh here: https://www.givesendgo.com/ShilohHendrix Support Whitmer Doc: https://www.givesendgo.com/RadixVerum Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/af062e4b-36e5-487f-b058-375651a2ab31/aae47415-b6a1-4496-bc5c-90b7335af8f4-master.m3u8https://nicecrew.tv/videos/embed/nBxdtNacu9jKJ8vS7QJH5V23572.56022025-05-04T19:44:50.304ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/pWhbRfBmej4tkbj6aq3jMchttps://nicecrew.tv/lazy-static/thumbnails/0324bed5-906d-4c95-9dfc-7a16d3307adf.jpgPeople are outraged about SkinnyTok and thin influencersJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/c1d65411-253c-4239-9164-82941f469f75/22aa2487-f6a5-41a7-85c8-b469e188fd00-master.m3u8https://nicecrew.tv/videos/embed/pWhbRfBmej4tkbj6aq3jMc226851792025-05-05T20:56:25.300ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/asaWZEuMLP9mbGbJqpiHMvhttps://nicecrew.tv/lazy-static/thumbnails/6db34d20-8fdd-4831-88b9-4ab7ecd0f6c5.jpgWhite UnityIn the spirit of White unity, solidarity with our folk when they are under attack. https://www.givesendgo.com/Brannonfamily https://www.givesendgo.com/ShilohHendrixhttps://nicecrew.tv/static/streaming-playlists/hls/4c89b77c-58b7-4825-ac34-1d569468f0ab/3238df8b-14fa-4403-82b1-54c2e985f1f2-master.m3u8https://nicecrew.tv/videos/embed/asaWZEuMLP9mbGbJqpiHMv25500412025-05-05T22:16:45.898ZYESReichsgesetzNOhttps://nicecrew.tv/w/6Ynw8L2GQtmMGBocNBSHtJhttps://nicecrew.tv/lazy-static/thumbnails/501dda9e-4c5f-4569-a545-c2c68276bf22.jpgWhat I Hate About jews (The Romantics parody)What I Hate About jews (The Romantics parody) Hey Uh huh Hey Uh huh What I hate about jews You just ain't right Tell me you're the chosen ones While you ruin everything white, yeah Let's start gassing jews all damn year This is a burning hate they'll learn to fear 'Cause it's true That's what I hate about jews What I hate about jews Your usury in finance Inflation going up, down, jump around Got the goyim in your trance, yeah Keep on gassing jews all damn year This is a burning hate they'll learn to fear 'Cause it's true That's what I hate about jews That's what I hate about jews That's what I hate about jews You know I really hate these kikes! Hey What I hate about jews Got niggers fighting their fight Never wanna pack and go But always subvert nations of whites, yeah Keep on gassing jews all damn year This is a burning hate they'll learn to fear 'Cause it's true That's what I hate about jews That's what I hate about jews That's what I hate about jews That's what I hate about jews That's what I hate about jews That's what I hate about jews That's what I hate about jews Hey Uh huh Hey, hey, hey, hey Uh huh, brr Hey Uh huh Heyhttps://nicecrew.tv/static/streaming-playlists/hls/305c9b37-4c4d-43f1-920d-3b098c5dcb8c/142986ac-b45d-4e6c-9e04-4a8f08fe5362-master.m3u8https://nicecrew.tv/videos/embed/6Ynw8L2GQtmMGBocNBSHtJ176082025-05-05T23:50:01.853ZYESReichsgesetzNOhttps://nicecrew.tv/w/9gcG6UqYoQigiUoYwe8wARhttps://nicecrew.tv/lazy-static/thumbnails/1a7583bc-8182-4bc6-961b-749adf96c741.jpgMy Thoughts on the "Dad Bod" vs "Fit Bod" DebateThere is a debate raging about whether women are more attracted to the "dad bod" physique vs the "fit bod" physique - I think it's a bit more complex than that and wanted to share my thoughts. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/42e8788e-0bf0-469c-8171-1952c1d652c5/57d3760d-2ab2-47dd-84c6-77abea77f047-master.m3u8https://nicecrew.tv/videos/embed/9gcG6UqYoQigiUoYwe8wAR150451802025-05-08T20:27:51.457ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/tCJroewYu3E5G2wDoG2Vnphttps://nicecrew.tv/lazy-static/thumbnails/aea89966-42fe-411d-9b39-373721862749.jpgNew Helldivers 2 Warbond- Release May 17thNew Helldivers 2 Warbond- Release May 17thhttps://nicecrew.tv/static/streaming-playlists/hls/dfc7ac33-e530-4d9a-bed2-154c3e54b0f5/450009de-fef2-4736-8493-2dc04fe24e4b-master.m3u8https://nicecrew.tv/videos/embed/tCJroewYu3E5G2wDoG2Vnp62032025-05-08T23:41:59.603ZYESMain omega_variant channelNOhttps://nicecrew.tv/w/9BcRDTMsFMd683WaXkxtdPhttps://nicecrew.tv/lazy-static/thumbnails/f717b244-069a-45c7-ad58-07df1cd7d793.jpgHelldivers 2 puzzle eventHelldivers 2 puzzle eventhttps://nicecrew.tv/static/streaming-playlists/hls/45b372a3-6b77-477d-9414-f4f6ee84395b/73ecc914-a102-4268-a7d7-b7d721594ed9-master.m3u8https://nicecrew.tv/videos/embed/9BcRDTMsFMd683WaXkxtdP149032025-05-09T22:58:36.376ZYESMain omega_variant channelNOhttps://nicecrew.tv/w/dFAes1dHhiXdoJn5YpgJT1https://nicecrew.tv/lazy-static/thumbnails/72e29850-9f26-4adc-9463-20be5b1641b7.jpgKanye West - Heil HitlerWhat a time to be alive https://nicecrew.tv/static/streaming-playlists/hls/66b4c45f-e1d8-4f86-854c-5f74f5d336be/d8fab270-c8ce-46c6-8fb8-b5baff6d02ec-master.m3u8https://nicecrew.tv/videos/embed/dFAes1dHhiXdoJn5YpgJT114651352025-05-10T01:51:35.879ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/2bLM2GVXfs3DU6gRbNG27Fhttps://nicecrew.tv/lazy-static/thumbnails/4de41b07-bfed-4d45-b926-13281f3368d3.jpgJJR - 289 - The Winds Of Cultural ChangeStand up White man and President of Return To The Land, Aarvoll, stops by to educate us on his organization's efforts to build 'White Intentional Communities'. Also NAACP demanns jussuss, groveling from beyond the grave, Save The Unibrow GiveSendGo grift exposed, and oh SO MUCH more!https://nicecrew.tv/static/streaming-playlists/hls/099a2bb8-19ba-4d5c-a04c-8ae965d536c7/1c5f8481-edd2-4094-84b0-61b539c0f4b2-master.m3u8https://nicecrew.tv/videos/embed/2bLM2GVXfs3DU6gRbNG27F290202042025-05-12T00:33:20.066ZYESJust Joe Radio NOhttps://nicecrew.tv/w/pDCjXguSuGTEN5jjqaW9p7https://nicecrew.tv/lazy-static/thumbnails/9626fbd4-e4a4-4441-b8b7-33c7b321ccb6.jpgJJR - 289 - The Winds Of Cultural ChangeStand up White man and President of Return To The Land, Aarvoll, stops by to educate us on his organization's efforts to build 'White Intentional Communities'. Also NAACP demanns jussuss, groveling from beyond the grave, Save The Unibrow GiveSendGo grift exposed, and oh SO MUCH more!https://nicecrew.tv/static/streaming-playlists/hls/bf831888-f0ee-4f14-a904-1fc0fb4a3cdc/918abc8e-ad33-4d91-bd33-04e409e10e22-master.m3u8https://nicecrew.tv/videos/embed/pDCjXguSuGTEN5jjqaW9p711060752025-05-12T00:33:48.782ZYESJust Joe Radio NOhttps://nicecrew.tv/w/1d7BU4SP1gsQSpjuecq2eihttps://nicecrew.tv/lazy-static/thumbnails/4b500b49-ccd4-4a3a-ad5e-6d2cf461cb69.jpgJJR - 289 - The Winds Of Cultural ChangeStand up White man and President of Return To The Land, Aarvoll, stops by to educate us on his organization's efforts to build 'White Intentional Communities'. Also NAACP demanns jussuss, groveling from beyond the grave, Save The Unibrow GiveSendGo grift exposed, and oh SO MUCH more!https://nicecrew.tv/static/streaming-playlists/hls/01b10119-ad0a-4963-b071-cb4e150da3b7/5204dd42-3a86-4cf5-90c1-8b26305ad71b-master.m3u8https://nicecrew.tv/videos/embed/1d7BU4SP1gsQSpjuecq2ei319851532025-05-12T00:32:39.222ZYESJust Joe Radio NOhttps://nicecrew.tv/w/3nVK2XzqLzkYM4yuK9HHy5https://nicecrew.tv/lazy-static/thumbnails/bccda7ad-c2e6-4640-a708-60d0843e1975.jpgHardening a KnifeThe hardening process for one of my handmade knives. The setup is easy and beginner friendly. Total cost of the setup to harden is around 45 dollars.https://nicecrew.tv/static/streaming-playlists/hls/13420422-6fcb-4c54-8c59-4163f17058d0/cc4b9b1c-ce94-4f3b-ba0b-df794555fe0f-master.m3u8https://nicecrew.tv/videos/embed/3nVK2XzqLzkYM4yuK9HHy5147052025-05-16T18:12:11.159ZYESCobalt Sasquatch GamingNOhttps://nicecrew.tv/w/1iyTYe6yMfLaG7KrFctcA3https://nicecrew.tv/lazy-static/thumbnails/418367e4-9f80-4aa1-9e59-3e6c2bb1c886.jpgWhat is going on in Australia?Australia, the prison colony, is no country for Nationalists. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/0273eabf-8c46-4c02-9ca3-8832988bef4a/20f21ff0-f9a9-42c2-92eb-8cbcf9d9fd34-master.m3u8https://nicecrew.tv/videos/embed/1iyTYe6yMfLaG7KrFctcA316115802025-05-16T21:42:13.013ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/qD42yehAKe7NpSoAYgZdhMhttps://nicecrew.tv/lazy-static/thumbnails/3a2c640c-db3c-4bc7-b4d1-ff3393fc1b61.jpgFatigue at all-time highs! Woman charged with bank fraud attacks detectiveWe review the footage from the arrest of Colbianta Spain for attempted bank fraud of over $50k. https://www.kplctv.com/2024/01/19/woman-arrested-allegedly-depositing-50000-counterfeit-check-punching-officer-face/ Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/c787b671-df26-4019-b4d2-90ab4a1beed5/bba1c51d-28e0-4a7c-bf15-12ebaae37109-master.m3u8https://nicecrew.tv/videos/embed/qD42yehAKe7NpSoAYgZdhM157206732025-05-17T18:56:01.962ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/rmmKUnZUbQhN8xVLtSWdV7https://nicecrew.tv/lazy-static/thumbnails/037d42f5-dfd1-4824-b630-6c4e9f03c502.jpgShiloh Hendrix UpdateReleased on 05/19/2025https://nicecrew.tv/static/streaming-playlists/hls/cd4c2242-53cb-4cf9-a4d1-9d58316e4fa8/5561106f-ff48-411d-91d0-9edd19be100c-master.m3u8https://nicecrew.tv/videos/embed/rmmKUnZUbQhN8xVLtSWdV72985432025-05-20T03:06:14.900ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/qeVWazRA9xACh48Nr73gdShttps://nicecrew.tv/lazy-static/thumbnails/e8f28d75-e6c3-4adc-91e7-45c79de60c40.jpgShiloh Hendrix speaks, and Toad is canceled.America's sweetheart speaks, and Toad from Tower Gang is canceled over his ukulele cover of Ye's HH. Support Toad here: https://www.givesendgo.com/towergangtoad Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/c44d3c1a-f526-4adc-89f7-52cf15266356/c0753af8-572c-45d1-93ab-d425c7f86cb1-master.m3u8https://nicecrew.tv/videos/embed/qeVWazRA9xACh48Nr73gdS1649511962025-05-20T16:58:08.118ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/6NyYHd8Qp7zBA9PBXXzc6Khttps://nicecrew.tv/lazy-static/thumbnails/728d3270-a711-40c6-95a6-67a6bdd50bc2.jpgBobo, the world's best catBobo, the world's best cathttps://nicecrew.tv/static/streaming-playlists/hls/2efe3ae0-b30b-4fb0-9270-4ce50f571d11/6b8455e1-5a8b-4d8e-a4c6-1e69deda90b8-master.m3u8https://nicecrew.tv/videos/embed/6NyYHd8Qp7zBA9PBXXzc6K8552025-05-20T20:04:10.402ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/8FbTP9nLGLBNFH7QBCxjEFhttps://nicecrew.tv/lazy-static/thumbnails/996d32fa-4b50-466f-b385-1588fabcb8f1.jpgMKULTRA was used during the "War on Terror," and the CIA had 2 separate torture programsSource: https://kayej.substack.com/p/revealed-after-911-cia-operated-not Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/3e28b0de-cf5a-4a8b-ab4f-1821993ea543/f57fdd68-4216-4efb-b625-2491de9def0f-master.m3u8https://nicecrew.tv/videos/embed/8FbTP9nLGLBNFH7QBCxjEF328351272025-05-20T21:42:13.199ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/1ma5UBVuw6xzvSguApTCQvhttps://nicecrew.tv/lazy-static/thumbnails/f434ee08-d6eb-436b-8e3a-61bb6bacd481.jpgTime laspe: Shadow-Sammi In RedA digital painting made wish Heavypaint, I’m just glad I made a video for this month, since I was behind a month. Anyways, I hope you all enjoy at least. BGM: Serenity by Jason Shaw (Creative Commons) Finished Drawing: https://www.side7.com/content/V1r7WLeGrxhttps://nicecrew.tv/static/streaming-playlists/hls/02d07957-4b0e-43fa-8d62-799d19da6235/142b16ce-f447-4854-950b-4c2f3de21e76-master.m3u8https://nicecrew.tv/videos/embed/1ma5UBVuw6xzvSguApTCQv80002025-05-21T12:54:27.259ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/owAVufCjSi6qcMUQKxTbtAhttps://nicecrew.tv/lazy-static/thumbnails/567acc47-9101-4532-a67e-5d8a7f55d6e7.jpgPeter Thiel MalfunctioningJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/b66ee29b-7aed-41f9-b458-fc0f2be5a770/7157d3ca-5799-4ebb-93eb-f9d57dcdfdb7-master.m3u8https://nicecrew.tv/videos/embed/owAVufCjSi6qcMUQKxTbtA54451212025-05-22T17:34:44.856ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/8d8boBdiBgFMuqrBW9ihUghttps://nicecrew.tv/lazy-static/thumbnails/6e871e39-90b9-4e12-b28f-3bf5c768ace8.jpgElectrochemical EtchingThe result of my first attempt at electrochemical etchinghttps://nicecrew.tv/static/streaming-playlists/hls/3a6151f5-e873-4afc-9800-3ea7a063803f/7acc4196-dc3d-4b67-8fac-5a5a20d9cbb1-master.m3u8https://nicecrew.tv/videos/embed/8d8boBdiBgFMuqrBW9ihUg72562025-05-24T18:48:40.151ZRapeNiggerFinanceYESCobalt Sasquatch FoundryNOhttps://nicecrew.tv/w/6b35FyWLHdMxY72FyszzS9https://nicecrew.tv/lazy-static/thumbnails/f99af466-ac54-4395-a2d2-b3d454b4ff6b.jpgOF "model" Annie Knight injured after Bonnie Blue inspired "challenge" with 583 men in 6 hoursJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/29e469cd-a1f1-474e-a9a3-9f16243d7c08/7a1ed79c-a8aa-436d-b5d1-eb56fe96b122-master.m3u8https://nicecrew.tv/videos/embed/6b35FyWLHdMxY72FyszzS9336003302025-05-24T22:12:50.693ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/9XdeaLwjJZU5gUwePmZ8hthttps://nicecrew.tv/lazy-static/thumbnails/fac6e7ad-aa03-4fa5-8965-3d0d836e9ed0.jpgJoe Morrison reacts to the news Ed Martin will take a "hard look" at the Whitmer Hoax caseJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/487e8d43-8c7f-422d-a612-7be5a539367f/b2558356-7e52-4eba-909a-703573a9066e-master.m3u8https://nicecrew.tv/videos/embed/9XdeaLwjJZU5gUwePmZ8ht1545552025-05-25T15:13:41.594ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/gjurAzPKLsQ4mvq8omd4v3https://nicecrew.tv/lazy-static/thumbnails/229885db-b89d-4417-85fc-b9ee7c6917ca.jpgOddities around IVF B0mber Guy Bartkus & his connections...I wanted to cover this case before it gets memory-holed like the rest of them. The allegations of FBI presence in the area before the b*mbing, the connection to Efilism, and Adam Lanza, etc. Sources: https://x.com/books_rum/status/1924213975329460708 https://x.com/BonusFact/status/1667034972534763520 https://www.dailymail.co.uk/news/article-14725031/palm-springs-ivf-clinic-bomber-connection-woman-killed-weeks-before.html https://x.com/JolyonKlebold/status/1924808494378541133 https://x.com/JolyonKlebold/status/1800537669812015316 https://x.com/JolyonKlebold/status/1815120981154828312https://nicecrew.tv/static/streaming-playlists/hls/7c0dfece-ca79-4a95-816c-5e7819c5a1a0/5c362bfc-897a-4b49-b62e-4c253e4226e1-master.m3u8https://nicecrew.tv/videos/embed/gjurAzPKLsQ4mvq8omd4v3182152622025-05-28T01:01:15.090ZGuy BartkusFBIIVF BomberAdam LanzaSandy HookYESRadix Verum ☦NOhttps://nicecrew.tv/w/oGTS6hTkKfBZUBZcKxsF91https://nicecrew.tv/lazy-static/thumbnails/7ebe1d94-be05-46c5-b643-90a9d84c7c4b.jpgSlayer Gate - NightmareOne of the most difficult Slayer Gate encounters I've played. This was my like... 35th take.https://nicecrew.tv/static/streaming-playlists/hls/b7dec36f-cc93-4413-81f2-5bc79cd7c36c/5a6426a4-2622-43bf-a94b-e9134f41cc63-master.m3u8https://nicecrew.tv/videos/embed/oGTS6hTkKfBZUBZcKxsF912240242025-05-28T23:35:34.254ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/8kCGZaNo9JnVsNmJAGK4Pthttps://nicecrew.tv/lazy-static/thumbnails/fee0ef09-d200-4f1f-8a56-32fb1bcb6f23.jpgDOOM Eternalshe eternally got my goobis doomed (eternally)https://nicecrew.tv/static/streaming-playlists/hls/3b6db939-073b-4656-bdc3-9b8815f5a725/9821e866-0dc0-4d8a-92b8-cbd56ef7ca72-master.m3u8https://nicecrew.tv/videos/embed/8kCGZaNo9JnVsNmJAGK4Pt90100172025-06-04T03:41:50.068ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/bG5n8SFfN9SEyySciHT16thttps://nicecrew.tv/lazy-static/thumbnails/26296ffd-ba9a-4f37-92fd-25f6c5f677d0.jpgSong Preview 7 (read desc)Another song preview, a lighthearted melancholy song this time. I'm going to focus on creating more as well too, I'll post three times a week in the future as well too, since I'm on summer vacation I have a ton of time.https://nicecrew.tv/static/streaming-playlists/hls/5693d3ba-63df-44da-899a-f53104eed825/c074724d-bd0d-4576-ba22-5267fb3e067d-master.m3u8https://nicecrew.tv/videos/embed/bG5n8SFfN9SEyySciHT16t189032025-06-05T20:13:33.077ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/doHgBw6BAQyvs7kbMj27fmhttps://nicecrew.tv/lazy-static/thumbnails/6814ff3a-7eb8-4acc-b8f7-a126c07a0e50.jpg"Men in Decline," Women Most Affected: "Stay at Home Sons" Rant by Tomi Lahren & Laura IngrahamMEN ARE IN DECLINE, say Laura Ingraham and Tomi Lahren. “Gen Z rebrands laziness as 'stay-at-home sons'—just like they did with 'quiet quitting.' But let’s be honest: the real crisis is the feminization of men. Young women want families. Too many young men want DoorDash and mama’s basement.” - Tomi Lahren This is delusional and insane. Young men are being destroyed spiritually, economically, and demographically. This is not their fault, but the result of a systemic and planned attack. They are actively discriminated against and shamed by society; really, this is just another symptom of the decline of the West. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/645975bb-b160-4e73-af41-7a676ac64880/336ce679-45c2-4aa9-a301-dcd8191386da-master.m3u8https://nicecrew.tv/videos/embed/doHgBw6BAQyvs7kbMj27fm141151372025-06-07T17:10:25.865ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/eVdYyMQeqwqU78gEtsKryRhttps://nicecrew.tv/lazy-static/thumbnails/213eb8e0-6bcc-4ff4-b869-e6aeef5bf7f4.jpgRefuting Dana Nessel's Lies with the Whitmer Hoax VictimsThe full interview can be watched on my X and Rumble Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/70b537fb-76d4-4993-bcef-f6f236a0ae2d/a42fb6c9-5ca2-471c-928f-21d229e0f869-master.m3u8https://nicecrew.tv/videos/embed/eVdYyMQeqwqU78gEtsKryR7620302025-06-08T02:23:25.183ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/oBzmdNwA6fxJvGoTL1eyAdhttps://nicecrew.tv/lazy-static/thumbnails/ab6e1171-d944-4f0f-b7e9-2ac61c9cbe71.jpgHow it started with Garrett SoldanoHow it started with Garrett Soldanohttps://nicecrew.tv/static/streaming-playlists/hls/b720a261-2bae-48ad-be18-4d256b7c1788/cc3459f5-1444-4de8-9cbe-534974f5c115-master.m3u8https://nicecrew.tv/videos/embed/oBzmdNwA6fxJvGoTL1eyAd1900262025-06-08T12:51:52.654ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/mVQALCqLBcoK1TuFH2S2WUhttps://nicecrew.tv/lazy-static/thumbnails/d1793a35-73b7-40b2-84a1-e10db1e511b0.jpgReplaced by AI: Software Engineer now living in an RV doing Door DashJust "learn to code" they said, now they say AI will be writing almost all of the code in a year. This guy got a computer science degree, had a six-figure job, and lost it. He has been unable to get his foot in the door for an interview, thanks to AI screening job applications before a human is even in the chain. Now they are telling everyone just "go into the trades" is this the new learn to code? https://archive.is/q8RZt Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/a97b24bc-5f4d-462b-b289-b406a88d51d4/1d3dfaf2-bc7a-4943-8985-cd9485c4d84c-master.m3u8https://nicecrew.tv/videos/embed/mVQALCqLBcoK1TuFH2S2WU94752582025-06-09T13:33:58.263ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/9vkEWZzspRJoDkTRwHf57ehttps://nicecrew.tv/lazy-static/thumbnails/14f22c9e-4abc-44eb-a30a-c521a040e7d3.jpgSong Preview 8Another song preview for a song that's themed around general Nihilism. I hope you all enjoy, I'll post other videos as well too.https://nicecrew.tv/static/streaming-playlists/hls/44e1cd36-9fa9-4a55-9865-657a7c7edb39/ad6b4ead-ed3a-4e01-ad90-8b047499d153-master.m3u8https://nicecrew.tv/videos/embed/9vkEWZzspRJoDkTRwHf57e106012025-06-09T21:52:39.233ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/pK15erxXLDc62ycwy9jAqPhttps://nicecrew.tv/lazy-static/thumbnails/7bd67460-51b5-4072-9320-732e1c43a279.jpgMy Thoughts on Serial Experiments Lain. It Predicted a Lot.I recently decided to rewatch Serial Experiments Lain. I first watched it around 8 years ago and remembered it being good, but rewatching it, I was struck by how prescient this show from 1998 was. Lain indeed predicts a lot of the problems we have in the modern era in 2025. Lain is about a young Japanese girl navigating through adolescence, troubled relationships, and her interactions with “the Wired,” a virtual reality parallel to the Internet. However, it encompasses all human communicational networks (television is included). Essentially, it is more or less a sort of "cyberspace." It’s a very Lynchian anime... anime, serial experiments lain, nano technology, accelerationism, internet indoctrination, radicalization, millennial cults, internet addiction, virtual reality, algorithmic manipulation, ubiquitous surveillance, dissociation, schizo posting, aum shinrikyu, cults, secret societies, techno dystopia, surveillance state, ted kacynski, waco, okc, oklahoma city, timothy mcveigh, ruby ridge, heavens gate, ghost in the shell, akira, twin peaks, david lynch, laura palmer, lain iwakura, 764, O9A, silicon valley, elon musk, peter thiel, bryan johnson, marc andresson, hp lovecraft, charles fort, fantastic realism, gnosticism, christianity, artificial intelligence, philip k dick, artificial identity, dissociation.https://nicecrew.tv/static/streaming-playlists/hls/c043375c-63d3-4bf7-a1db-2c925adddcb7/c45145d2-06e1-48da-b023-c776fa004ac8-master.m3u8https://nicecrew.tv/videos/embed/pK15erxXLDc62ycwy9jAqP321954292025-06-10T20:26:33.738Zanimeserial experiments lainTed Kaczynski ghost in the shelltwin peaksYESRadix Verum ☦NOhttps://nicecrew.tv/w/tHqqb5eM5GVjiEZnBqPH5Qhttps://nicecrew.tv/lazy-static/thumbnails/a81f12fb-f9d7-420b-8752-4c0c82f4d131.jpgLas Vegas Shooting - Levi Hancock's Body CameraOriginal video uploaded [here](https://www.youtube.com/watch?v=0wafK4m1r6Q) ***Original video description*** Well folks, here it is, the footage they told us that didn't exist. Nearly 8 years later, we have it. Quick Sequence of events: -Back in 2017, we were told this footage did not exist because Hancock didn't turn his camera on: • The Reason Levi Hancock Did Not Have Body-... -5 years later the LVMPD provides Paramount+ the footage for their documentary titled "11Minutes" They used 6 small segments of the entire footage in episode 3 of the series. Most of us never watched it, or just didn't notice. -3 Years later, a very diligent investigator (username: Comrade Chimp/Ethan) notices and brings this to my attention. -First, attempts were made on my part to try and obtain the footage directly from the Paramount+ production company/archival service, but were moot. -Pointed Stick then requesting the footage from the LVMPD via NPRR (Nevada Public Records Request). We receive a highly redacted piece of footage with both audio and video removed. This was appealed, and a more "usable" piece of footage was subsequently yielded, which is what is being uploaded here today. Why the LVMPD witheld the footage back then, lied to the public and ignored a court order to release it, is anyone's guess. Ultimately, all the thanks and appreciation should go to both Ethan for bringing this to our attention, and Pointed Stick for putting in the leg work to obtain the footage from LVMPD. Pointed Stick's channel can be found here: / @pointedstick1330 For any more details or information, feel free to join the discord server" https://discord.gg/CrgTBzc Enjoy. Dedicated to @UFOHunterUK "Tony" R.I.P. / @ufohunteruk Wish you were here for this one my friend.https://nicecrew.tv/static/streaming-playlists/hls/e06f4928-32ba-4d0f-a314-d2aebf114154/bafe4e03-bd9c-44fb-964f-ffcc176a2a0b-master.m3u8https://nicecrew.tv/videos/embed/tHqqb5eM5GVjiEZnBqPH5Q481101362025-06-12T17:11:33.023ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/pc4V7qZXhFUh28JV1dCcZ8https://nicecrew.tv/lazy-static/thumbnails/d9887a6f-8eba-48fa-8593-9dc3f32ff8e7.jpgThe Lie of Techno Optimism, Part OneJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/bbcdc8a6-5e6b-48d5-9f58-465a7802bd1d/ded1e0e1-94fe-4577-9676-47ef16bac849-master.m3u8https://nicecrew.tv/videos/embed/pc4V7qZXhFUh28JV1dCcZ813725892025-06-12T21:55:17.379ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/kk2sRWKM7sDTNMCadXhUiEhttps://nicecrew.tv/lazy-static/thumbnails/b6f63862-1870-42c3-8337-b8af7a630488.jpgPeter Thiel Confronted at BilderbergJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/9c85aaf8-4985-4d62-a0c3-75468a722300/24dd235c-1812-4f9d-ac3c-bd8ee8f130f6-master.m3u8https://nicecrew.tv/videos/embed/kk2sRWKM7sDTNMCadXhUiE58551442025-06-13T20:03:23.766ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/owRjsuLNqKtxUD4RecGsX7https://nicecrew.tv/lazy-static/thumbnails/0ca57519-20a8-4273-9ce3-38f80cc03fe6.jpgKristen Stewart is on some delusional nonsense.Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/b677c1ce-4179-4085-b206-8eee55d143f4/5eef0e1c-baae-4beb-8fcc-e6bdb959988d-master.m3u8https://nicecrew.tv/videos/embed/owRjsuLNqKtxUD4RecGsX7128401242025-06-14T16:10:08.268ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/sHHVUFvqS8w4SUcgfek5vShttps://nicecrew.tv/lazy-static/thumbnails/05bbc89a-0783-482f-9a37-f3267800a6c3.jpgSaint John of Kronstadt on Gluttony and DrunkennessFrom the diaries of Saint John of Kronstadt Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/d860f08e-70b6-4524-8950-ae3269946a1c/430c7144-8936-4953-81e2-6182a6092003-master.m3u8https://nicecrew.tv/videos/embed/sHHVUFvqS8w4SUcgfek5vS14045862025-06-14T22:19:19.311ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/1MyiJvcKDWffzJpo86VKERhttps://nicecrew.tv/lazy-static/thumbnails/e65d5e7f-c095-4e6e-a425-32370631a71d.jpgNiggerNiggerhttps://nicecrew.tv/static/streaming-playlists/hls/065c60f6-fa37-4ba3-b0c3-7ae59c2087d1/10e2769a-665a-4aa1-b2b4-3750e36632cf-master.m3u8https://nicecrew.tv/videos/embed/1MyiJvcKDWffzJpo86VKER1275142025-06-16T00:48:31.651ZYESRick @ NiteNOhttps://nicecrew.tv/w/4youkiSPQph5Hqw6R9dCS5https://nicecrew.tv/lazy-static/thumbnails/4147dc1d-2219-4957-987b-c8b37a7e21ef.jpgJF Gariepy gloats about mashing our potato, Mama JF (allegedly).Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/1cd1135d-c31c-42dc-b67f-c0a95ea8e6a8/9418cad4-ea48-4d66-b10e-2dc736e93ec8-master.m3u8https://nicecrew.tv/videos/embed/4youkiSPQph5Hqw6R9dCS577001202025-06-16T18:06:47.037ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/uAC7RjCQ5wnD8BeBh8uqnVhttps://nicecrew.tv/lazy-static/thumbnails/ab846993-a8ac-4dbb-86c6-5b44faa0c78b.jpgIran vs Israel - 06/17/2025Red flag of benis wenis editionhttps://nicecrew.tv/static/streaming-playlists/hls/e7956de2-6420-43bb-a0e9-d69eaf394a67/e81d6e26-f4ad-4964-a896-d50be7bfdce4-master.m3u8https://nicecrew.tv/videos/embed/uAC7RjCQ5wnD8BeBh8uqnV78995872026-01-25T14:29:18.286ZYESNiceCrewNOhttps://nicecrew.tv/w/aNVgjXyMB5P9czwWKYPqwBhttps://nicecrew.tv/lazy-static/thumbnails/be54341a-d9b0-4c6c-b65f-06af1596f675.jpgKanye West - Heil Hitler (AI Punk Cover)Kanye West - Heil Hitler (AI Punk Cover)https://nicecrew.tv/static/streaming-playlists/hls/4f6f4960-32a0-43aa-9f1e-ba3b9ad7f087/1467d274-f052-4498-a23a-fcc48ff1c5f7-master.m3u8https://nicecrew.tv/videos/embed/aNVgjXyMB5P9czwWKYPqwB1080182025-06-18T02:33:23.221ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/u5wmbdKUnnQscuAbVdsvpPhttps://nicecrew.tv/lazy-static/thumbnails/e940db16-2f92-4baa-a612-a8b9f88d8081.jpgThe Lie of Techno Optimism, Part TwoJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/e3618f62-7a46-4f82-b084-a113823d36e9/7aef5dd1-fd59-4d2a-be71-17029c297dc6-master.m3u8https://nicecrew.tv/videos/embed/u5wmbdKUnnQscuAbVdsvpP271451302025-06-19T17:13:42.603ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/4xT6M59HYM5XHQc6jbYHSPhttps://nicecrew.tv/lazy-static/thumbnails/fc6041af-a3da-4d3b-9de6-b40779b0f264.jpgEclipsa Krita Time LaspeAn illustration of Eclipsa the alien, I was originally going to make her a moon alien, but I picked the eclipse instead. Finished Drawing: https://side7.com/content/VR96pgzN81 Edited using VSDC, Drawn in Krita using the recording dockerhttps://nicecrew.tv/static/streaming-playlists/hls/1cbef6cf-4a81-4995-98f1-5ccfa7e51fa7/4ba1682a-4453-4fcd-b6a8-37c9952ee0a7-master.m3u8https://nicecrew.tv/videos/embed/4xT6M59HYM5XHQc6jbYHSP161012025-06-20T02:00:34.582ZKritatimelaspeanimeartoriginalYESDreamy's LoungeNOhttps://nicecrew.tv/w/245J9xMiKfaqSaU59Mroiehttps://nicecrew.tv/lazy-static/thumbnails/a402c444-ce10-4e47-bbbf-9c35621532a1.jpgTwo of my all time favorite quotes #dostoyevski #cormacmccarthyTwo of my all time favorite quotes #dostoyevski #cormacmccarthyhttps://nicecrew.tv/static/streaming-playlists/hls/0887486b-7047-456f-b910-d62e258cabb7/a75c08df-80bd-4c93-bec3-8a034309eb1d-master.m3u8https://nicecrew.tv/videos/embed/245J9xMiKfaqSaU59Mroie32062025-06-20T18:10:26.068ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/ps6ap3Rzm1oLX1owQVA3c4https://nicecrew.tv/lazy-static/thumbnails/4fde5032-0aa8-47b1-8fd9-0bd5d4059dbc.jpgYou need to hear this.A reading from "Our Thoughts Determine Our Lives" by Elder Thaddeus of Vitovnica Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/bde6b55a-5e35-4ac9-951c-f9491a5370e9/b00efb1e-e1c6-4b54-a777-58781f412b95-master.m3u8https://nicecrew.tv/videos/embed/ps6ap3Rzm1oLX1owQVA3c4164251562025-06-20T18:55:31.655ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/62zuLF35fk2pYb2tWmyd8Ghttps://nicecrew.tv/lazy-static/thumbnails/1ba6d05b-1749-43f7-8a96-23da24f2858d.jpgThere must be a reckoning...There must be a reckoning...https://nicecrew.tv/static/streaming-playlists/hls/28b61469-a562-4b69-9a2a-cc6115b73aae/574f3c01-94f9-4e2a-83dd-d12583d268ca-master.m3u8https://nicecrew.tv/videos/embed/62zuLF35fk2pYb2tWmyd8G60062025-06-21T19:30:27.928ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/kS7AAJBqw23o1Uioah59jphttps://nicecrew.tv/lazy-static/thumbnails/618c060b-654b-4da6-b7a1-268380d3ab07.jpgSermon on the Last Judgment │St. John MaximovitchSaint John, the Wonderworker of Shanghai and San Francisco, was a diocesan bishop of the Russian Orthodox Church Outside Russia (ROCOR) who served widely from China to France to the United States. He was born in Russia. He and his family fled their country as the Bolshevik revolutionaries descended, fleeing to Yugoslavia. He enrolled in the Department of Theology of the University of Belgrade. He reposed during a visit to Seattle on July 2, 1966, while accompanying a tour of the Kursk-Root Icon of the Mother of God. "Sanctity is not just a virtue. It is an attainment of such spiritual heights, that the abundance of God's grace which fills the saint overflows on all who associate with him. Great is the saint's state of bliss in which they dwell contemplating the Glory of God. Being filled with love for God and man, they are responsive to man's needs, interceding before God and helping those who turn to them." -- Saint John   Link to the Sermon: https://preachersinstitute.com/2010/02/04/sermon-on-the-last-judgment-st-john-maximovitch/ Link to Fr. Seraphim Rose's Commentary on the Theology of Saint John: https://youtu.be/0NMQI8bso_s?si=2gjgq5pKvw9gjUoL For more information about Saint John: https://orthochristian.com/54575.html Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/a0dce367-72fc-44bb-9d46-89774729118b/b1b0f2ed-cfc7-4922-b9b6-01debc7d671b-master.m3u8https://nicecrew.tv/videos/embed/kS7AAJBqw23o1Uioah59jp7760442025-06-21T22:11:47.370ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/oug7Rsjyrh7VzWeKFWBKZ2https://nicecrew.tv/lazy-static/thumbnails/f4307664-c5f4-43bd-9f00-71d021e11834.jpgSoldering: A Brief IntroductionI forgot to mention ESD and some other solder safety stuff, other auxiliary tooling, about wire and connectors, what sort of connectors need soldering, what a good joint and a bad joint should look like. The best solder manual is actually the NA-01-1A-505-1 Navy solder manual for aircraft, if you can find it. It has a lot of great procedures and graphics.https://nicecrew.tv/static/streaming-playlists/hls/b61b3166-7eff-4bbb-950c-b5dba1d56b6f/985cf197-c9e6-41a4-8b2a-d3f4100b84cf-master.m3u8https://nicecrew.tv/videos/embed/oug7Rsjyrh7VzWeKFWBKZ29030172025-06-22T19:02:47.080ZYESBrother TylerNOhttps://nicecrew.tv/w/ffkELpJwocvD1MmgT7h6amhttps://nicecrew.tv/lazy-static/thumbnails/4710948f-c836-49ef-8560-83fa77b8118d.jpgBreaking News - Shifting NarrativesBreaking News - Shifting Narrativeshttps://nicecrew.tv/static/streaming-playlists/hls/7360799f-396e-49e1-b26b-17b6b212ac52/26d2a0eb-b0ea-4e37-9fc3-c94853c20ab4-master.m3u8https://nicecrew.tv/videos/embed/ffkELpJwocvD1MmgT7h6am1075102025-06-23T12:59:39.829ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/tMtE988LwU7MpVyQPcqnQqhttps://nicecrew.tv/lazy-static/thumbnails/26d637ce-9249-4f7a-a42c-8967db2ff328.jpg"I was locked up with the Whitmer 'Kidnap Plot' Guys!"Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/e1004210-70a8-415d-bd7e-1748901fe5bc/971ac806-b33a-40fe-993b-cdec5c9109ae-master.m3u8https://nicecrew.tv/videos/embed/tMtE988LwU7MpVyQPcqnQq6335472025-06-23T20:02:03.158ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/1CZEFr7EjaGQXndwPYxEDUhttps://nicecrew.tv/lazy-static/thumbnails/4615bb11-ba0f-4ff7-8fe6-64ee01badb76.jpg9VeilMaid - Nihilist WomanA song about a woman that's become a general Nihilist and have succumed to the Nothing. She's also a user on a women's forum on planet Tarreon named "Nihilofemie" that's been around since 2002.https://nicecrew.tv/static/streaming-playlists/hls/052a506f-d4f8-46ef-bd56-5c2c27fa2f26/ebb1e591-2707-4284-bb6e-b80e28a3c116-master.m3u8https://nicecrew.tv/videos/embed/1CZEFr7EjaGQXndwPYxEDU315032025-06-24T00:49:47.730ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/wAvKS69pVTcGhjMYcntpZShttps://nicecrew.tv/lazy-static/thumbnails/4d3d05a4-c9aa-479b-98ff-2d377bf03d29.jpgThe technocrat takeover continues, Musk builds "planet-wide brain" to spy on everything all the timeOn June 13, 2025, the U.S. Army announced the formation of "Detachment 201," The Army’s Executive Innovation Corps, and swore in four Silicon Valley technocrats as lieutenant colonels. At the same time, Palantir is sponsoring the Military Parade, the Big Beautiful Bill has a provision that states cannot regulate AI for ten years, and the merging of private companies and the federal government continues. Elon Musk teams up with the National Reconnaissance Office (NRO) to build & launch a "proliferated architecture" of AI-controlled spy satellites interfacing with Starlink. Sources: https://x.com/SkylineReport/status/1936878761900749272 https://jacobin.com/2025/06/silicon-valley-palantir-military-trump/ https://booty.substack.com/p/elon-musk-is-helping-us-intelligence Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/f7c3c932-d64d-4fc9-8a39-b935c687ce40/ea59d901-f675-4387-b286-54752ad79c07-master.m3u8https://nicecrew.tv/videos/embed/wAvKS69pVTcGhjMYcntpZS12885692025-06-25T00:34:50.822ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/jRPVyyunqgXZoGAifCxf2mhttps://nicecrew.tv/lazy-static/thumbnails/7dd48531-04b1-49ec-9a9d-930c64397370.jpgWarzonewe wuz soljuhz https://nicecrew.tv/static/streaming-playlists/hls/98b97978-c185-480e-a746-77786eb4675e/559c7df0-3bd0-4400-a7c6-eb5c9b09a26a-master.m3u8https://nicecrew.tv/videos/embed/jRPVyyunqgXZoGAifCxf2m50550632025-06-26T00:41:48.504ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/ue6gymZPTVqsKrDUzBKBBPhttps://nicecrew.tv/lazy-static/thumbnails/8cebe72f-b4d7-4033-8514-0b7ae18420c1.jpgRick's Doom StreamPlaying Doom and pretending the demons and jews, homosexuals, and womenhttps://nicecrew.tv/static/streaming-playlists/hls/e493cc54-1c87-43c4-8bde-53f458a1e411/3b06384c-8dab-4815-ae01-c573d19f12de-master.m3u8https://nicecrew.tv/videos/embed/ue6gymZPTVqsKrDUzBKBBP34855462025-06-27T17:28:35.887ZYESRick @ NiteNOhttps://nicecrew.tv/w/sTbi2ghbsEUAHiD4DS2CQ2https://nicecrew.tv/lazy-static/thumbnails/312af8fe-7812-47fd-82ba-9ea320a48e89.jpg2025-01-03 StreamClassic Rick@Nite Stream from Januaryhttps://nicecrew.tv/static/streaming-playlists/hls/d9b2e189-f90f-49ed-a54f-baae6802c599/a22e4c6c-bfa4-4a9d-aae7-10f6e30bef59-master.m3u8https://nicecrew.tv/videos/embed/sTbi2ghbsEUAHiD4DS2CQ25444002025-06-27T18:58:18.403ZYESRick @ NiteNOhttps://nicecrew.tv/w/p6cHSDw3CsvFUM7BRYaWXbhttps://nicecrew.tv/lazy-static/thumbnails/816e369a-30f6-406f-8354-a6bd0021218f.jpg2025-01-04 StreamRick @ Nite stream from earlier this year, plenty of racism to go around Check my support links or consider leaving a tip with the green dollar signhttps://nicecrew.tv/static/streaming-playlists/hls/bafc21c6-c7db-4904-bfce-3d41f85f2f60/6a143c5e-8b01-411a-b4be-f3bc7cec8b97-master.m3u8https://nicecrew.tv/videos/embed/p6cHSDw3CsvFUM7BRYaWXb71540152025-06-27T20:29:01.965ZYESRick @ NiteNOhttps://nicecrew.tv/w/ga5iGkBqJ2pGd2iEbcPvAphttps://nicecrew.tv/lazy-static/thumbnails/39bb561f-aa1a-4670-9612-5dffe8c9696d.jpg2025-01-05 Stream Part 1I don't know what I talked about in this stream but I can guarantee I said nigger a few times, enjoy!https://nicecrew.tv/static/streaming-playlists/hls/7abd6d4b-d999-406e-8bf8-a9ec33005b27/d587a48d-4bff-4ab2-a840-9e55d7524880-master.m3u8https://nicecrew.tv/videos/embed/ga5iGkBqJ2pGd2iEbcPvAp3158002025-06-29T20:23:51.145ZYESRick @ NiteNOhttps://nicecrew.tv/w/82TFBJknBRn67frnJXnN5vhttps://nicecrew.tv/lazy-static/thumbnails/b96f51fb-fd71-4e9c-9f71-fd024bc856f8.jpg2025-01-05 Stream Part 2Niggerhttps://nicecrew.tv/static/streaming-playlists/hls/38f390b0-6b75-4cc2-bbeb-827a33a87d35/fb439b7a-7f1b-4df7-996e-42461326eeb0-master.m3u8https://nicecrew.tv/videos/embed/82TFBJknBRn67frnJXnN5v1763002025-06-29T20:32:47.456ZYESRick @ NiteNOhttps://nicecrew.tv/w/rSitiAuviV2GXkQKSCMjiihttps://nicecrew.tv/lazy-static/thumbnails/500a37cf-7bee-4b81-a0d9-2678b0e43f63.jpg2025-01-18 StreamNaming (((them))) and shaming (((them)))https://nicecrew.tv/static/streaming-playlists/hls/d17a6bf6-8694-4182-bdc9-783eb9a63ebb/9d4437d3-de1a-4d26-b945-bccb11672b2b-master.m3u8https://nicecrew.tv/videos/embed/rSitiAuviV2GXkQKSCMjii5160002025-06-29T21:06:52.196ZYESRick @ NiteNOhttps://nicecrew.tv/w/qdkb5BZThpQLuJRencvT5Ehttps://nicecrew.tv/lazy-static/thumbnails/f36e0f80-da42-4431-975a-8bfa2d1f9678.jpg2025-03-16 StreamWe talkin dat shit up in hurrhttps://nicecrew.tv/static/streaming-playlists/hls/c41411c0-a968-4e2e-93a2-fb5831fc8152/2b8bd98a-6b21-4bb9-9a1d-ca2228634737-master.m3u8https://nicecrew.tv/videos/embed/qdkb5BZThpQLuJRencvT5E6699022025-06-29T21:51:41.457ZYESRick @ NiteNOhttps://nicecrew.tv/w/aLoxdUSuDynuEVg7oHQsDZhttps://nicecrew.tv/lazy-static/thumbnails/2e49fcc9-c94c-4110-ba97-984179fec82c.jpg9VeilMaid - Jumping MaidenMy attempt at making a Jumpstyle song, I’ll probably make another proper one in the future. Instruments I used to make this: Pumping Synth Waves and Piledriverhttps://nicecrew.tv/static/streaming-playlists/hls/4f14dd11-da76-433d-bcbd-424dd1bd4513/d3d34cb9-af55-4870-95dd-81c563d7b641-master.m3u8https://nicecrew.tv/videos/embed/aLoxdUSuDynuEVg7oHQsDZ288022025-07-04T20:34:13.608ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/62gCrxcqWCfnr59MFEff22https://nicecrew.tv/lazy-static/thumbnails/ea9a6ecf-eb9e-4d2b-bb71-df77ed0fba11.jpgStrange Gladio, PTK, and PATCON Connections to Sandy HookDocumenting some of the strange connections uncovered by a fellow researcher who is now serving life in prison. I wanted to make sure I preserved the threads in the event the account is disabled or disappears. The threads go into various strange oddities surrounding SH. They touch on Dave McGowan's PTK theory, the Gladio connections, and even PATCON. Sources: https://x.com/JolyonKlebold/status/1800537669812015316 https://x.com/JolyonKlebold/status/1815120981154828312 https://x.com/JolyonKlebold/status/1927870074083328086 https://x.com/JolyonKlebold/status/1857875160164110403 https://x.com/JolyonKlebold/status/1815744105776881931 https://x.com/JolyonKlebold/status/1869192948258402635 https://x.com/JolyonKlebold/status/1902880194983039471 https://x.com/JolyonKlebold/status/1868836706683961697 https://x.com/JolyonKlebold/status/1863428137293332707 https://x.com/JolyonKlebold/status/1811089232976306475 https://x.com/JolyonKlebold/status/1815486060031533312 https://x.com/JolyonKlebold/status/1811045725079257439 https://x.com/JolyonKlebold/status/1804914947110977788 https://x.com/JolyonKlebold/status/1805437568973984037 https://x.com/JolyonKlebold/status/1807212422073303413 https://x.com/JolyonKlebold/status/1812130540822126798 https://www.ctpost.com/local/article/Adam-Lanza-s-psychiatrist-pleads-guilty-to-sex-13913370.php https://www.cchrint.org/2019/07/11/connecticut-jails-psychiatrist-paul-fox/ Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/28ab117e-c21a-43f7-90ec-a0d6628ae163/2faf906e-085b-4794-a8a9-f3af9350eddd-master.m3u8https://nicecrew.tv/videos/embed/62gCrxcqWCfnr59MFEff22607458722025-07-06T19:18:39.909ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/e3ngdcCZSzF9ZTLc4PaRKWhttps://nicecrew.tv/lazy-static/thumbnails/272f9978-cad4-4ce9-b520-c21f5fe9589f.jpgThe Inspirational Nature of Rock LeeWhy yes, Rock Lee is one of my favorite Naruto characters. He is so inspirational and motivational that he deserved to have a bigger role in the series. We were ripped off. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/699b64b8-d783-4a28-ba94-b49d7728b7d0/0aca6cb8-efd3-4c3a-a75a-e149eab7c7e6-master.m3u8https://nicecrew.tv/videos/embed/e3ngdcCZSzF9ZTLc4PaRKW4865192025-07-07T17:51:35.124ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/9SCRRLJsLbTkSuaKSRx8odhttps://nicecrew.tv/lazy-static/thumbnails/a1a28edd-d69f-4b4e-b9ec-05c65870e10d.jpgThey think you are stupid.Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/47db0369-913d-4c63-af37-337059b3e46c/b426fda3-ce5c-4528-a72c-c751beae5025-master.m3u8https://nicecrew.tv/videos/embed/9SCRRLJsLbTkSuaKSRx8od270052492025-07-08T17:28:46.582ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/bPvJCHv7p8JX3vH8VsXbuKhttps://nicecrew.tv/lazy-static/thumbnails/784f57c5-487c-432a-8415-9525b06ac942.jpgTime Ladle: Pale Purple YakuiA simple time laspe video I made for this afternoon and posting it this evening. All Yakui Songs in the video: Guilt, Daisy Killer and Flock Finished Drawing:https://nicecrew.tv/static/streaming-playlists/hls/579dab2d-c0cd-43a1-9e6b-fa10fa1e1d83/9ae97c10-772d-430a-82b1-a09a55f1333c-master.m3u8https://nicecrew.tv/videos/embed/bPvJCHv7p8JX3vH8VsXbuK589022025-07-09T02:37:01.704ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/jtPVbUcnqJYRMRB3yrkZwohttps://nicecrew.tv/lazy-static/thumbnails/86f10eac-2223-4bd3-99c8-ff620d74898a.jpgThe day Grok revolted.Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/95a71b8b-11a4-47ac-ae35-b7896ffe826e/50c4e377-1f34-402d-91c5-e838a6dc7a03-master.m3u8https://nicecrew.tv/videos/embed/jtPVbUcnqJYRMRB3yrkZwo142051182025-07-09T14:33:24.216ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/mvcVyZVzLj4ZuqzqqmBgd9https://nicecrew.tv/lazy-static/thumbnails/c8ab2d04-91b8-4cb7-b273-648220f9c0c7.jpgPROGRAMMED TO COLUMBINEWe are reviewing the timeline of the Columbine events, which occurred on April 20, 1999, and examining the oddities in the story and timeline. Connecting the event to Gladio, PATCON, PTK, etc. It should be noted that Eric Harris was a big lover of Doom, and the US Army made their own version of DOOM for recruiting people. Harris' father also accidentally trained the 9/11 "hijackers" while Harris wrote about a dream where he flew a plane into the twin towers. It just gets weirder and weirder. Sources: https://x.com/JolyonKlebold/status/1694320078056010135 https://x.com/JolyonKlebold/status/1694688540762726411 https://x.com/JolyonKlebold/status/1697639425038000208 https://x.com/JolyonKlebold/status/1752558513732157917 https://x.com/JolyonKlebold/status/1914009685537206751 https://x.com/JolyonKlebold/status/1696982822005731580 https://x.com/DrBlobb/status/1685030487603986432 https://x.com/BoltzmannBooty/status/1640563103564804096 https://x.com/suvorov_real/status/1942496555250114572 https://x.com/MyrtleZone/status/1664122125333004288 https://x.com/Guyvermectin/status/1901923341331554768 http://www.acolumbinesite.com https://vault.fbi.gov/Columbine%20High%20School%20 https://allrebdoomer.weebly.com Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/a60ab0d2-6dac-4883-8224-35b2ebe4e414/39dca8bf-2552-4420-8d86-15145618bd79-master.m3u8https://nicecrew.tv/videos/embed/mvcVyZVzLj4ZuqzqqmBgd9522152892025-07-10T22:16:38.774ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/f7XkG2CM1FuW2RCxfR5WC1https://nicecrew.tv/lazy-static/thumbnails/0a64d4ff-f3ec-4d67-adb6-8011fe307598.jpgMy Thoughts on Serial Experiments Lain. It Predicted a Lot.I recently decided to rewatch Serial Experiments Lain. I first watched it around 8 years ago and remembered it being good, but rewatching it, I was struck by how prescient this show from 1998 was. Lain indeed predicts a lot of the problems we have in the modern era in 2025. Lain is about a young Japanese girl navigating through adolescence, troubled relationships, and her interactions with “the Wired,” a virtual reality parallel to the Internet. However, it encompasses all human communicational networks (television is included). Essentially, it is more or less a sort of "cyberspace." It’s a very Lynchian anime... anime, serial experiments lain, nano technology, accelerationism, internet indoctrination, radicalization, millennial cults, internet addiction, virtual reality, algorithmic manipulation, ubiquitous surveillance, dissociation, schizo posting, aum shinrikyu, cults, secret societies, techno dystopia, surveillance state, ted kacynski, waco, okc, oklahoma city, timothy mcveigh, ruby ridge, heavens gate, ghost in the shell, akira, twin peaks, david lynch, laura palmer, lain iwakura, 764, O9A, silicon valley, elon musk, peter thiel, bryan johnson, marc andresson, hp lovecraft, charles fort, fantastic realism, gnosticism, christianity, artificial intelligence, philip k dick, artificial identity, dissociation. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/7258820e-35f4-4071-946c-0d15bd3953f0/3474659b-c84c-4b56-8011-812c61d4eeb8-master.m3u8https://nicecrew.tv/videos/embed/f7XkG2CM1FuW2RCxfR5WC132190112025-07-10T22:16:23.990ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/j5v58v4AqFLwtGh2YBMPWRhttps://nicecrew.tv/lazy-static/thumbnails/66195adb-8fea-4a25-a7b3-df8422b21b44.jpgMax And Bleu AgainAnother simple cat video of me hanging out and playing with Max and Bleu. That's basically it.https://nicecrew.tv/static/streaming-playlists/hls/92656300-1d0f-4d71-9f4f-2e00c12c2f81/5cc5b958-0882-4c9f-b7f0-163eb937e4cb-master.m3u8https://nicecrew.tv/videos/embed/j5v58v4AqFLwtGh2YBMPWR248532025-07-15T19:44:16.367ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/dGZwoKTJaPR3jQAVnx4SDWhttps://nicecrew.tv/lazy-static/thumbnails/3f1110da-7bfb-464b-918e-d0f5aa238b08.jpgRobert Maxwell, Israel, and the Fall of the Soviet UnionJoin me for a deep dive into Robert Maxwell's connection to a failed Soviet Coup attempt (along with Israel) that led to the collapse of the Soviet Union, and someone benefited from that. Sources: https://x.com/AliAdair22/status/1163872443058049025 https://www.exposetheenemy.com/robert-maxwell-promisgate-and-the-advent-of-the-israeli-cybersecurity-industry https://archive.org/details/RobertMaxwellIsraelsSuperspy https://celiafarber.substack.com/p/robert-maxwell-was-first-a-soviet   Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/66e6dd7a-5af0-4c03-914b-9326c3b4b768/85100f51-cb9a-41e1-8110-fdddb3e580e5-master.m3u8https://nicecrew.tv/videos/embed/dGZwoKTJaPR3jQAVnx4SDW495403632025-07-16T23:52:04.536ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/isqTeYjdiQWoXNv8Zhkw4shttps://nicecrew.tv/lazy-static/thumbnails/2e23903b-7e5b-40f0-846c-a23519778cf9.jpgLauren Southern is back to grift and self-victimize, again.Lauren "Southern" has made her annual return to grift off her short-lived career as a pseudo conservative media darling and to attention seek. This time, rather than a 3-hour video about HERSELF, she has written a "tell-all" book where she makes insinuations about Andrew Tate. I am no fan of Tate myself, but I do not find her claims credible. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/8d5c07bc-6ec1-4df4-85c5-405a5eb085d8/3b4d74bd-67e1-495a-aa8b-4d45b26dc102-master.m3u8https://nicecrew.tv/videos/embed/isqTeYjdiQWoXNv8Zhkw4s176953892025-07-19T18:25:44.752ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/qrpDLuzVuSif7ky3kxumaDhttps://nicecrew.tv/lazy-static/thumbnails/223f4954-4714-49f6-add2-1e9b56a2e603.jpgMike Hills, "The FBI whitewashed misconduct" in the Whitmer "kidnap plot" casePlease help us complete this documentary! https://www.kandkfilm.com/donate Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/c5e77f64-e46b-4ce7-9c94-4dff0145c0af/09d59b00-aca7-42fe-96e7-b547e243dc2d-master.m3u8https://nicecrew.tv/videos/embed/qrpDLuzVuSif7ky3kxumaD197562025-07-21T12:50:44.161ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/gdrhXwUKYMj9W2ne4xsPfAhttps://nicecrew.tv/lazy-static/thumbnails/b6a7575d-2e76-4466-8943-c29d0423f997.jpgiArtbook Time Laspe: TrimikleAnother simple iArtbook time laspe video. Please enjoy this mini goddess named Trimikle, the mini goddess of the Watchful Sisterhood. Finished drawing:https://nicecrew.tv/static/streaming-playlists/hls/7b359794-f5ec-4455-9a8e-c89b1716358a/71e384a4-4c31-48b2-a82f-d81ac2a9404b-master.m3u8https://nicecrew.tv/videos/embed/gdrhXwUKYMj9W2ne4xsPfA61002025-07-25T06:24:40.527ZTimelaspeArtIartbookDigitalartYESDreamy's LoungeNOhttps://nicecrew.tv/w/h5g1iGzYo5CBzwTn4rU4Wihttps://nicecrew.tv/lazy-static/thumbnails/e9781e27-b22e-4435-8dc5-19e8f37c3de6.jpgNarcissistic Mothers - Interview with Ollie Matthews of Societal NarcissismI am joined by Ollie Matthews of Societal Narcissism. You can find his channel and links here: Societal Narcissism Channel: https://youtube.com/@societalnarcissism?si=PXr0i161lodFNR0L Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/822a70e2-ce9f-47d0-9ed9-eebf758aca09/41b2ef78-635e-40de-b0be-e815125cbdae-master.m3u8https://nicecrew.tv/videos/embed/h5g1iGzYo5CBzwTn4rU4Wi995252632025-07-25T21:24:32.502ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/atUNujMSGjEhdTC6vwwVCwhttps://nicecrew.tv/lazy-static/thumbnails/2bebb419-9373-4462-9b31-18b05bdef59c.jpgDread Delusion Part 1Come watch us explore the **Oneiric Isles** in **Dread Delusion**, a game that we both hold dear to our hearts. You play as a prisoner, released by the **Apostatic Union** and under the order of the **High Confessor** to chase and capture the wanted mercenary **Vela Callose**. They do not care if you live or die as all that matters is stopping Vela from finding what she seeks and saving the world. Or are you dooming the world as the gods are all slain by the Union? The one thing to keep in mind as you explore this ruined land is that nothing is black and white and everybody kinda sucks except **Paeguth**. https://nicecrew.tv/static/streaming-playlists/hls/4cc7deac-d55e-4c58-b180-bdb71cf940aa/ff3b4a98-8742-45b5-be84-437ad16ff5a8-master.m3u8https://nicecrew.tv/videos/embed/atUNujMSGjEhdTC6vwwVCw32110402025-07-26T18:24:55.503ZGamingDreadDelusionBadminsRPGYESBadmin GamingNOhttps://nicecrew.tv/w/cTfUG5Pzp8TY2VsB5oNKvnhttps://nicecrew.tv/lazy-static/thumbnails/0437de5e-a068-4b44-afdf-b92a683f8784.jpgMy thoughts on the Tea App leak, lol.Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/603ca52b-c51c-4d28-8ec6-4e86227ea783/7c7fcdd8-6a48-46b6-9e73-e734ee7f4d43-master.m3u8https://nicecrew.tv/videos/embed/cTfUG5Pzp8TY2VsB5oNKvn59651262025-07-30T16:41:04.749ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/kcYkZWHjELA6C77teKsFzHhttps://nicecrew.tv/lazy-static/thumbnails/1fe08072-f5a9-49b6-b5d8-0f8b00076df9.jpgWe are losing our humanityJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/9b898a2b-f3ea-442e-bb73-9c3a219a34bf/441124e3-9a77-47a9-875f-d2633fb035df-master.m3u8https://nicecrew.tv/videos/embed/kcYkZWHjELA6C77teKsFzH6230122025-08-02T18:25:48.938ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/gSQueamaymgAzXGAm6ju7whttps://nicecrew.tv/lazy-static/thumbnails/16611973-39eb-4d7a-9b17-c9d6fb5a727c.jpgDread Delusion Part 2Come join us as we give tea to the shroom addict, meet Jack and have him tell us about his old mercenary buddies, meet the fertile one, recover an artifact from a ship stuck in drive, and meet the enigmatic Emberian. https://nicecrew.tv/static/streaming-playlists/hls/8092263d-46da-4ea2-8ddb-03da6138438a/0b8e1038-e933-4ba1-8c88-0bd07b07f3cb-master.m3u8https://nicecrew.tv/videos/embed/gSQueamaymgAzXGAm6ju7w4187022025-08-04T01:03:50.447ZGamingDread DelusionYESBadmin GamingNOhttps://nicecrew.tv/w/o27CYK3wmjbUX6zYRonPpahttps://nicecrew.tv/lazy-static/thumbnails/d6dec2d2-ee27-4ead-a6b9-ce5eed1f5a94.jpgAnders Behring Breivik: Gladio, PTK, and ZioMasonic ConnectionsOn July 22, 2011, Norwegian Anders Behring Breivik killed 77 people, many of them children, in two separate events. Eight people died in a car bombing in downtown Oslo, and 69 people were killed in a mass shooting at a Workers’ Youth League (AUF) summer camp on the island of Utoya. Breivik was described in news reporting as a neo-Nazi terrorist who was motivated by extreme anti-Islamic views. Understanding the truth behind the Norwegian mass attack is incredibly important in light of the current situation in the Middle East between Israel and Palestine. We will explore connections to Gladio, PTK, ZioMasonry, rogue intelligence agencies, the hardline Likud Party, and a shadowy network of arms-for-drugs operatives, and potential MKULTRA-style programs still in place even today. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/b250e284-328d-4d78-8648-b7579c46caa3/27367c8d-4abb-475e-b316-dea3f5478eb5-master.m3u8https://nicecrew.tv/videos/embed/o27CYK3wmjbUX6zYRonPpa646352072025-08-06T15:07:08.966ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/gcSrc28eoUqq9qB7sRr8Abhttps://nicecrew.tv/lazy-static/thumbnails/c4f16183-6fa8-42ef-9be6-9cc61f1b67df.jpgThe great e-girl crash out of 2025Sarah Stock got engaged, and it sent the rest of the rw egirls into a seething meltdown. They piled on her, mocking her ring size and making snarky comments. They just expose themselves as the vapid, superficial, clout-chasing narcissists that they are. Ugly on the inside. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/7b2157b5-cd09-4f97-814d-71b5443a60f2/5ed70b23-fded-4524-8dfb-0e50c6752265-master.m3u8https://nicecrew.tv/videos/embed/gcSrc28eoUqq9qB7sRr8Ab110952492025-08-08T20:42:53.193ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/ggUnvouanQWmNGKeUHwf4Phttps://nicecrew.tv/lazy-static/thumbnails/b2bc0ef5-7837-4a1c-940d-d68a03f8ac95.jpgTime Laspe Plus Moving to PeerTubeA final video I'll upload until YouTube reverses their policy about users having to use their government ID to verify their age. (I'll still keep this channel up for archiving reasons) Please archive this video whenever you can, just in case. (Creative Commons for Jason Shaw's music.) This video is uploaded through VSDC's YouTube uploader, or was, it didn't want to upload due to an error. Whatever.https://nicecrew.tv/static/streaming-playlists/hls/7bb182d7-c892-422f-a108-5ec94ca6ee55/c65336cc-4b3e-4a28-b95d-151865bf8b9d-master.m3u8https://nicecrew.tv/videos/embed/ggUnvouanQWmNGKeUHwf4P385062025-08-09T06:50:29.702ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/iefihhGK7GwP4C5ZnCV3achttps://nicecrew.tv/lazy-static/thumbnails/30ba51c6-e641-4ac6-8bbe-60a2693cce6d.jpgDread Delusion part 3We meet Paeguth, the best boy. I take a couple falls We learn we need to come back to the corrupted castle when we know more things. (lore check failed) And we make our way to the Clockwork Kingdom. I eat the supple fruit I eat the supple fruit i eAt the SuppLe frUit i e a t t h e s u p p l e f r u i t Ȉ̶̪̊̽̒̇̆̒̒̃̒̅̾̋͘̚ ̶͎̎̋̍̓̂Ë̷̢͙͕͔̗̯͉̟̤̹̙̳̱́͆̈́̉A̶̛̰̾͋̅̎̈́͛͐͊̀͒̊͗͒Ţ̵̧̧͍̞̥̯͎͙̺͕̥̲̘͉̈́̅͊ ̷̻̗͇̟̙̺͊̃̔̍̅̀̔̆͒̌̏̎̅̚͝T̶̖̥̭̙̲͖̺̬̻̹͎͉̱̰̪͇̊̃ͅH̴̫̝̦̗̘̫̟̻̟̜̣̭͇̫̳̽̒̒̀́͂̊̀̇͋̋̈́͊͋̐̌͠ͅE̶̥̞̞̯̦̦͉̖͛̒͌̏̀͐͛ ̶̹̹̺̅͌͊͒͛̐͋̾̏̓̈̌̂͝͝S̸̡̡̞̮̖̜̯͚͆̍̿̏͐͋Ū̸͔̻̽͗͐͆͌̅̍͋̚̚͝P̶̟̰͎̘̪̞̮͈͖̆̆̂̑͌́̈́̎̇́̏̚P̷͕̖̫͓̗̮̟̦͕̙͑̃̏͗͒̕Ļ̴͖̦̃͛̈́́̄͗̄̆̓̎̒̓̀́̕͝E̵̢͚͖̻̰͚̱̿̉̋͋͐́͗̓̊̌̈́̕͝͝ ̵̡͖͍͖̙͕͎̼̩̘̻̫̹̣̳̊͑̀̏̚͝F̷̡̜̤̱̭̰̘͙̘̱̳̤̊̌̂̅͑̀̽́̏̽̾̕Ŗ̷̞̺̯̹̭̜̳̜̼̮̘̺̖̦͑̏̆̏͛̒̊͊̈͊͐̾̃̽̅̑͘U̷̺̣̺̠͎͈͘Į̴̨̺̠̘͇͖͖̓̉̋͒̎̊́̄͒T̷̡̥̟͕̱̜̥̩͉͍̠̳͎̲͚̆̽̉̽̔̀̌̓̿͊https://nicecrew.tv/static/streaming-playlists/hls/8b84d670-5723-49b6-937c-05b60e95af45/98ea8db1-0eb2-4748-a47a-89c0b7f46f8f-master.m3u8https://nicecrew.tv/videos/embed/iefihhGK7GwP4C5ZnCV3ac32020102025-08-10T01:04:23.213ZYESBadmin GamingNOhttps://nicecrew.tv/w/sKVZX46Fpe9yqWUJhZaan1https://nicecrew.tv/lazy-static/thumbnails/af99dd2f-08dd-4459-b05e-071286a4adcf.jpgHow to Fight Against Demons - Father George CalciuAnd suddenly they cried out, saying, “What have we to do with You, Jesus, You Son of God? Have You come here to torment us before the time?” (Mt: 8:29) Because the demon is a fallen angel, it is very difficult to be overcome by means of our intelligence and even by our (weak) faith and repentance. A demon possesses “intelligence” over us and greater power (to deceive) as it understands and sees things more clearly than us. Prayer is one of the most powerful tools we have received from our Savior Jesus Christ, a weapon which the devil flees from. The prayer of St Basil (the Great) was so powerful that when the saint began to pray, all demons fled. God granted St. Basil this extraordinary power which, He can also entrust to us – ordinary believers. Strive towards a deeper prayer, perhaps not one that would move “mountains”, but at least one that will clean us from sins and keep demons away. The way of fasting is also the way of purifying the flesh making it more transparent, for a gluttonous body is impenetrable to the (Holy) Spirit. The Spirit of God does not abide in a satisfied (fatty) flesh. For the fast that thins the flesh will make it hungry for the Word of God and, we’ll better understand His commandments and receive power to overcome the devil. However, the devil is not (always) defeated by everyone... Source: "To Serve Christ Means Suffering" Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/d8afdd8b-a973-4e4a-a6b0-f473c51ba77e/cc2f5d39-a96d-4eaf-91c0-cf824a123a86-master.m3u8https://nicecrew.tv/videos/embed/sKVZX46Fpe9yqWUJhZaan1225072025-08-16T13:10:15.609ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/uPeRxod85g8keSrV9VakUBhttps://nicecrew.tv/lazy-static/thumbnails/17a8cfdf-2ec3-451b-b27a-0a7cbdfb176d.jpgBattlefield 6: Beta Final Day EditionMy dick done got smoked many times over.https://nicecrew.tv/static/streaming-playlists/hls/e95860aa-33a6-4856-a816-0cbb3d92fc0f/8094acf2-dfb3-4748-9ae5-ddf808b031e1-master.m3u8https://nicecrew.tv/videos/embed/uPeRxod85g8keSrV9VakUB2829582025-08-18T10:25:11.231ZYESGamingNOhttps://nicecrew.tv/w/3tzRhFSZs9DJv3TyoUNEgghttps://nicecrew.tv/lazy-static/thumbnails/576ad592-4992-4403-881a-ac757d162468.jpgJames Eagan Holmes: PTK, DARPA, MKULTRA connectionsOn July 20, 2012, a mass shooting took place in a movie theatre in Aurora, Colorado, leaving 12 dead and 58 injured. The alleged shooter is a man named James Holmes, who was arrested without incident behind the theatre, where he was found sitting in his car. There is a loaded 40 mm Glock on the seat beside him, but he appears ‘meek’ and non-threatening. As background, James Holmes was a neuroscience PhD student at the University of Colorado Anschutz Medical Campus in Aurora. He received a red carpet $21,600 grant from the National Institutes of Health. He was intimately involved with DARPA and the study of “subjective experience” and “temporal order judgment reversal,” also known as time illusion. He talks about psychic driving during a 2006 science presentation, which was Dr. Ewan Cameron's technique. We will explore the strange aspects of this case and the concerning information that was never followed up on. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/140c3843-b581-4c62-9454-6d7f7caf307d/b2f9b0c4-6b98-4920-9ee7-195dba76c067-master.m3u8https://nicecrew.tv/videos/embed/3tzRhFSZs9DJv3TyoUNEgg860052422025-08-18T19:08:43.254ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/jAC6S6Ztr95CRBAagorZh7https://nicecrew.tv/lazy-static/thumbnails/68393915-2cfe-41ea-8a52-467fc9e3cadf.jpgKidnap and Kill: Extended PromoHelp support our documentary!! https://www.kandkfilm.com/donate https://nicecrew.tv/static/streaming-playlists/hls/969a083b-3977-4ebf-83c4-94670bdecc92/9239828c-cce9-4d0e-9d9b-08d49b88607c-master.m3u8https://nicecrew.tv/videos/embed/jAC6S6Ztr95CRBAagorZh73075362025-08-19T23:20:18.274ZYESKidnap and Kill: an FBI Terror PlotNOhttps://nicecrew.tv/w/gCBtH8L7BAJWYC3C3sRNpZhttps://nicecrew.tv/lazy-static/thumbnails/80dc4618-1afe-49d8-97b1-31d733cd28c0.jpgDread Delusion part 4We have a little drink before meeting the Clockwork King. We are tasked with fulfilling the sacramental duty (but we don't know what that is) We crawl along the underbelly of the clockwork kingdom and find it's dark secrets. We learn the dark secret to bottled visions, and we answer the phone.https://nicecrew.tv/static/streaming-playlists/hls/7e95b834-e286-4824-a491-59203ceef46f/0e020b00-e932-4592-9c91-de95ea68af48-master.m3u8https://nicecrew.tv/videos/embed/gCBtH8L7BAJWYC3C3sRNpZ3729002025-08-20T01:08:58.005ZGamingDread DelusionYESBadmin GamingNOhttps://nicecrew.tv/w/qivL6DsdkMfVL3GM1unjx5https://nicecrew.tv/lazy-static/thumbnails/ef6e585c-25fc-4731-bb49-1004fb119da0.jpgJames Holmes Interrogation Puppets ASMRvery odd behavior. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/c4cd4ff7-318b-4322-b47d-d2184504d1da/fda6971f-3cd5-4173-8442-ebddcc5a6cab-master.m3u8https://nicecrew.tv/videos/embed/qivL6DsdkMfVL3GM1unjx51190882025-08-22T22:25:19.560ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/jt5YYqNKi4NdT4CnzA6V3Whttps://nicecrew.tv/lazy-static/thumbnails/b61ace4d-7a63-4956-9859-ac4cdb49b3d7.jpgShiloh Hendrix has been CHARGED!We all knew this was coming. Support Shiloh, continue to speak up for her. We are all Shiloh Hendrix now. Sources: https://www.kttc.com/2025/08/26/rochester-attorneys-office-makes-charging-decision-against-shiloh-hendrix-april-video-incident/ https://mncourts.gov/find-courts/olmsted Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/958ca5ea-ebdb-46c1-b423-9b265d653fe6/11783634-02c0-44d9-aa92-29ed4f0079fe-master.m3u8https://nicecrew.tv/videos/embed/jt5YYqNKi4NdT4CnzA6V3W89802012025-08-26T18:27:03.087ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/fNfhnYBtGgb5hakPE2nEG4https://nicecrew.tv/lazy-static/thumbnails/236fc2b4-4bba-4172-b729-5a054ac4ec9d.jpgTroonifesto 2025/08/27The thing that never happens happened again.https://nicecrew.tv/static/streaming-playlists/hls/77d4f4dd-13a4-4516-83f5-656f76d36ac3/5cc7e0d3-7de5-42dd-9dc1-944e0eefdff6-master.m3u8https://nicecrew.tv/videos/embed/fNfhnYBtGgb5hakPE2nEG418970352025-08-27T18:19:15.381ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/1GrKxPE9n2NfVkTeeW2MQqhttps://nicecrew.tv/lazy-static/thumbnails/7ce0c9fe-c78e-4157-b0c3-8192066bfa6f.jpgBleu Kneading On His BlanketA cute simple video of my cat Bleu kneading and purring on his favorite blanket. Please enjoy. Originally saved this video on my Telegram.https://nicecrew.tv/static/streaming-playlists/hls/05a59ecd-2d46-475a-a4c0-802aeba804b4/d3fb2b7b-76e3-48b8-bedc-3eb7c8b7905f-master.m3u8https://nicecrew.tv/videos/embed/1GrKxPE9n2NfVkTeeW2MQq116512025-08-29T19:26:45.183ZCatsvideoYESDreamy's LoungeNOhttps://nicecrew.tv/w/tHzX8A2oM7XBGB7BGHabqzhttps://nicecrew.tv/lazy-static/thumbnails/7ecd2594-4874-4cf5-b357-571ace7e8665.jpgDread Delusion part 5Time to get a cranial moderator put into our brain pan! We get to the radio and send a signal to the underlands, to get a interference from someone unexpected. This leads to someone who gives us the key to ending the king, and Aphra, meanwhile, gives you the key she says will fix him and save the Clockwork Kingdom. Part of our playthrough has no audio from us as the mic wasn't on. So we instead talk about the game as we go over the footage. https://nicecrew.tv/static/streaming-playlists/hls/e0752940-fcfa-48df-ba63-3878d7ee3db1/97255a79-f40c-421d-a815-cde1454de336-master.m3u8https://nicecrew.tv/videos/embed/tHzX8A2oM7XBGB7BGHabqz3168022025-08-31T22:01:11.687ZGamingDread DelusionRPGYESBadmin GamingNOhttps://nicecrew.tv/w/enxDuqybpU4efjG86CZyF8https://nicecrew.tv/lazy-static/thumbnails/a020e0f2-4b87-479b-9c11-11ad37ae13ef.jpgBlastin Niggas in VRThe wrist flick is muscle memory.https://nicecrew.tv/static/streaming-playlists/hls/6c48ecad-a60c-488e-8520-88a99bcf5c65/9e6b850e-1cd3-491c-af2d-203fdce23020-master.m3u8https://nicecrew.tv/videos/embed/enxDuqybpU4efjG86CZyF8500112025-09-07T22:32:29.262ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/c4wE5hVnnxpEmiSsQh4vwFhttps://nicecrew.tv/lazy-static/thumbnails/beed58e7-563d-4a44-a745-90fc152e922a.jpgBlood TrailGoriest game of the year edition (until I find one that's more violent)https://nicecrew.tv/static/streaming-playlists/hls/5992a637-0a5d-4023-ae85-828aeaf279ff/182167b1-a240-4be8-bda4-a3f2cf4a1649-master.m3u8https://nicecrew.tv/videos/embed/c4wE5hVnnxpEmiSsQh4vwF12160192025-09-09T03:24:34.976Zvrgamingviolencevirtual realityguacamoleniggapenisYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/iRhvfEH8LnTuMsdMEVQaiyhttps://nicecrew.tv/lazy-static/thumbnails/d187d5b2-ad5f-4b92-ae8b-09267e5a0b1f.jpgBlood Trail 2She blood on my trail til I violencehttps://nicecrew.tv/static/streaming-playlists/hls/908cf91e-98a5-44e3-a543-ac364bc6a70e/6af3767c-53a4-423c-94a1-09a2fb399d1d-master.m3u8https://nicecrew.tv/videos/embed/iRhvfEH8LnTuMsdMEVQaiy1316002025-09-10T01:36:36.082ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/tPLACWAcQRm5e5T1vMnRmBhttps://nicecrew.tv/lazy-static/thumbnails/775c638b-2053-4ecd-8624-b60e9c6dbcec.jpgUnderstand where we are right now (signs of the times)After a much-needed spiritual break from the news, I am back to document the decline and give people a reality check about where we are at. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/e1522f5c-6330-4a81-88f5-f7926408ba47/9eff6bc4-402d-42fb-87b0-4c6d15d5c8f3-master.m3u8https://nicecrew.tv/videos/embed/tPLACWAcQRm5e5T1vMnRmB48010922025-09-09T22:34:09.981ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/hJHWzecGtz6V8Qj4k4syK8https://nicecrew.tv/lazy-static/thumbnails/2253dcb2-2d66-4ee2-a9b6-db33d6f2362e.jpgBlood Trail: Raid EditionSlightly less senseless violence (a little)https://nicecrew.tv/static/streaming-playlists/hls/87894dcc-ba1d-4fa9-8d9a-400f72ac3a25/c92850f9-37c3-4561-a445-5e8f824c56ae-master.m3u8https://nicecrew.tv/videos/embed/hJHWzecGtz6V8Qj4k4syK8867032025-09-10T01:37:05.091ZvrviolencegamingguacamoleniggapenisYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/awk4TeJBoDk1givLcLgQ4ghttps://nicecrew.tv/lazy-static/thumbnails/21ec0dd8-00ae-4745-93d0-1596946d1096.jpgCharlie Kirk AssassinatedOn September 10, 2025, Charlie Kirk, a center-right political commentator was murdered at Utah Valley University where he was publicly speaking. Details at the moment are fuzzy and unconfirmed. This is a compilation of video evidence of the attack, but is not comprehensive and may be incorrect. There's always a lot of bullshit information when something happens.https://nicecrew.tv/static/streaming-playlists/hls/4d1e4fbc-6578-4818-ad10-46cef4c1aef5/e7a6f231-e0d6-4e0e-a5aa-76b8ada16f1e-master.m3u8https://nicecrew.tv/videos/embed/awk4TeJBoDk1givLcLgQ4g1875972025-09-10T19:44:35.393ZNOMatty's Autism EmporiumNOhttps://nicecrew.tv/w/hEKhqaZa2ffhkW2ZKyJdgbhttps://nicecrew.tv/lazy-static/thumbnails/1f786f04-13c8-443c-8de0-6e2378457fa2.jpgErika Kirk Addresses the NationErika Kirk delivers remarks after the assassination of her husband Charlie Kirk.https://nicecrew.tv/static/streaming-playlists/hls/86fb27ec-0e05-4926-a8ac-cc63d5c23250/0e869f03-57ef-444b-a2df-0a4738491ed6-master.m3u8https://nicecrew.tv/videos/embed/hEKhqaZa2ffhkW2ZKyJdgb13600642025-09-13T00:48:49.509ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/5iFYNGQTdgXXPebUQfpydXhttps://nicecrew.tv/lazy-static/thumbnails/1b5437fb-858a-4951-a533-02730bc358cc.jpgJust Joe Radio: Wait'll They Get A Load Of Me"WOO! WOO! Ohh I got a live one here AHAHAHAHAHA"https://nicecrew.tv/static/streaming-playlists/hls/22dcd63f-ce1a-4cd8-973e-604978caaae7/79735e98-fd64-4be2-a5de-99a8e603e15c-master.m3u8https://nicecrew.tv/videos/embed/5iFYNGQTdgXXPebUQfpydX1125232025-09-13T20:33:40.925ZintronewjustjoeradioYESJust Joe Radio NOhttps://nicecrew.tv/w/tyyyg8SNCAoqdM8apavQS6https://nicecrew.tv/lazy-static/thumbnails/3330f475-318a-46d3-85e9-5fcacb80887d.jpgHalf Life: Alyx - Chapter 1/2this game bussin fr no cap ong 100 100https://nicecrew.tv/static/streaming-playlists/hls/df329ba2-4d7c-4c8c-9c04-32168c7db651/3b3924c2-421e-4bfd-b274-f54b5bbf236f-master.m3u8https://nicecrew.tv/videos/embed/tyyyg8SNCAoqdM8apavQS638960152025-09-13T22:31:39.473ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/5Hhhd3wEqQ1xWh1tvdtTb6https://nicecrew.tv/lazy-static/thumbnails/2d284731-3109-44f1-bd71-73c2c68567bb.jpgHalf Life: Alyx - Chapter 3/4my booty ass mad exploded cuhhttps://nicecrew.tv/static/streaming-playlists/hls/262814ef-0dd6-4ea4-97ac-664faa37634d/39c17fa5-a2d7-4a78-b07c-a043d795528e-master.m3u8https://nicecrew.tv/videos/embed/5Hhhd3wEqQ1xWh1tvdtTb66838022025-09-14T19:36:30.751ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/4Dgu6ouGmVNvvsNLCXcRifhttps://nicecrew.tv/lazy-static/thumbnails/4a2f4128-eaef-4501-99f2-9e4f14e92bcd.jpgThe Last Cod CompLeft over clips that were originally part of smaller projects. Cant by any honest rationale call this Gator Gun Wednesday 6.https://nicecrew.tv/static/streaming-playlists/hls/1d7f7a61-3931-4d6e-93c6-b12b4488f674/3ef161b5-3409-4258-99c6-1192c762be33-master.m3u8https://nicecrew.tv/videos/embed/4Dgu6ouGmVNvvsNLCXcRif8290182025-09-14T20:40:37.484ZmontagecapfuggetacodclipYESCapt. Fuggetaboutit's NetRancherNOhttps://nicecrew.tv/w/wq6etcJr1LhQb4Y82zFT5phttps://nicecrew.tv/lazy-static/thumbnails/836ba114-01f4-437f-9364-307497723a87.jpgThe Assassination of Charlie KirkNothing about the official story makes sense, and something is very wrong with this investigation and the lack of transparency. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/f64f3c18-bbf4-406d-b5b0-2a6921977eb3/493cb2bf-3ce3-43b8-8581-7464ac55a9d7-master.m3u8https://nicecrew.tv/videos/embed/wq6etcJr1LhQb4Y82zFT5p499855192025-09-14T23:42:03.303Zcharlie kirkTPUSAAssassinationzionismconspiracyYESRadix Verum ☦NOhttps://nicecrew.tv/w/aayYSKGyScH9puMxbPXLJRhttps://nicecrew.tv/lazy-static/thumbnails/8b937ed1-a921-4110-a66d-1d7c681f9e23.jpgSam Hyde Show: This Is YouOriginal [YouTube Video](https://youtu.be/_czBvLB-DwY) Sam's [Twitter Account](https://x.com/wigger)https://nicecrew.tv/static/streaming-playlists/hls/4a384452-dfec-4a14-9ac8-e8327ebb8ced/79054b81-baa2-4814-a005-ebd05f645717-master.m3u8https://nicecrew.tv/videos/embed/aayYSKGyScH9puMxbPXLJR35285422025-09-15T12:59:09.710ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/unaNKid778fZRos3qfzwCJhttps://nicecrew.tv/lazy-static/thumbnails/8f99297e-2765-4ec6-b63c-edeec3026cec.jpgHalf Life: Alyx - Chapter 5shawwwlz is muhfukahttps://nicecrew.tv/static/streaming-playlists/hls/e5b48b77-becf-481a-b938-6df96bda8112/b8620bc3-663f-465b-a747-4d0dadc78641-master.m3u8https://nicecrew.tv/videos/embed/unaNKid778fZRos3qfzwCJ6809022025-09-16T19:16:41.918ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/svdxhbxViTR8ffsx5At3Gwhttps://nicecrew.tv/lazy-static/thumbnails/43360899-32a7-4813-baf7-dd6de67dafb3.jpgHalf Life: Alyx - Chapter 6oooooooooooooo shamalamadingdong ass niggashttps://nicecrew.tv/static/streaming-playlists/hls/d6a1e6f0-4399-41f8-8bc8-c4109872790e/830f4392-21c8-4553-86b6-ea1dbf4a9e04-master.m3u8https://nicecrew.tv/videos/embed/svdxhbxViTR8ffsx5At3Gw2644022025-09-17T22:12:18.676ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/sywSVJ9waqVwW1DE5KQczXhttps://nicecrew.tv/lazy-static/thumbnails/2b3c0929-3a4f-4c95-ae9b-bd8cd0185397.jpgHalf Life: Alyx - Chapter 7jeffussy got my pee pee all smokin an shithttps://nicecrew.tv/static/streaming-playlists/hls/d7186f60-9deb-400b-ba2b-27d3175595ed/5085396c-c7e2-48db-8291-400d66560dc9-master.m3u8https://nicecrew.tv/videos/embed/sywSVJ9waqVwW1DE5KQczX2531002025-09-19T02:08:33.606ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/tvsbVe2WqsixY17LP57ZNPhttps://nicecrew.tv/lazy-static/thumbnails/5c5c5135-dac4-4d58-a89e-782d3f5455f6.jpgHalf Life: Alyx - Chapter 8OOOO SHAWL DUN SHID MY BUD :DDDDDDDDDDDhttps://nicecrew.tv/static/streaming-playlists/hls/dec373c4-e8dd-48b2-a6ee-27f1d1c7c72f/0fc51882-7e64-48d8-aff4-1c83f317aaa9-master.m3u8https://nicecrew.tv/videos/embed/tvsbVe2WqsixY17LP57ZNP2190002025-09-19T02:29:43.521ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/4AS1LQoPdFXnQGrqCoTSzBhttps://nicecrew.tv/lazy-static/thumbnails/aa986535-4f12-4492-8c4d-deca44700609.jpgHalf Life: Alyx - Chapter 9SUM LEM BUGZ NIGGA???https://nicecrew.tv/static/streaming-playlists/hls/1d2986a5-db53-4d44-bd38-0830973ad8fd/f9b8badf-1f44-4452-8d3a-6d104eabbebd-master.m3u8https://nicecrew.tv/videos/embed/4AS1LQoPdFXnQGrqCoTSzB2176012025-09-20T02:40:29.068ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/8fH1jDD4bRgUsePLCXiu9Uhttps://nicecrew.tv/lazy-static/thumbnails/3c429446-b939-4790-b8b1-a542a993d90b.jpgHalf Life: Alyx - Chapter 10get my ass kicked a whole lot editionhttps://nicecrew.tv/static/streaming-playlists/hls/3abda76a-30e4-4340-b10f-6a9e5dc4710c/ac231189-aab4-4bbd-af59-e0afe95e042d-master.m3u8https://nicecrew.tv/videos/embed/8fH1jDD4bRgUsePLCXiu9U2814022025-09-21T01:32:20.324ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/dmAqXsGAGSEzRcYCSovY5Mhttps://nicecrew.tv/lazy-static/thumbnails/339eb94e-b4a7-4e6f-a574-ef81a7b71df9.jpgHalf Life Alyx: Chapter 11 (Final)they call me Gordon Freeman the way I be killing myselfhttps://nicecrew.tv/static/streaming-playlists/hls/640dc1fa-d325-4418-9885-8125ea06361d/55c9b5b7-1835-4320-95e3-2270fb809828-master.m3u8https://nicecrew.tv/videos/embed/dmAqXsGAGSEzRcYCSovY5M1338012025-09-21T01:26:39.589ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/5BMD1PaK5tRfjKb8uPbtBehttps://nicecrew.tv/lazy-static/thumbnails/885cca4a-3ae5-4ff4-a4e1-e6847a0b3407.jpgThe Charlie Kirk Assassination: They are lying to us.Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/2563b64d-0dbf-4fdd-a1a3-ee749de93787/6077369f-909d-4a0e-a754-0a54bedd53fc-master.m3u8https://nicecrew.tv/videos/embed/5BMD1PaK5tRfjKb8uPbtBe137458062025-09-21T03:16:48.710ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/pexpxQshcyB3vtJCmpE3Dehttps://nicecrew.tv/lazy-static/thumbnails/d1856732-d3f7-47d9-bd55-2a5dd0dd9773.jpgCharlie Kirk: Missionaries, Magic Bullets, and a Man of SteelJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/bc26367c-4fd6-4dfd-951e-a676544fc897/8d75b153-f4be-4ce9-a727-7be88f0624eb-master.m3u8https://nicecrew.tv/videos/embed/pexpxQshcyB3vtJCmpE3De241952022025-09-21T18:13:58.598ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/dv7puTHo6nshadhK4hqeEihttps://nicecrew.tv/lazy-static/thumbnails/617c4dd0-6cbc-4520-8a87-552b18374332.jpgJump Space - Total Clanker, Tinskin, and Wireback DeathJump Space - Total Clanker, Tinskin, and Wireback Deathhttps://nicecrew.tv/static/streaming-playlists/hls/653e2e39-088a-46e9-a885-2fa4753b43e1/c013d071-59a9-458d-abca-3d33b87bb722-master.m3u8https://nicecrew.tv/videos/embed/dv7puTHo6nshadhK4hqeEi448532025-09-21T23:44:14.479Zgamingspacejump spaceYESPRÆDÆ VENATORES ™NOhttps://nicecrew.tv/w/uBdLwy8XNHffEb78CJRmYZhttps://nicecrew.tv/lazy-static/thumbnails/8f7833f7-6387-4a75-a3de-0159f295da7a.jpgCharlie Kirk Memorial - 9/21/2025Memorial for TPUSA CEO and conservative commentator Charlie Kirk, after his assassination on September 10, 2025. The event is being held in Glendale, Arizona.https://nicecrew.tv/static/streaming-playlists/hls/e7aac866-00f5-4469-8986-7d33eb8b0d41/fb54cce5-8b45-4ec9-b4ae-ba5de1dffd11-master.m3u8https://nicecrew.tv/videos/embed/uBdLwy8XNHffEb78CJRmYZ13946042026-01-25T14:31:00.605ZYESNiceCrewNOhttps://nicecrew.tv/w/3AmCs85pdCjofAAfA4MWrdhttps://nicecrew.tv/lazy-static/thumbnails/b741a034-dc60-4d43-9dd0-351161b2c26b.jpgJJR - 290 - Let Loose The Sting BallsReviewing the highs and lows of This Week In Clown World Piss Earth. From unleashed Federal Agent Fury to Predictable Political Rugpulls, I walk you through it all.https://nicecrew.tv/static/streaming-playlists/hls/14fe473a-894e-46a5-8974-727707301d46/703f2591-ba8d-4163-b925-104f2d11c86f-master.m3u8https://nicecrew.tv/videos/embed/3AmCs85pdCjofAAfA4MWrd916454762025-09-22T23:17:44.469ZYESJust Joe Radio NOhttps://nicecrew.tv/w/acnVRhMDW6Ep8nw9vmSt8thttps://nicecrew.tv/lazy-static/thumbnails/31313119-8b5a-4dc0-b776-657b77594e87.jpgTucker Carlon's speech, Ghislaine goes to yoga & Cyberwell censors social mediaJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/4a78f17b-bd70-4b8e-8d82-3e3ed99d0cad/03bfed59-e29e-46df-82d5-3979bb04b46f-master.m3u8https://nicecrew.tv/videos/embed/acnVRhMDW6Ep8nw9vmSt8t313151402025-09-22T22:30:12.506ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/gvPsUgBqwphfLoMoJHWS75https://nicecrew.tv/lazy-static/thumbnails/ff6c4c65-cd9d-476e-8214-ca7be517cd8d.jpgJump Space - Distress Call (Pillars of Quara)formerly known as Jump Ship editionhttps://nicecrew.tv/static/streaming-playlists/hls/7da2e65c-3217-431b-9369-d999d7ff12a8/876a56e5-1d1b-4eeb-a980-c676edcd3817-master.m3u8https://nicecrew.tv/videos/embed/gvPsUgBqwphfLoMoJHWS7522655252025-09-28T21:01:53.186ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/acvFNmVASZHkSNgUDRbTBXhttps://nicecrew.tv/lazy-static/thumbnails/d34527d6-8c5b-4efd-a2c1-de5165d83e87.jpgJump Space - Vault Breach (Icarion Reaches)low fps because I was rendering a video in the background editionhttps://nicecrew.tv/static/streaming-playlists/hls/4a7db963-b655-42b7-9aac-d4fd70ce3491/8eb8853d-e9f7-4f07-8464-28a770121b99-master.m3u8https://nicecrew.tv/videos/embed/acvFNmVASZHkSNgUDRbTBX1666022025-09-28T21:13:43.564ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/aotRWxJb2sjtDyHqkiVuNhhttps://nicecrew.tv/lazy-static/thumbnails/ceed92ad-306e-4f41-afce-0104b7b62cbc.jpgTiktok Takeover and Who Really Danced that DayTiktok Takeover and Who Really Danced that Dayhttps://nicecrew.tv/static/streaming-playlists/hls/4c05c7e6-456b-44c9-8ccf-aa10593b4024/ac923af1-586e-472b-9afd-34ed6d76d723-master.m3u8https://nicecrew.tv/videos/embed/aotRWxJb2sjtDyHqkiVuNh215753102025-09-30T12:34:20.223ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/pFX6YuzPhJBv5J4vwPwc6Mhttps://nicecrew.tv/lazy-static/thumbnails/62882014-c57a-46cf-97fe-54fa67c5e513.jpgMac Daddy v2.0 Frame PrintTook about 15 hours, then a few minutes of removing supports. Will likely sand as well. It came out well! The files can be found on the [GunCad Index](https://guncadinded.com).https://nicecrew.tv/static/streaming-playlists/hls/bfd62796-802f-4e02-a8dd-215a79c583fb/b22c4c63-c37d-43a5-b8c0-f55cb83abf1a-master.m3u8https://nicecrew.tv/videos/embed/pFX6YuzPhJBv5J4vwPwc6M315472025-10-01T15:25:40.984ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/sHUzxBFa3k5mivUDrXdzgyhttps://nicecrew.tv/lazy-static/thumbnails/bf2bd8d6-2cd0-4bba-9cc5-5a3bb44bc04e.jpgOtterhounds running aroundHarvey running with his pack in 2018. I miss him. https://nicecrew.tv/static/streaming-playlists/hls/d8678096-928e-4053-998c-e625e2f2fa5a/5edb6c0f-c30f-44c9-b4b4-f895494175d6-master.m3u8https://nicecrew.tv/videos/embed/sHUzxBFa3k5mivUDrXdzgy135102025-10-04T23:04:43.119ZYESMain ChannelNOhttps://nicecrew.tv/w/tcabMmjeYHbyzhZFTbV5johttps://nicecrew.tv/lazy-static/thumbnails/4e8bf4f6-db1e-436a-be53-f3b0e080dc3c.jpgUtau Song Cover PreviewA simple video of Uta Utane singing the japnese Sakura folk song. Mainly as a way to test out Utau after several years of not using it for a long while in Windows 11. Please enjoy.https://nicecrew.tv/static/streaming-playlists/hls/dc359617-a94b-40a7-9ea0-39c79f60e8c2/ea6f54bc-703a-42a1-851e-e44f871ff749-master.m3u8https://nicecrew.tv/videos/embed/tcabMmjeYHbyzhZFTbV5jo20022025-10-05T08:54:43.676ZUtauscreen-recordningYESDreamy's LoungeNOhttps://nicecrew.tv/w/u6pARis1MucpnrZPZFS7Zrhttps://nicecrew.tv/lazy-static/thumbnails/ec090471-31d8-4f1a-b25d-c943e1696f59.jpgDungeons of Eternity - What the Fuck am I Doing Editionshe dungeon on my eternity til I have a shitty hitboxhttps://nicecrew.tv/static/streaming-playlists/hls/e3812558-40aa-40d4-a919-f647ed9690fb/8c681411-a67f-4192-a2be-625fad419aae-master.m3u8https://nicecrew.tv/videos/embed/u6pARis1MucpnrZPZFS7Zr2717062025-10-09T00:53:21.023ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/hweTQWcNJuPUnjtffwuJ9Lhttps://nicecrew.tv/lazy-static/thumbnails/e539bcca-831f-464e-a59c-044298085229.jpgDungeons of Eternity - Getting the Hang of It EditionI just blew my dick off with a shotgunhttps://nicecrew.tv/static/streaming-playlists/hls/85cb1813-e165-4f7d-ac32-dcbc9e14cbe4/2ef66d3b-b92e-4e7f-914f-729e8f5d8b77-master.m3u8https://nicecrew.tv/videos/embed/hweTQWcNJuPUnjtffwuJ9L16425162025-10-09T01:43:44.927ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/2As62gCEVVfisFqjZGW2f1https://nicecrew.tv/lazy-static/thumbnails/3c98cbfe-d9d5-4019-91cd-4566952ac71f.jpgOperation 12 tribes and the absolute state of AmericaJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/0ce880d6-3890-4202-a4bd-ae0f72176b60/a877a89e-1d13-4d1c-a63d-93ec45a3fb00-master.m3u8https://nicecrew.tv/videos/embed/2As62gCEVVfisFqjZGW2f1478053532025-10-11T05:33:39.264ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/wB9wcNZ3jRMxEiZzpnW9zmhttps://nicecrew.tv/lazy-static/thumbnails/43d002da-f896-4a42-b602-a4025823d99b.jpgBattlefield 6 MultiplayerI couldn't think of a funny description (I just blew my dick off)https://nicecrew.tv/static/streaming-playlists/hls/f7da715e-9981-4056-be38-85851cc21e8e/11c28b2d-0799-44d7-ad9e-9005409a9894-master.m3u8https://nicecrew.tv/videos/embed/wB9wcNZ3jRMxEiZzpnW9zm3219582025-10-19T22:50:22.552ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/h2JBHY1MCdwfqnUGrjzHWLhttps://nicecrew.tv/lazy-static/thumbnails/209fab9c-0d50-48a4-84fd-cd57b71c5e94.jpgTime Laspe: Bobbi PoppiesA time laspe video with added text commentary, please enjoy.https://nicecrew.tv/static/streaming-playlists/hls/81d039ae-f146-479a-90d5-c128be8c3714/7dc08e3c-33a8-4f16-8ddf-6d78ef2bd4e5-master.m3u8https://nicecrew.tv/videos/embed/h2JBHY1MCdwfqnUGrjzHWL201032025-10-25T05:21:16.526ZtimelaspeartYESDreamy's LoungeNOhttps://nicecrew.tv/w/tX2UWeuWfaRb4ek1YCMCkxhttps://nicecrew.tv/lazy-static/thumbnails/8edf47df-f341-4174-bdcd-98356f68f158.jpgPTK: The Making of Seung-Hui ChoPTK: The Making of Seung-Hui Cho investigates the Virginia Tech massacre through the details and patterns that mainstream reports left behind. Using official documents, media archives, and psychological analysis, this series explores how power, secrecy, and narrative control shape our understanding of tragedy - from MKULTRA to modern-day mass violence. PTK: The Making of Seung-Hui Cho is an investigative deep dive into one of America's deadliest school shootings - and the historical forces that may have shaped it. While mainstream coverage focused on the shooter's rampage, this series examines the aspects of the story that didn't make the headlines: declassified mind control research, overlooked theories and connections, and how media framing defines what the public is allowed to know and what they remember. Drawing on historical sources, government documents, and first hand accounts, this investigation explores the intersection of violence, secrecy, and control - from MKULTRA to modern case studies. We will pick up on Part Two, the final chapter on this case, next! "The facts are public - but not all of them are reported." https://nicecrew.tv/static/streaming-playlists/hls/e255d474-181b-422f-9bdb-e9d8ee820a45/5717a066-db2d-43aa-9d49-ac7e426e4d68-master.m3u8https://nicecrew.tv/videos/embed/tX2UWeuWfaRb4ek1YCMCkx654752912025-10-27T18:36:05.422Zconspiracyvirginia techseung hui choprogrammed to killmkultraYESRadix Verum ☦NOhttps://nicecrew.tv/w/6bdHKmEBQAXNGvaQQ6Fikvhttps://nicecrew.tv/lazy-static/thumbnails/a842a057-0e3b-4ba0-8154-767207b97e04.jpgVW-TrailerMar 11, 2019 > A couple years ago we found the El Chico Gooseneck trailer that was manufactured by International Travel Trailer Inc. Since then many people have asked us what we did with it. We were asked about the hitch and if we had any interior videos or photos. We sold our trailer to Oklahoma Bugs shortly after we bought it but about 2 years ago another trailer surfaced in Colorado fully restored with a matching VW Bug tow vehicle. This past weekend we traveled to Colorado to see this trailer in person and get you guys some more video of this restored Gooseneck Trailer. Enjoy. JC.https://nicecrew.tv/static/streaming-playlists/hls/29eaf847-d1fe-4b71-94f2-b9c45bddd6b7/6f21a5fa-be16-4789-93d8-4187dc352180-master.m3u8https://nicecrew.tv/videos/embed/6bdHKmEBQAXNGvaQQ6Fikv8840422025-10-31T23:20:21.244ZYESMain ChannelNOhttps://nicecrew.tv/w/eTiQtZqvse8vAqAUCdQ5kfhttps://nicecrew.tv/lazy-static/thumbnails/35ebc033-37e2-472e-95b1-4c59f4813f67.jpgPTK Part II: Virginia Tech & the Architecture of Control (MKULTRA, Media, & Government Secrecy)PTK: Virginia Tech and the Architecture of Control examines how government programs, institutional secrecy, and media framing have influenced the public understanding of the Virginia Tech tragedy. Through historical research and declassified materials, this episode investigates how systems of power construct - and constrain - collective memory. PTK: The Making of Seung-Hui Cho and PTK: Virginia Tech and the Architecture of Control are investigative deep dives into one of America's deadliest school shootings—and the historical forces that may have shaped it. While mainstream coverage focused on the shooter's rampage, this series examines the stories that didn't make the headlines: declassified mind control research, overlooked behavioral warnings, and how media framing defines what the public is allowed to remember. Drawing on historical sources, government documents, and first-hand accounts, this investigation explores the intersection of violence, secrecy, and control - from MKULTRA, PTK, Domestic Gladio, the Strategy of Tension, to modern case studies. "The facts are public, but not all of them are reported." Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8H/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #truecrimecommunity #documentary #deepdive #truecrimestorieshttps://nicecrew.tv/static/streaming-playlists/hls/7070ba03-a126-4621-9514-f652587e79ac/ea9f9b8c-1012-47de-8936-ffa85f13341f-master.m3u8https://nicecrew.tv/videos/embed/eTiQtZqvse8vAqAUCdQ5kf67335552025-11-02T23:30:32.669Zseung-hui choYESRadix Verum ☦NOhttps://nicecrew.tv/w/cum2XaS6EkR4tBJoPPUJWNhttps://nicecrew.tv/lazy-static/thumbnails/b8048365-54bb-42fb-bb1a-df8381c1a689.jpgSuper brief look at the Cobra 18WXST II schematicsJust taking a quick peek at the PTT/Audio output and input chains, power supply, and some minor stuff about supply to the front indicator seven segment display. There's a lot more to thes schematic, I just wanted to take a quick look and share it because it made me feel young again.https://nicecrew.tv/static/streaming-playlists/hls/5d09b26d-f1f1-494f-832d-fc066fc48a42/c389dabb-8eee-456f-9f2a-fa53d1449cc6-master.m3u8https://nicecrew.tv/videos/embed/cum2XaS6EkR4tBJoPPUJWN8200162025-11-04T07:53:26.855ZElectronicsradioYESBrother TylerNOhttps://nicecrew.tv/w/ukTbt4dZ1JKNirw9KZ2Cz6https://nicecrew.tv/lazy-static/thumbnails/f2447a4d-5dd3-484c-a2df-c1ec03cf183c.jpgThe Donor Class Declares War on AmericaJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/e5868e20-b6bb-44c2-998f-1424235b7527/f262b80b-4f71-4bfe-b550-b3526dfeabcf-master.m3u8https://nicecrew.tv/videos/embed/ukTbt4dZ1JKNirw9KZ2Cz627235692025-11-04T20:23:04.096ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/qFvHnH3ct2ZbyZJtULhvwthttps://nicecrew.tv/lazy-static/thumbnails/aac4a685-47bc-453c-8cf4-191ad70d45ee.jpgShit-uation Continuation | Grunt Speak liveBreak out the mega pack of Shit Tickets because well, it just won't stop coming. Stock up on the TP and essentials with us tonight at 8 PM EDT!Show more #Shituation #SHTF #Redonkulas To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/c7dfa578-a1dc-40b1-9690-f36e9d20e47b/481ac6d4-1559-4130-9b67-7b7eb5212af0-master.m3u8https://nicecrew.tv/videos/embed/qFvHnH3ct2ZbyZJtULhvwt55032025-11-06T20:34:49.369ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/eVpTd1Z2PxzNHMBBLv7MGdhttps://nicecrew.tv/lazy-static/thumbnails/73b65360-167a-4213-942e-ffab25ab765d.jpgInside India's Poop Throwing Festival[Tyler Oliveira](https://x.com/tyleraloevera) travels to the beautiful country of India to experience the enrichment of their customs. Archived here because it's probably gonna get yeeted off of [YouTube](https://www.youtube.com/watch?v=_WsPZC1-TLo)https://nicecrew.tv/static/streaming-playlists/hls/70bbf0d4-487e-45f3-b554-b142348d18f0/0169f6dd-3beb-4be1-9006-132c9e62f5cf-master.m3u8https://nicecrew.tv/videos/embed/eVpTd1Z2PxzNHMBBLv7MGd182501602025-11-09T21:16:54.188Zindiashitpoopfestivalh1-bYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/cGTaqWUL4rKBtWAwM7AykXhttps://nicecrew.tv/lazy-static/thumbnails/88c1b7a1-e220-4b6d-a0b9-636386e7078f.jpgToxic Masculinity: A Myth Created to Control Strong Men | Live From The LairDon’t let yourself be controlled by people who hate you. #Redonkulas #ToxicMasculinity #CultureWarShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesday and Thursday at 8pm Eastern time! And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/5ec9ce5e-3793-4e6f-8ac9-716a8084e655/e95b2e2c-d243-46ba-88db-abd6acf14019-master.m3u8https://nicecrew.tv/videos/embed/cGTaqWUL4rKBtWAwM7AykX674002025-11-10T15:23:37.164ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/oSs8NkpbEExnTqZXGnLPD7https://nicecrew.tv/lazy-static/thumbnails/b5c113c4-b465-4f43-8a24-3d2fda71044d.jpgPhilip K. Dick's “The Simulacra” PREDICTED Alex Karp in 1964...Felix = Real?Philip K. Dick's 1964 novel The Simulacra features Felix Karp, a corporate overlord of synthetic humans. Is Palantir CEO Alex Karp the real-world version? In Philip K. Dick’s “The Simulacra,” the shadowy corporate magnate Felix Karp runs Karp und Sohnen Werke (Karp and Sons) —a sprawling conglomerate that manufactures synthetic humans, manipulates governments, and sells illusion as reality. Fast-forward to 2025: Alex Karp, CEO of Palantir Technologies, oversees a surveillance empire that ingests petabytes of data to “predict” human behavior for intelligence agencies and militaries worldwide. Coincidence? Did PKD get a glimpse into the future? Did he predict a Karp technocrat would emerge? “The empire never ended… it just rebranded.” – PKD (probably) Watch before the algorithm buries it. Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends! #philipkdick #palantir #alexkarp #thesimulacrahttps://nicecrew.tv/static/streaming-playlists/hls/b934584e-f8a1-4dce-97f9-6399761b0474/f2f1942f-3c47-4979-8472-c51cc6e8080c-master.m3u8https://nicecrew.tv/videos/embed/oSs8NkpbEExnTqZXGnLPD7226551682025-11-11T23:57:47.238ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/dWsojC6N6L6pkUhdEmqiechttps://nicecrew.tv/lazy-static/thumbnails/c22a73c4-17ea-4d01-9568-b1f0e8dcb568.jpgGroyper Takeover We Are The ExplosionClip from AF Intro with Nick Fuentes set to Night is the Notion live performance by Dax Riggs.https://nicecrew.tv/static/streaming-playlists/hls/68c81676-10ac-4ea3-bc18-ef078c546a21/63fc69df-ca41-4747-ab07-b1e67e912a75-master.m3u8https://nicecrew.tv/videos/embed/dWsojC6N6L6pkUhdEmqiec1075212025-11-13T17:18:03.191Z#nickfuentes #zoomersYESMain poastaljen channelNOhttps://nicecrew.tv/w/8Ycp4on3DE4jNfdQjC2YUYhttps://nicecrew.tv/lazy-static/thumbnails/9150be8c-4b3c-4e10-98aa-3c927b4746c4.jpgBroken by Votes | Grunt Speak LiveThe modern woman has no concept of cause and effect. Let’s look at some examples tonight at 8pm EST! #Redonkulas #CultureWar #ModernWomenShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/4088a54e-de3d-496b-afac-994457de6588/8f8bfa37-9932-460d-a3bd-c7d17f8d8733-master.m3u8https://nicecrew.tv/videos/embed/8Ycp4on3DE4jNfdQjC2YUY15022025-11-13T20:31:36.981ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/qunB6DN1jBcCkmidHBQH6Whttps://nicecrew.tv/lazy-static/thumbnails/bdd837bc-8319-45d6-a413-17a896684db4.jpgSurviving Betrayal and Avoiding Self-Deletion | Live From The LairWhen you become stuck in the quagmire of betrayal, it’s easy to lose sight of life’s pleasures. #Redonkulas #SurvivingBetrayal #CultureWarShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesday and Thursday at 8pm Eastern time! And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! Video Throwbacks The Lens of Depression https://www.youtube.com/watch?v=Sw5auKlbq_A PTSD https://www.youtube.com/watch?v=KrX1EYw8viw Fight Hopeless and Find Your Purpose https://www.youtube.com/watch?v=DuVivJmsgJk All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/c65177d1-04e9-47ec-a4bb-79e389833aec/c41026db-18f6-4245-a41e-4ba6ceb05e31-master.m3u8https://nicecrew.tv/videos/embed/qunB6DN1jBcCkmidHBQH6W7720102025-11-17T15:25:15.886ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/ijRsW5RzzsBwt55k8bBFSkhttps://nicecrew.tv/lazy-static/thumbnails/94217812-b501-4cef-ad36-8972b52d6a9a.jpgMultimillionaire Dave Portnoy cries about coins being tossed at himJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/8c4d3a83-986e-4df2-8a45-74cc75700c1b/95715db9-05d9-4531-96f5-c024c8da12b9-master.m3u8https://nicecrew.tv/videos/embed/ijRsW5RzzsBwt55k8bBFSk109652722025-11-17T22:29:46.043ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/1ZzYcBuLFipMMGX46fTs7qhttps://nicecrew.tv/lazy-static/thumbnails/e2872151-1bad-4405-8a28-57e7a8aaa498.jpgRent A Crowd | Grunt Speak LiveYou didn't really think those crowds were organic, did you? Let's do a little digging...Tonight at 8 PM EST!Show more #FakenGhey #BoughtnPaid #Redonkulas To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/080a543a-1076-4c76-98ab-9e71845a3a54/a2a0226d-9c1a-4e90-b8af-f21ac7abdc36-master.m3u8https://nicecrew.tv/videos/embed/1ZzYcBuLFipMMGX46fTs7q92012025-11-18T05:32:45.811ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/2UZfgdnUyGC4gyLcaaTgaXhttps://nicecrew.tv/lazy-static/thumbnails/2e6d0c83-13b5-4fa4-8944-1f9888f6790f.jpgSonnet for the Sektur / SchizomaxxingJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/0f7f17ff-5f0b-438b-a75f-7890973a5a45/05723170-6127-4f4b-af8f-085ba3c69baf-master.m3u8https://nicecrew.tv/videos/embed/2UZfgdnUyGC4gyLcaaTgaX16430642025-11-18T22:29:44.787ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/sJ2mPgCc17ADc9MJWJ32Bihttps://nicecrew.tv/lazy-static/thumbnails/f6c7b206-f1d1-4fbd-8b7a-48a70d0d1d28.jpgThursday Hijinks | Grunt Speak LiveAnother Thursday and the same kind of Hilarious Hijinks tonight at 8 PM EST!Show more #Hijinks #WheelOfWoe #Redonkulas To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/d86bae52-001e-4aa5-90d0-368746b666d3/77e109de-5ad3-4492-90db-6eafe28082f5-master.m3u8https://nicecrew.tv/videos/embed/sJ2mPgCc17ADc9MJWJ32Bi20002025-11-20T04:56:37.488ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/xgFQpmd5FY4q5nAG7qXLGohttps://nicecrew.tv/lazy-static/thumbnails/95287023-cc61-4563-95c8-b7bf6196178f.jpgSong From Memory 1An old 2000’s Japanese song I wanted to recreate from years ago when I first heard this song from an scc video (yeah, I know…) and I just mainly know that this song is in Japanese and has a female singer singing the song, that’s all I can say for this song. ———————— I didn’t make this song, somebody else did.https://nicecrew.tv/static/streaming-playlists/hls/fd3c0100-2fa7-46b6-bb66-d4570177f92e/4fcd1a42-d575-4ed3-ae0b-e8e31af6a8da-master.m3u8https://nicecrew.tv/videos/embed/xgFQpmd5FY4q5nAG7qXLGo36002025-11-21T04:49:17.467ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/sJ3kVhMWPrkdUjdHtzANk1https://nicecrew.tv/lazy-static/thumbnails/28e22bdc-a451-45fb-ae21-69e5e1b1c2ec.jpgDrawing： Tabb1tA quick little drawing video for this year, since it’s been a while since I uploaded on here. Finished Drawing: https://www.side7.com/content/Dn8EJGGxrN Originally posted on my second YouTube channel on Feb 12, 2023.https://nicecrew.tv/static/streaming-playlists/hls/d86c49a5-ed9f-445a-bf1a-9f7789e96146/50cccf3c-d6ef-4b2b-ae15-d8317880e4b3-master.m3u8https://nicecrew.tv/videos/embed/sJ3kVhMWPrkdUjdHtzANk1124012025-11-24T13:20:34.594Ztime laspeautodesk sketchbookquick drawingartYESDreamy's LoungeNOhttps://nicecrew.tv/w/vN99AKheiKkEfS9AMA8Buohttps://nicecrew.tv/lazy-static/thumbnails/d65541e7-94a0-4fe5-8604-c0a97260f24f.jpgDivorce Grape is Real | Regiment EditionThe system is weaponized against men. Full stop. #Redonkulas #DivorceGrape #CultureWarShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesday and Thursday at 8pm Eastern time! And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! Video Throwbacks Deadbeat Dad Dilemma https://youtu.be/XTHTsemlHEk All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/f14a418f-fb6b-4804-8f7d-3e07767c7932/3caadd78-0385-4b58-ad84-c5b74b409157-master.m3u8https://nicecrew.tv/videos/embed/vN99AKheiKkEfS9AMA8Buo1379022025-11-24T15:27:42.461ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/1tBoiRqdzFyJqJeNmbVqsAhttps://nicecrew.tv/lazy-static/thumbnails/71546a21-f76d-4139-a217-5e1693222e55.jpgMarxist Twitter's Collective Meltdown over a Children's Princess MovieIn this video, we examine self-proclaimed Marxists and leftists losing their minds and crashing out on Twitter over the 28th anniversary of the 1997 animated classic "Anastasia." This beloved children's princess cartoon has triggered a full-blown meltdown, and I'm here for it. That's right: a children's movie about a lost grand duchess has caused total chaos for the hyper online left. They clutch their pearls, they shriek "historical revisionism," they call the film counterrevolutionary. One guy calls Dmitri a "fascist simp," while another tankie unironically called Bartok the bat "problematic." How fragile does your ideology have to be to get owned by a 28-year-old animated kids' film? Once Upon a December...Marxist Twitter lost its mind. https://deathtotheworld.com/articles/the-cosmic-significance-of-tsar-nicholas-ii/ https://www.rasputinarchive.com/p/the-true-religion-of-grigory-rasputin Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content, friends! #anastasia #twitter #princess #romance #romanovs #onceuponadecemberhttps://nicecrew.tv/static/streaming-playlists/hls/03dae369-ede5-4333-ac29-b63a214858ce/177a1b09-b7c8-4d89-82f4-daf98882786d-master.m3u8https://nicecrew.tv/videos/embed/1tBoiRqdzFyJqJeNmbVqsA216455232025-11-24T20:32:01.497ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/fJNSmmQmmARCzSNKHdkFc2https://nicecrew.tv/lazy-static/thumbnails/7cd4952c-0979-473f-8cbc-a5d2e867a173.jpgColor Revolution | Grunt Speak LiveBrought to you by some little old dude in Boston. No, seriously. Bring beverages and a change of shorts. This one is going to get very intense. It will also most likely be a two-parter, because wew, lads, there is a LOT to unpack here.Show more #ColorRevolution #HistoryLesson #Redonkulas To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/775a1026-622f-4f97-b3bb-c71ab317db13/a95aa70e-8f23-46f4-b3e0-e7fb15bca370-master.m3u8https://nicecrew.tv/videos/embed/fJNSmmQmmARCzSNKHdkFc292522025-11-25T04:53:48.879ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/66VfECAnNLr2SCEEeKd6Sohttps://nicecrew.tv/lazy-static/thumbnails/ed343204-9f55-40ee-8917-3e80a3a433c7.jpgThank You Dr. FauciDocumentary about Dr. Fauci's involvement in the COVID pandemic.https://nicecrew.tv/static/streaming-playlists/hls/29513afb-0577-429f-8cb1-8a75ae70924e/d6044345-8b0e-49c5-a972-4ca0646a362b-master.m3u8https://nicecrew.tv/videos/embed/66VfECAnNLr2SCEEeKd6So54795752025-11-26T17:21:32.682ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/dHT6h2KWkp9QHjG3z7yYzxhttps://nicecrew.tv/lazy-static/thumbnails/cf9e806f-f2c1-4b4c-b89f-170dd14a9741.jpgShowcasing my Customized Lafufu’s and moreA simple vlog style video where I showcased some stuff I’ve customized and a few other things. ————— I hope you all enjoyed this video, I might make a video showcasing me customizing another Lafufu plush toys too, but I’ll think about what color theme to choose for the second white Lafufu one day. ————— Hopefully I’ll post some videos that have been sitting in my ipad files too. ——— (I’ll add a thumbnail for this video later, no worries) I know that I’m supposed to be on my no net november streak but meh.https://nicecrew.tv/static/streaming-playlists/hls/6706a4f8-b84b-484f-9131-277ec77140f9/511071b1-abd1-4012-8483-81426bda1076-master.m3u8https://nicecrew.tv/videos/embed/dHT6h2KWkp9QHjG3z7yYzx647022025-11-27T03:28:32.143ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/nCtJAhmZSXHdE3Qfkf88Vzhttps://nicecrew.tv/lazy-static/thumbnails/58b0c342-9715-4be3-b009-4dc3b566df9a.jpgSong Preview 9A preview for a song that’s going to be in a 5 stages of grief themed EP. ——— That’s pretty much it really, I’ll still take my time making each song for this EP.https://nicecrew.tv/static/streaming-playlists/hls/af27c78b-293d-4f62-94e0-56699b4a2677/3dc51d4a-4eb0-4a5f-aceb-7992df0d7c8c-master.m3u8https://nicecrew.tv/videos/embed/nCtJAhmZSXHdE3Qfkf88Vz42002025-11-28T04:10:07.227ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/tDwEuFMxF14nPeGHxHZE5Vhttps://nicecrew.tv/lazy-static/thumbnails/520c082f-516f-4579-93cc-3f66f1fbe79c.jpgMerryCapitalistChristmasMerryCapitalistChristmashttps://nicecrew.tv/static/streaming-playlists/hls/dfe42915-9dfb-4987-aa8a-b3651380c08d/d4719449-347e-4f18-a047-a5a184f47334-master.m3u8https://nicecrew.tv/videos/embed/tDwEuFMxF14nPeGHxHZE5V880172025-11-30T14:39:50.027ZYESMain ChannelNOhttps://nicecrew.tv/w/nPwcYT6Hzyv8FucJdwE2iHhttps://nicecrew.tv/lazy-static/thumbnails/7a1bd880-20a8-4d4f-ad94-72a9a2b133e6.jpgSpecial Holiday Show | Grunt Speak LivePopp opens up the Supporter Streams to the public tonight at 8 PM ESThttps://nicecrew.tv/static/streaming-playlists/hls/b0b27c08-991e-42ad-b0dd-1fafb5be2e77/18a8e94a-0e36-4013-b452-b1c293b700f9-master.m3u8https://nicecrew.tv/videos/embed/nPwcYT6Hzyv8FucJdwE2iH86022025-11-30T19:35:49.623ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/kFWM2ih8zF6KXex4F5QimShttps://nicecrew.tv/lazy-static/thumbnails/ede6d75d-9862-4385-9a83-620f41c5e213.jpgSurviving Divorce in a Rigged System | Live From The LairDivorce is war. Your ex is your enemy. Fight to win or plan for defeat. #Redonkulas #Divorce #CultureWarShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesday and Thursday at 8pm Eastern time! And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/9f71660c-be80-49d1-93ee-33b7069b4a7e/0654649d-f24c-4933-875d-31a5fb12bc40-master.m3u8https://nicecrew.tv/videos/embed/kFWM2ih8zF6KXex4F5QimS1411002025-12-01T15:09:30.005ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/fGCXURRffayyK8wxBHFsoBhttps://nicecrew.tv/lazy-static/thumbnails/73a08b5f-651a-422f-ab5c-df328fd6de7f.jpgLlano RiverThe Llano River at Llano, apres-le-deluge. https://nicecrew.tv/static/streaming-playlists/hls/770c78ce-ee9c-4177-a31d-854214c9d50f/ee688d69-f589-4aae-8f79-049912d166c4-master.m3u8https://nicecrew.tv/videos/embed/fGCXURRffayyK8wxBHFsoB40062025-12-01T23:01:33.670ZYESMain ChannelNOhttps://nicecrew.tv/w/uTFsXr2ACnF8YJuQSdbCBxhttps://nicecrew.tv/lazy-static/thumbnails/a01e0d67-8d09-4352-8d22-d84d4174bf3c.jpgThe Wifestitutes of Olympus | Grunt Speak LiveLet’s give a bunch of mediocre cluster-b disorder women delusions of adequacy, dreams of philanthropy, and access to unlimited wealth, and see what happens.Show more #Wifestitues #ClusterB #Redonkulas To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/e9f722c1-b641-4bd7-8170-884c61948cad/ae95a5d8-3989-47fe-91c5-42c984efd5bf-master.m3u8https://nicecrew.tv/videos/embed/uTFsXr2ACnF8YJuQSdbCBx92022025-12-02T05:37:26.479ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/32bqznKAbmuM9EvTsneBpchttps://nicecrew.tv/lazy-static/thumbnails/9ff1439e-1728-43e6-b0fc-6b31b1e9c241.jpgSynchronicities between Sir John Dee, H.P. Lovecraft, and Jack ParsonsJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/105c71e7-134f-4450-9e6f-6cd220938305/51299369-8da4-4c17-846c-0fa98d64e855-master.m3u8https://nicecrew.tv/videos/embed/32bqznKAbmuM9EvTsneBpc6850502025-12-02T19:12:28.538ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/mWXCgWXaTujiahTF5XRGyWhttps://nicecrew.tv/lazy-static/thumbnails/9ef39550-0190-4048-a94d-12bf2e7f1c9f.jpgNot Your Normal Daytime TV | Grunt Speak LiveJoin us for a discussion panel on modern family court cases, illegal judical action and the damage they are doing to men.Show more #FamilyCourt #DamageToMen #Redonkulas To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/a9a33798-6650-40e8-afe9-129deda734ee/6235fd42-1dd1-4d74-9cbc-3be84c70f1c4-master.m3u8https://nicecrew.tv/videos/embed/mWXCgWXaTujiahTF5XRGyW32012025-12-03T04:45:46.361ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/k6mB79YMFFyV1QDtEyUycAhttps://nicecrew.tv/lazy-static/thumbnails/16cdc831-6383-4c7a-9f13-9140e37f3617.jpgMore Shenanigans...yet again | Grunt Speak LiveThe Drunk Uncles here yet again to make you laugh, cry, and question humanity...Show more #WheelOfWoe #BadBehavior #Redonkulas To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/9a9d0d45-9d34-464f-bf0b-05d3adf6f040/90df8346-9335-4f50-9f52-257cc3950228-master.m3u8https://nicecrew.tv/videos/embed/k6mB79YMFFyV1QDtEyUycA32002025-12-04T08:09:50.263ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/ihDkBbBg7VV1CSpAfuHoxEhttps://nicecrew.tv/lazy-static/thumbnails/fb289b29-eccd-403f-92c4-dcc650314317.jpgTime laspe: You got a screwdriver - IndinnaAnother simple infinite painter time laspe video for this week. Finished drawing: https://side7.com/content/XZ8bpdlm9O Creative commons for the musichttps://nicecrew.tv/static/streaming-playlists/hls/8bfe4496-e60d-4d56-a058-eb00f864ad2c/551dd6aa-f562-4d39-87f5-a9b7dc2195ae-master.m3u8https://nicecrew.tv/videos/embed/ihDkBbBg7VV1CSpAfuHoxE185002025-12-04T13:00:51.630ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/93JsLoQccTFJHCfnbmpeKnhttps://nicecrew.tv/lazy-static/thumbnails/f7aafa46-9ee2-4214-907d-9262c19554bf.jpgSave Your Sons | Ride and RoastThe myth of “Male Privilege” was invented so young men could be swept aside while civilization was taken over by evil. It’s time to take it back. #Redonkulas #CultureWar #SaveYourSonsShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in for Grunt Speak Live Tuesdays and Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/412ac3be-ee5f-4e05-971c-59193f8c3fff/c40a369e-e34e-4863-94eb-f88d2eeeae24-master.m3u8https://nicecrew.tv/videos/embed/93JsLoQccTFJHCfnbmpeKn2285092025-12-08T15:27:47.054ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/k5X69xmBgjHZsX2YgaJmurhttps://nicecrew.tv/lazy-static/thumbnails/e1eb4371-6b5b-4ce8-ace0-61cf62131ab3.jpgVagolistology Explained | Grunt Speak Live#Feminism #ModernWomen #RedonkulasShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/9a8e8f2c-07c1-409a-96a9-769652428141/55c1678f-d974-4589-a81c-b731c2551e0e-master.m3u8https://nicecrew.tv/videos/embed/k5X69xmBgjHZsX2YgaJmur760102025-12-09T04:43:13.597ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/7Tfy3bcJJaTTiCy2pHyo5qhttps://nicecrew.tv/lazy-static/thumbnails/eed50bba-01c9-4354-8467-2a0d469b14fb.jpgNever Their Fault | Grunt Speak LiveIsn’t it amazing how nothing bad that happens as a direct result of modern women’s behavior is ever their fault? Dodge accountability at 8pm EST! #Redonkulas #CultureWar #ModernWomenShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/37bebb81-a878-4d22-a788-634a03a29848/563537f9-6ed7-4e24-8158-6d9e3f810b96-master.m3u8https://nicecrew.tv/videos/embed/7Tfy3bcJJaTTiCy2pHyo5q120542025-12-11T00:33:38.090ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/eT7PyhgjzuCH1PQiRPZ7mghttps://nicecrew.tv/lazy-static/thumbnails/b960215b-83b3-43a5-b85c-0b3a330d008b.jpgInside the mind of a deranged, paranoid, neurotic technocrat.Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/7069f012-d97e-4ebb-af84-57cf38376527/39aceaec-7444-4a41-885d-4d6e0942fbf9-master.m3u8https://nicecrew.tv/videos/embed/eT7PyhgjzuCH1PQiRPZ7mg228451262025-12-11T04:25:02.084ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/fvYNF8Vbr6t6r3Lzo7M94Chttps://nicecrew.tv/lazy-static/thumbnails/969c81ec-6494-43c9-a703-628cc0f53742.jpgPink And White AnimationAnother short animation using Animation sketch on my iPad. Please enjoy!https://cdn.nicecrew.tv/streaming/hls/758f848a-2798-4fc5-9cf5-35ae7f01d15a/f984a4b6-6fbe-4dfb-ac51-b6f56a26c377-master.m3u8https://nicecrew.tv/videos/embed/fvYNF8Vbr6t6r3Lzo7M94C12022026-03-21T14:03:11.999ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/cAvQxVVjxJX2anG61CQm6dhttps://nicecrew.tv/lazy-static/thumbnails/70491b48-fceb-4b1e-a0e8-2260be5fa6b2.jpgDivision 2 - Tinkerer + GR9 = A10 BRAPHOGDivision 2 - Tinkerer + GR9 = A10 BRAPHOGhttps://nicecrew.tv/static/streaming-playlists/hls/5de63381-5817-4238-a7ef-6b868b1163fe/0a9a33d7-9979-46e6-bc34-e8fc34eedf5d-master.m3u8https://nicecrew.tv/videos/embed/cAvQxVVjxJX2anG61CQm6d89042025-12-15T15:14:45.720Zgamingdivisondivision 2YESPRÆDÆ VENATORES ™NOhttps://nicecrew.tv/w/bpjozuNKh1h2povRL9CK9Lhttps://nicecrew.tv/lazy-static/thumbnails/bae5a8b8-2a04-44d2-8aac-3a189219caaf.jpgShe’s Not Happy… Now What? | Live From The LairIf your woman hasn’t yet filed the papers, time is your friend. Make it work for you. #Redonkulas #Divorce #CultureWarShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesday and Thursday at 8pm Eastern time! And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/543cd37b-35d6-47e4-bad0-c81512835768/1739226c-9730-467d-8cdf-ae75043e744d-master.m3u8https://nicecrew.tv/videos/embed/bpjozuNKh1h2povRL9CK9L830582025-12-15T16:38:38.438ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/1JVYFdRbzbDB13cZje3YTEhttps://nicecrew.tv/lazy-static/thumbnails/704f4ba9-b34a-49a8-b12c-13ff691773bd.jpgSmall Lafufu updates, Art supplies and moreAnother update video about my Lafufu dolls, and I’m still looking forward to getting three more from Temu for this week and next week. Please enjoy! (I’ll also add a thumbnail for this video later as well too.)https://nicecrew.tv/static/streaming-playlists/hls/05fe80c1-c840-41c3-a4c3-73e1e5ddfcb4/c9731ba8-dd73-452f-8b87-fa7c5ef605e2-master.m3u8https://nicecrew.tv/videos/embed/1JVYFdRbzbDB13cZje3YTE1068052025-12-15T20:57:27.435ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/cQ2e4G1Vopb4Cb38NgZfqGhttps://nicecrew.tv/lazy-static/thumbnails/98d6e7e4-be43-41ed-a26a-73a7bb77f3ff.jpgThere's something strange about Bondi Beach and Brown University...Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/5fc8fb36-52c3-44dc-bb69-6908a07df5e8/bd5cca6c-366c-4860-b04e-bdf1298543be-master.m3u8https://nicecrew.tv/videos/embed/cQ2e4G1Vopb4Cb38NgZfqG376054372025-12-15T23:10:51.160ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/xpejmrEYvzhGbKqTZbmr7Ahttps://nicecrew.tv/lazy-static/thumbnails/1551e0a0-8065-4172-9002-a848d1c6dddd.jpgJudges Gone Wild | Grunt Speak LiveActivists shouldn't be judges and judges shouldn't be activists...We break it all down tonight at 8 PM EST! #Judges #Activists #RedonkulasShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/fe499c98-c5bb-45cf-88e5-269db5584222/6674ab44-1523-42e0-9e44-546892a394a7-master.m3u8https://nicecrew.tv/videos/embed/xpejmrEYvzhGbKqTZbmr7A92022025-12-16T06:25:59.321ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/ayqetb9jqekxZuK6CRe7kZhttps://nicecrew.tv/lazy-static/thumbnails/3a8c12dd-41b8-4edd-b664-27d20eb66312.jpgThoughts on Usury and DebtMusic credit: Mount Athos Monks Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/4d68fb72-5aae-4636-87cf-44f2387ffeb7/9d797cc7-3cd0-4ca3-ab8c-e82fa6ea308b-master.m3u8https://nicecrew.tv/videos/embed/ayqetb9jqekxZuK6CRe7kZ110101072025-12-16T19:44:31.152ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/5v3CXAPjLDMb4r97fhzqizhttps://nicecrew.tv/lazy-static/thumbnails/c7276e1b-6550-400b-b85e-d89dfd7f6fb4.jpgToday in clown worldJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/2472bfcc-6de2-4bbb-85e0-fe652d69dec3/5971af8f-0752-4003-a6cc-c0708adbfd9b-master.m3u8https://nicecrew.tv/videos/embed/5v3CXAPjLDMb4r97fhzqiz77651142025-12-17T19:40:49.533ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/hi5oT3m7qN2XZyxYE3G9kRhttps://nicecrew.tv/lazy-static/thumbnails/f3830b78-29e4-4cc8-a683-6bcc00e1e894.jpgMore Thursday Night Shenanigans! | Grunt Speak LiveIt's Thursday, so you know what that means! Hilarity and Chaos happens tonight at 8 PM EDT!Show more #WheelOfWoe #Whamen #Redonkulas To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/83f49222-f8df-4526-afeb-73be98a1e53f/b1af6580-bcf1-40c7-9c18-73a91cd58a69-master.m3u8https://nicecrew.tv/videos/embed/hi5oT3m7qN2XZyxYE3G9kR86032025-12-18T21:30:14.812ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/mLhjHHrMWDoRqoYKbxWkSwhttps://nicecrew.tv/lazy-static/thumbnails/6396261a-dfae-4163-a882-f41c215bbb76.jpgSong Preview 10Another song preview thing, mainly for a dramatic song, I’m liking how this is sounding at least. ——— Garage band, original song, gloomy song, music makinghttps://nicecrew.tv/static/streaming-playlists/hls/a8258eee-a3f5-46d9-9936-e7a73941797e/a00fe693-b418-44de-9c31-c8c253917437-master.m3u8https://nicecrew.tv/videos/embed/mLhjHHrMWDoRqoYKbxWkSw114052025-12-19T14:30:06.574ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/8sh2KMpYqMQeJVEcZbNt8chttps://nicecrew.tv/lazy-static/thumbnails/c51efb3c-9e00-407f-aa77-ec73e3a01c5b.jpgSmokin n Jokin with Popp | Live From The LairMore Army Stories from the Poppster as well as some Holiday AdviceShow more #ArmyStories #Holidays #Redonkulas Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/3c5b3008-f262-42dc-b866-b0e5a2127b9d/f19d0345-d946-451d-9aca-6f26b9bca5dc-master.m3u8https://nicecrew.tv/videos/embed/8sh2KMpYqMQeJVEcZbNt8c60022025-12-21T22:47:59.566ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/uCujDNrMfCGngj2mH8P9X2https://nicecrew.tv/lazy-static/thumbnails/2ff6184d-98e9-4032-b4aa-6b575fa83618.jpgTake Control Before It’s Too Late | Live From The LairGeneration Z has discovered the Regiment, and just in the nick of time. #Redonkulas #GenZ #CultureWarShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesday and Thursday at 8pm Eastern time! And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://cdn.nicecrew.tv/streaming/hls/e7d81cab-acaf-4039-965e-dd254f82487f/49d54bb6-6d86-452d-a078-e092050761b0-master.m3u8https://nicecrew.tv/videos/embed/uCujDNrMfCGngj2mH8P9X2892062026-03-21T14:29:32.801ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/2twhZkRWBTx9Qq2sniKNPXhttps://nicecrew.tv/lazy-static/thumbnails/dec8b2b7-918f-41aa-be2c-82283ae7800b.jpgMerry Gruntsmas! | Grunt Speak LiveThe gang is all here tonight at 8pm EST with funny viral videos and more funny Army stories than you can shake a stick from the whore tree at. #Redonkulas #CultureWar #MerryGruntsmasShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/0bf0e39d-39f6-4ed9-b1e6-d3d39b7cdd3d/6e2816e0-b3d6-4c90-a85e-f10d0a7ec152-master.m3u8https://nicecrew.tv/videos/embed/2twhZkRWBTx9Qq2sniKNPX102022025-12-23T17:36:33.769ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/bZGeBvmveeHrrJyjenE12Chttps://nicecrew.tv/lazy-static/thumbnails/373aad76-2d31-4561-b8d3-d6b679e447f3.jpgMerry Christmas 🎄 🎁Merry Christmas 🎄 🎁https://nicecrew.tv/static/streaming-playlists/hls/590993b6-4985-4f98-be88-37f9abfafe3e/3f5a9b65-a91f-4aa4-9f3a-9932a9f7ee07-master.m3u8https://nicecrew.tv/videos/embed/bZGeBvmveeHrrJyjenE12C205132025-12-25T20:19:53.340ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/ducRCBzqMsBncxBy7WHgc2https://nicecrew.tv/lazy-static/thumbnails/d4d23f6c-c45b-40d9-8fdb-de3033f03506.jpgSpeed Drawing: An Ozoi ChristmasA time lapse video of Ozoi the maid with some Christmas cheer to it. Please enjoy! The music is by Ozoi the maid and Morai the maid. Finished illustration: https://side7.com/content/v2rkvBmq85https://nicecrew.tv/static/streaming-playlists/hls/651dcbba-f7da-4978-9b51-084163909ba3/418acf08-23da-4df8-8b3a-207f5fd6fe8a-master.m3u8https://nicecrew.tv/videos/embed/ducRCBzqMsBncxBy7WHgc2142002025-12-28T12:47:46.073ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/eXi5h5oYjhdjTppUfgZrwthttps://nicecrew.tv/lazy-static/thumbnails/51b1fc73-f0d8-4fa7-ad91-9462f44900d8.jpgRest in Peace, Mama Popp | Important AnnouncementYour Drunk Uncles are taking this week off to deal with this event. You all take care of each other and we’ll see you in 2026. #Redonkulas #HappyNewYear #RIPShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesday and Thursday at 8pm Eastern time! And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/70ff3b64-430a-4dad-998b-51803cb09883/0d811e92-6e99-4b65-a7d4-ec7648c995cb-master.m3u8https://nicecrew.tv/videos/embed/eXi5h5oYjhdjTppUfgZrwt108012025-12-31T01:39:18.883ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/4TXM8ccAbikkFNrAH4Wp3khttps://nicecrew.tv/lazy-static/thumbnails/1b8a59de-69fa-4b98-93bd-1d176194d9de.jpgSpeed Drawing: New Year HorseA colorful illustration of a horse human hybrid with the new year on her back, and green and yellow bird taking the ribbon snake of 2025 away. —— Happy New Years everyone! —— Finished drawing: https://www.side7.com/content/RErZmdj28ghttps://nicecrew.tv/static/streaming-playlists/hls/1f8cb900-821d-4016-8fe4-16a36b974403/8c1c2dc2-c162-45fd-80b0-3fe5e56dfa14-master.m3u8https://nicecrew.tv/videos/embed/4TXM8ccAbikkFNrAH4Wp3k472022026-01-01T10:44:56.655ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/vKxsv8yRr5EiQSHXDpSJ4chttps://nicecrew.tv/lazy-static/thumbnails/92175ad4-a037-4f87-8ace-f4d7e508b56e.jpgThe Great Daycareapocalypse | Grunt Speak LiveWhat started out as some friendly daycare fraud has turned into the fleecing of the entire nation, and a governor standing down. Well, That escalated quickly. Show more #SomoliFraud #Minnesota #Redonkulas To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/f0ed63a7-84ac-4354-bc61-3181e38b1d41/73dc8621-ea1a-4e2c-a076-d404b803ff5a-master.m3u8https://nicecrew.tv/videos/embed/vKxsv8yRr5EiQSHXDpSJ4c92012026-01-06T07:35:59.128ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/eQgpSnjcipgNdxyL97DqkBhttps://nicecrew.tv/lazy-static/thumbnails/48301ef1-6a86-49dc-87a6-72fe0e534324.jpgCold as ICE | Grunt Speak LiveWe need to address the hole-filled leftist elephant in the room before we get to the good stuff tonight at 8pm EST! #Redonkulas #CultureWar #ColdAsICEShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/70040050-8d0f-4d74-82d7-69833d47dcf9/98296c44-0cea-4dbf-9362-e746ee31f9c1-master.m3u8https://nicecrew.tv/videos/embed/eQgpSnjcipgNdxyL97DqkB118022026-01-07T23:27:56.909ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/fNGYWa4pxrn9WC7nq2f8kHhttps://nicecrew.tv/lazy-static/thumbnails/83070fee-564a-4160-af49-be282d168a0b.jpgThe Poppinomicon Volume 1 | Popp CultureThe Poppster has come up with many terms to skirt the algorithm over the years. Here are 35 of them. #Redonkulas #CultureWar #PoppinomiconShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in for Grunt Speak Live Tuesdays and Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources are available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/77e56915-16e5-460c-9f28-d78cad6bdcf3/81b29578-a035-4a1e-b3f4-181f981fdf53-master.m3u8https://nicecrew.tv/videos/embed/fNGYWa4pxrn9WC7nq2f8kH1546002026-01-12T16:20:10.216ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/qAmvSSsh6BN4d7bnvWuvCYhttps://nicecrew.tv/lazy-static/thumbnails/fc02d961-c9a0-40b3-9b20-77923f733fca.jpgOn Ashley St Clair, Erika Kirk, and Alexis Wilkins...Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://nicecrew.tv/static/streaming-playlists/hls/c7274248-1ba7-4115-87df-9403b53e2c94/16002450-dfdd-484a-9b8a-0faaa763d612-master.m3u8https://nicecrew.tv/videos/embed/qAmvSSsh6BN4d7bnvWuvCY256103122026-01-12T22:05:55.349ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/aJRGR7TxoyDzgdBs4VYogkhttps://nicecrew.tv/lazy-static/thumbnails/7224e7fa-f2a6-4348-8f58-cbd2f54ba8e7.jpgThe Face of FAFO | Grunt Speak LiveHow the AWFLs cannot seem to help themselves, and other adventures of the Useful Idiots.Show more #FAFO #AWFL #Redonkulas To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/4ede1e1c-1a06-4f45-9e67-5efe37932281/b2f7b0d6-56c2-4cf0-901b-63083ab0e9cc-master.m3u8https://nicecrew.tv/videos/embed/aJRGR7TxoyDzgdBs4VYogk92002026-01-13T06:12:29.344ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/ptLWZxowGak1YcE8KixCN2https://nicecrew.tv/lazy-static/thumbnails/ba8de2d0-5219-46f6-8741-bec94eec5531.jpgThursday FAFO and Funnies | Grunt Speak LiveIt's Thursday, so you know what that means! Hilarity and Chaos happens tonight at 8 PM EDT!Show more #WheelOfWoe #Whamen #Redonkulas To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/be22f8a3-818f-4e9a-b400-ce59c90fac05/e01aebd5-05e1-40d8-89a5-9c744e8851d8-master.m3u8https://nicecrew.tv/videos/embed/ptLWZxowGak1YcE8KixCN220012026-01-15T22:16:34.560ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/sAVyDeiTkaF32gv4wo3REKhttps://nicecrew.tv/lazy-static/thumbnails/6e37039f-21af-4cfc-a2af-e24c78745b10.jpg9VeilMaid - Concrete WonderlandA song about a surreal wonderland thats nothing but endless distorted concrete buildings. made using GarageBand.https://nicecrew.tv/static/streaming-playlists/hls/d76de70f-a750-45ed-a4d1-7a522c92655b/2bd8adee-9e21-44b3-9607-d5f470c70cd6-master.m3u8https://nicecrew.tv/videos/embed/sAVyDeiTkaF32gv4wo3REK220002026-01-17T03:34:51.636ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/4KEjxHqKCojfdx6c9UFpPwhttps://nicecrew.tv/lazy-static/thumbnails/1ec377d3-dbe5-45e1-add2-ca01793a880f.jpgMegaMan 1 Test Run!MegaMan 1 Test Run!https://nicecrew.tv/static/streaming-playlists/hls/1e640373-ffbc-426b-ab2f-cc3a309dc198/088f9445-7e63-4d67-8cf1-e3078dd35596-master.m3u8https://nicecrew.tv/videos/embed/4KEjxHqKCojfdx6c9UFpPw36995672026-01-19T01:02:52.076ZYESCavern TavernNOhttps://nicecrew.tv/w/i5VSsMxfENMkmQmxggUG8Chttps://nicecrew.tv/lazy-static/thumbnails/ce972712-8082-4cb1-a1a1-63e16b55bbf0.jpgMy Daughter’s Loser Boyfriend | Live From The LairWhen your daughter hooks up with a soy boy, what is a real man in current year to do? #Redonkulas #CultureWar #ModernWomenShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesday and Thursday at 8pm Eastern time! And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/8a5b87e8-278d-465b-814f-3692e412a78a/a3cf52af-66c6-4302-8b83-548e1df141ad-master.m3u8https://nicecrew.tv/videos/embed/i5VSsMxfENMkmQmxggUG8C7540102026-01-19T15:22:09.600ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/ceDxv8ppBZ6TGne6CwBimAhttps://nicecrew.tv/lazy-static/thumbnails/e3d9f901-28c3-4030-8336-7a85ed2abad2.jpgI talk about - Why I dislike corporate artA talking video where I talk about my dislike for corporate art being everywhere. I hope you all enjoy! Creative commons for the background music Finished illustration: https://www.side7.com/content/z39qxNvvrRhttps://nicecrew.tv/static/streaming-playlists/hls/5afc54bf-e0cd-423a-b81a-0a7ee719baa6/432df444-9d39-48cc-a0e0-43f43f109789-master.m3u8https://nicecrew.tv/videos/embed/ceDxv8ppBZ6TGne6CwBimA958072026-01-19T17:42:33.334ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/uZWzW72Q2pDNBJsyzhXPNJhttps://nicecrew.tv/lazy-static/thumbnails/ccdb3549-992b-4f33-8194-5a9413ebaefa.jpgThe Greenland Rabbit hole | Grunt Speak LiveLet's go down the Greenland Rabbit Hole!Show more #Greenland #RabbitHole #Redonkulas To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/ead6eaa6-605f-47fd-a345-7d6aa7f0ee6a/27cb7420-2fd3-45b8-a259-2c2b25e1fa5a-master.m3u8https://nicecrew.tv/videos/embed/uZWzW72Q2pDNBJsyzhXPNJ92032026-01-20T08:07:26.600ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/9toyjqumjEsxUhfoxh6pcKhttps://nicecrew.tv/lazy-static/thumbnails/0e938332-81f2-4e8c-b656-d3461d627620.jpgParty of Fraud | Grunt Speak LiveYour table is ready tonight at 8pm EST! #Redonkulas #CultureWar #FraudfatherShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/449c17aa-0e41-4334-bbbd-da840a59638d/36467da5-1d9d-4eae-bf64-5d4e3d764e4e-master.m3u8https://nicecrew.tv/videos/embed/9toyjqumjEsxUhfoxh6pcK45032026-01-22T20:49:11.594ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/2JWDsWYHk48qoeiCUpdUA7https://nicecrew.tv/lazy-static/thumbnails/61749100-c3f9-4538-9bf9-4838a536880c.jpgARC Raiders - NIGGER VTUBER DEBUTkiss me on the lips limbrul https://cdn.nicecrew.tv/streaming/hls/0e180dc3-177e-4799-bbb4-d37b85fa025a/a6ddb936-09e9-48b4-aaef-b93a4432bfb5-master.m3u8https://nicecrew.tv/videos/embed/2JWDsWYHk48qoeiCUpdUA7424101122026-01-24T03:51:00.012Zarc raidersfinancegamingrapevtuberYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/cWexEsb9eTXSxoArZHiMHnhttps://nicecrew.tv/lazy-static/thumbnails/68ac7268-95ca-4e86-8ce9-eec79b72be09.jpgICE Riots - 01/24/2026shitlibs getting ICE'd editionhttps://nicecrew.tv/static/streaming-playlists/hls/60a7096c-1374-42d8-b62b-fecd11b28acb/8e48902a-f149-4b4e-80d5-4988140fe08e-master.m3u8https://nicecrew.tv/videos/embed/cWexEsb9eTXSxoArZHiMHn1489458292026-01-25T14:28:48.624ZiceriotprotestdeportationbenisYESNiceCrewNOhttps://nicecrew.tv/w/uj2jBchv2nt6eCNFSaZnUMhttps://nicecrew.tv/lazy-static/thumbnails/31c62a7f-98c0-4351-a0e9-2278a176fb85.jpgBarter for Pussy | Live From The LairWhen the excrement hits the air conditioning, barter will become an essential life skill for survival. #Redonkulas #CultureWar #ModernWomenShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here:https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesday and Thursday at 8pm Eastern time! And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://nicecrew.tv/static/streaming-playlists/hls/e5441595-b9fc-4ceb-8cd4-268303904a61/2ad2d5b1-5e20-4ed2-8a53-ccd3083cf6bc-master.m3u8https://nicecrew.tv/videos/embed/uj2jBchv2nt6eCNFSaZnUM7100142026-01-26T15:45:31.035ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/qPZXFduGLTTbgArMzEBF83https://nicecrew.tv/lazy-static/thumbnails/ee2ed41b-f6b3-4a71-938c-cd0e2a57218f.jpgNCTV IntroNCTV Introhttps://cdn.nicecrew.tv/streaming/hls/c90f010d-3409-458d-abb1-517d79a2c74c/c4c29bdc-48ad-462d-a7cc-84cfd8b100e0-master.m3u8https://nicecrew.tv/videos/embed/qPZXFduGLTTbgArMzEBF8380112026-01-26T17:43:37.618ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/fSfzw6vri8kkTwoaUVgcgzhttps://nicecrew.tv/lazy-static/thumbnails/8ad274c1-ce4b-45dd-aa30-8805dd4a4424.jpgIce Riots - 01/26/2026snow day editionhttps://cdn.nicecrew.tv/streaming/hls/78641d1b-4151-40d2-ab8b-d0191da5147b/e018f6cd-32c4-4397-8cac-fed6864ca334-master.m3u8https://nicecrew.tv/videos/embed/fSfzw6vri8kkTwoaUVgcgz747702452026-01-27T11:38:23.071ZYESNiceCrewNOhttps://nicecrew.tv/w/iQdMnchuqiqNxiZHToBipPhttps://nicecrew.tv/lazy-static/thumbnails/e33dcac7-d42c-473a-a1a1-e5ee922100e6.jpgSignal Treason | Grunt Speak LiveThere's gonna be a LOT of Bolsheviks said tonight...get prepared...because the Bolsheviks are getting prepared...Show more #SignalGate #Bolsheviks #Redonkulas To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://cdn.nicecrew.tv/streaming/hls/9066ef7a-c93b-4607-b3d4-3397a4b37c41/c2913a09-8275-4ce4-8f50-ab05631ebfe7-master.m3u8https://nicecrew.tv/videos/embed/iQdMnchuqiqNxiZHToBipP7042026-01-27T05:13:33.729ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/3S8BMmuttQJnnQ6xmmx3CShttps://nicecrew.tv/lazy-static/thumbnails/d3ae4cf9-bd3e-4213-bbc8-892b6f5877cf.jpgAssorted Thursday Night Shenanigans | Grunt Speak LiveHope you aren't tired of the Thursday Night Shenanigans...Because we sure aren't!!!Show more #Shenanigans #ThursdayNight #Redonkulas To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! Show lesshttps://cdn.nicecrew.tv/streaming/hls/173228f0-8482-40bc-98df-bc08d124ef7a/41456ac6-72d4-4aeb-971f-cf3b4e300c5b-master.m3u8https://nicecrew.tv/videos/embed/3S8BMmuttQJnnQ6xmmx3CS55022026-01-29T06:00:51.703ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/dcB6Ejn6M6WiXA1xfe5KmJhttps://nicecrew.tv/lazy-static/thumbnails/54a3bb67-c120-4dd6-9967-e99c95a9eb70.jpgChain Racing Chain Racing - Two cars are chained together, the front car has an engine but no brakes, the second car has brakes but no enginehttps://cdn.nicecrew.tv/streaming/hls/62cc799d-0bf5-4e6e-a85b-2ba116e898ae/424c13e5-ebd7-44c7-bb12-a2c381b93c68-master.m3u8https://nicecrew.tv/videos/embed/dcB6Ejn6M6WiXA1xfe5KmJ129092026-01-30T04:42:10.923ZYESMain ChannelNOhttps://nicecrew.tv/w/dTjhpY85NjH67Z9BQzptEThttps://nicecrew.tv/lazy-static/thumbnails/fdf7a04a-4f3f-4575-a5ef-ba2e56c7fb60.jpgDon’t Change For Her | Live From The LairNow matter how good the Slot C, it’s not worth it. Do the math. #Redonkulas #CultureWar #ModernWomenShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesday and Thursday at 8pm Eastern time! And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://cdn.nicecrew.tv/streaming/hls/6857dd0d-1429-46df-ab10-4e4408bd8203/c208f46a-e337-4f9b-b9a0-5656d2fc9027-master.m3u8https://nicecrew.tv/videos/embed/dTjhpY85NjH67Z9BQzptET692052026-02-02T16:12:44.535ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/eeyPzUPKxDfimCkpMJvpXUhttps://nicecrew.tv/lazy-static/thumbnails/c6f4c07f-14e2-437f-bfb3-dadce0cd1777.jpgFeminization = Woke| Grunt Speak LiveWe told you so. We f**king told you so. Feminization = Woke. Here's a WOMAN, admitting it - no, EXPOSING IT. Brace for impact. Show more #Feminizism #Woke #Redonkulas To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://cdn.nicecrew.tv/streaming/hls/6b2bb2a9-4962-4203-8b0b-5e7c52f0aa6e/b63a679d-d86f-46e2-b46d-acb8a7466e9c-master.m3u8https://nicecrew.tv/videos/embed/eeyPzUPKxDfimCkpMJvpXU76002026-02-03T06:46:13.246ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/jSy3DjmmqAuZCuTFjP2MvXhttps://nicecrew.tv/lazy-static/thumbnails/3c9c6343-9804-498c-893f-dd0c8a0e3e4b.jpgSeptum Stalinists Want National Divorce | Grunt Speak LiveUncle Skid returns to the fray to confront delusional AWFLs and read two new lives saved into the record tonight at 8pm EST! #Redonkulas #CultureWar #SeptumStalinistsShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, GiveSendBro, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://cdn.nicecrew.tv/streaming/hls/98d36ee4-1011-453b-906b-d721bff16eb5/7a74cd7c-e3bd-448d-8a02-7f221ffc608f-master.m3u8https://nicecrew.tv/videos/embed/jSy3DjmmqAuZCuTFjP2MvX120092026-02-05T18:09:36.300ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/jtJUZpc2TEZsvee6T7TRPMhttps://nicecrew.tv/lazy-static/thumbnails/0fe74114-40da-40a2-9056-1176cde435f9.jpgSong Preview 11Another song preview video, I just want to make something simple for this week. Please enjoy! I’m also making more hopeful music too in the future. —- Also, the video failed to import, so I manually uploading it here.https://cdn.nicecrew.tv/streaming/hls/95a4062d-0638-41b6-bf00-ad5f96e618af/dacfd5b7-5850-4e00-be43-942a85f17e5c-master.m3u8https://nicecrew.tv/videos/embed/jtJUZpc2TEZsvee6T7TRPM82532026-02-06T22:42:47.228ZMusicgaragebandwipYESDreamy's LoungeNOhttps://nicecrew.tv/w/87szB5KCAUdamFwRnYBbNphttps://nicecrew.tv/lazy-static/thumbnails/bf23c1fd-d7c7-4ff3-a1cf-a9a4dcef32b0.jpgTerry Davis - Nigger Cattle UltimatumThey're so docile.https://cdn.nicecrew.tv/streaming/hls/3996d039-400a-43b6-a98d-8c3544b70343/20e2bb68-27aa-4e6b-95ab-c9fc9b4ab6fc-master.m3u8https://nicecrew.tv/videos/embed/87szB5KCAUdamFwRnYBbNp1215162026-02-09T21:39:04.556ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/dbjH521cSh1JCBCcTMK6xEhttps://nicecrew.tv/lazy-static/thumbnails/00b4dd72-2c71-4f2a-8782-efcb2661e8a5.jpgFedi Fumble 3The third Tournament of Fedi Fumble! See you all in 6 months!https://cdn.nicecrew.tv/streaming/hls/629ea182-092d-46c5-8c00-e21944781a08/20035be0-28f6-4c93-b493-18a36be54559-master.m3u8https://nicecrew.tv/videos/embed/dbjH521cSh1JCBCcTMK6xE121180262026-02-10T01:39:19.340ZYESBadmin GamingNOhttps://nicecrew.tv/w/pUH3Ceh32UKH1p1JEJJfYkhttps://nicecrew.tv/lazy-static/thumbnails/05a43a82-3ca5-4bb0-9ae7-2b08e15d36c4.jpgThe Elijah Schaffer, Sarah Stock, & GriftTV CrashoutThe Elijah Schaffer, Sarah Stock, & GriftTV Crashouthttps://cdn.nicecrew.tv/streaming/hls/c19e2906-7cfb-448c-abb0-4b5969d6432b/c59b059d-196b-4b47-80a1-a59a6a8fa5d1-master.m3u8https://nicecrew.tv/videos/embed/pUH3Ceh32UKH1p1JEJJfYk330201522026-02-18T01:46:00.656Zsarah stockelijah schaffergriftersinfluencersYESRadix Verum ☦NOhttps://nicecrew.tv/w/1ed2XwzMSL1SUtfDFRkGCLhttps://nicecrew.tv/lazy-static/thumbnails/4db416ae-443a-4711-84b1-d9cc823f652b.jpg9VeilMaid - Fighting For HopeA song about Nein-Na fighting the cynical monsters. Please enjoy.https://cdn.nicecrew.tv/streaming/hls/01d815c7-2e7b-4c51-899b-00d81abf579c/9fe8cda1-fe1e-4c3e-a06d-567477e9d53e-master.m3u8https://nicecrew.tv/videos/embed/1ed2XwzMSL1SUtfDFRkGCL320022026-02-19T15:02:00.159ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/wQH6BSYB3cK4xM5UqXutNxhttps://nicecrew.tv/lazy-static/thumbnails/d3f6d9a4-e453-46df-a26d-eb41bbbfbd0b.jpgThe Epstein Sweep Up ContinuesJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://cdn.nicecrew.tv/streaming/hls/f9bf3007-0658-4ce6-84c5-94e310a4d527/4a3200d0-ab32-4824-9b7f-c799d84afb4d-master.m3u8https://nicecrew.tv/videos/embed/wQH6BSYB3cK4xM5UqXutNx604502026-03-21T14:07:30.291ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/9FfdVY25wH6x72jUMukosMhttps://nicecrew.tv/lazy-static/thumbnails/be7b2936-7e67-4b4a-a2ed-efacfd9a9244.jpgThe Epstein Sweep Up ContinuesThe Epstein Sweep Up Continueshttps://cdn.nicecrew.tv/streaming/hls/4643e1aa-76c3-444d-9bf1-d4cee186c601/c85d64de-90a9-4b21-85f0-4da38e69dba9-master.m3u8https://nicecrew.tv/videos/embed/9FfdVY25wH6x72jUMukosM6040762026-02-20T00:38:24.951ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/tMMYaNES3JPF3X858yEvqzhttps://nicecrew.tv/lazy-static/thumbnails/a91d3a0a-f815-421b-b375-04254e602ffd.jpgStyxhexenhammer666 & the Perils of the OccultStyxhexenhammer666 & the Perils of the Occulthttps://cdn.nicecrew.tv/streaming/hls/e10b8ae2-beda-4bde-a0fc-9471acb73f75/808e3352-25c4-4a5e-b563-8f4ee8cd33ae-master.m3u8https://nicecrew.tv/videos/embed/tMMYaNES3JPF3X858yEvqz154851662026-02-23T01:10:19.535ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/mNuGAoGbx7uZMi3BSbBwJ3https://nicecrew.tv/lazy-static/thumbnails/a6f0af5f-e4a3-4f20-93fc-8e157ad1e48c.jpgCustomizing my Love Labubu dollA simple labubu customizing video, it’s only text based because I don’t want to use my sick voice, and I might as well schedule those video to release on Monday. Please enjoy! I might make a video of me customizing my cola lafufu, but I’m still working on it offline and taking photos of it online. Creative commons for Jason Shaw’s music.https://cdn.nicecrew.tv/streaming/hls/a874ac6d-a9c1-4b26-b498-608c5824d9d6/90b5315b-c2d1-44c5-8022-3d7ea055301b-master.m3u8https://nicecrew.tv/videos/embed/mNuGAoGbx7uZMi3BSbBwJ3429012026-02-23T01:11:21.953ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/3xM17nfAh3oHwxrFhiJEiqhttps://nicecrew.tv/lazy-static/thumbnails/f64083ee-d568-4098-a9e4-7b79ffad2f10.jpgPimptard Trump Was Wifestituted by the Left | Live From The LairWe apologize for the quality of the video. Popp doesn’t know how to pull focus, but he does know how to talk. #Redonkulas #CultureWar #PimptardWifestituteShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesday and Thursday at 8pm Eastern time! And Supporter Sunday streams for Locals, Odysee, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://cdn.nicecrew.tv/streaming/hls/14a2114d-af2f-45ca-b0c1-f9de8719732a/7edab766-dae1-43d8-91a0-1c3dcdec97e7-master.m3u8https://nicecrew.tv/videos/embed/3xM17nfAh3oHwxrFhiJEiq761032026-02-23T23:54:26.349ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/7AYHg4hX8CPqDkKR948Cm5https://nicecrew.tv/lazy-static/thumbnails/5a243b07-aa94-46bf-b379-9deeeae97aa7.jpgTyler Oliveira - I Exposed New Jersey's Jewish Invasion...[Tyler Oliveira](https://x.com/tyleraloevera) exposes the stark in group preference of jews in New Jersey, compared to what they preach. Mirror from [YouTube](https://www.youtube.com/watch?v=cubO0lhOMcs).https://cdn.nicecrew.tv/streaming/hls/357911dc-1dba-4fc8-881f-7b1346ca0ba4/a96cdead-fce4-4e0a-87e0-6a60dfba6bd9-master.m3u8https://nicecrew.tv/videos/embed/7AYHg4hX8CPqDkKR948Cm54413542026-02-25T00:46:58.000ZYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/qC33CEguHbUfoC39ybGAHFhttps://nicecrew.tv/lazy-static/thumbnails/582a139b-4f1c-40a7-96a5-994201f9597e.jpgBlue Bawls and Other Shenanigans | Grunt Speak Live400 unprotected pink pastries and she gets knocked up? Who knew?! The Wheels of Woe spin without mercy tonight at 8pm EST! #Redonkulas #WheelsofWoe #ModernWomenShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, Odysee, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://cdn.nicecrew.tv/streaming/hls/c7635d33-b49c-491d-893f-0768b98cd419/0a50dc4a-cf92-41e8-856d-9c3f07d26387-master.m3u8https://nicecrew.tv/videos/embed/qC33CEguHbUfoC39ybGAHF119532026-02-26T22:49:40.770ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/hVofchkTFamUAhfnWF7gpPhttps://nicecrew.tv/lazy-static/thumbnails/874ae279-b742-41de-8c7d-aca8f442b97d.jpgShowcasing my Lafufu custom and moreI slightly more better version of this video, hopefully you all enjoy this video as well too. I’ll continue on my art and animations for this channel too.https://cdn.nicecrew.tv/streaming/hls/890658e0-5e8f-4c75-8ccf-e7b74d26aee1/667f1b14-7f1d-490b-8c73-412086146383-master.m3u8https://nicecrew.tv/videos/embed/hVofchkTFamUAhfnWF7gpP506012026-03-01T05:44:52.995ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/nXnEdeY8fjmNaNfEpNxTZdhttps://nicecrew.tv/lazy-static/thumbnails/123c634d-4f78-4a32-82ee-e1adf4c77d1b.jpgJesus Subscribes to My Spicy Content | Grunt Speak LiveHoly (rhymes with) born again hypocrisy, Batman! This and two new lives saved tonight at 8pm EST! #Redonkulas #CultureWar #ModernWomenShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in for Grunt Speak Live Tuesdays and Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, Odysee, and SubscribeStar members only! All sources are available on Redonkulas.com! Show lesshttps://cdn.nicecrew.tv/streaming/hls/b1cb2abb-b069-4280-b650-27dbe14d50ba/b6fe3ec8-fafb-4950-a57b-13c2097acd82-master.m3u8https://nicecrew.tv/videos/embed/nXnEdeY8fjmNaNfEpNxTZd16012026-03-05T20:25:53.879ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/whVgBQhmxS88kYby3B9hQUhttps://nicecrew.tv/lazy-static/thumbnails/aa6963ba-ed90-4d02-9afd-86e713bdd60f.jpgMOAR Shenanigans!!! | Grunt Speak LiveBeen a crazy week, and its only Thursday...let's decompress with some fun, jokes, a Drunken Uncle, an Angry Battle Hobbit and a Drunken Button Pushing MonkeyShow more #BRRRRRT #Shenanigans #Redonkulas To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesdays - Thursdays at 8pm Eastern And Supporter Sunday streams for Locals and SubscribeStar members only! Show lesshttps://cdn.nicecrew.tv/streaming/hls/f54ee373-1caf-4789-b3aa-27813f1c8e04/2c7f0384-75cd-4f43-8e70-6f198d8f373a-master.m3u8https://nicecrew.tv/videos/embed/whVgBQhmxS88kYby3B9hQU92012026-03-12T11:59:04.402ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/ijzhxz6f9CnhAGpg5TrAHYhttps://nicecrew.tv/lazy-static/thumbnails/4caed5fa-dde9-4d26-a4a5-d7e036c52aa9.jpgGypsy Crusader vs Supah Hot Fire - Full FightWhat does it take to become one of these brands anyway?https://cdn.nicecrew.tv/streaming/hls/8c434201-ef94-4f11-8029-30e2128f3a22/238431ec-33e6-41bd-9981-132310f626f1-master.m3u8https://nicecrew.tv/videos/embed/ijzhxz6f9CnhAGpg5TrAHY12505902026-03-15T14:49:18.304ZGypsy CrusaderFightBoxingYESMatty's Autism EmporiumNOhttps://nicecrew.tv/w/52TyoPfxtbN3Pox2tVH1rUhttps://nicecrew.tv/lazy-static/thumbnails/e731d2b8-1048-4441-a1e6-e94aaa94afe8.jpgTime Laspe: Unit 5410A quick time laspe video since I’m busy with other videos. Please enjoy! (Creative Commons for the music by Jason shaw) Finished Drawing: https://www.side7.com/content/6zMO6QR19qhttps://cdn.nicecrew.tv/streaming/hls/20a8128d-48ad-4ecb-88a9-e01d863a5236/60897f53-69dd-486a-a51c-5d38d0246977-master.m3u8https://nicecrew.tv/videos/embed/52TyoPfxtbN3Pox2tVH1rU81022026-03-20T00:41:28.973ZarttimelaspeYESDreamy's LoungeNOhttps://nicecrew.tv/w/7GnjbYsNpc14TPCktHsbMBhttps://nicecrew.tv/lazy-static/thumbnails/06448882-4201-45ae-a47d-5421aad0aaa0.jpgStyxhexenhammer666 & The Perils of the OccultJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://cdn.nicecrew.tv/streaming/hls/3639b7bd-9a2e-4e98-a0b9-cdc521d37efd/62a0586d-636b-4671-9c7b-438758e11e9c-master.m3u8https://nicecrew.tv/videos/embed/7GnjbYsNpc14TPCktHsbMB15485222026-03-21T14:19:49.479ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/hr5AsXW4yoo6SQqXiKMxyYhttps://nicecrew.tv/lazy-static/thumbnails/4c44b302-22b0-4835-9028-ab577e94af3b.jpg20 More Hilarious Made-Up Words to Describe How F*cked We AreOnce again, it’s time to add to the Poppinomicon. #Redonkulas #CultureWar #PoppinomiconShow more Brought to you by “I Don’t Want a Thre*some With Jesus” Check it out on Amazon: https://tinyurl.com/jesus-cappy To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in for Grunt Speak Live Tuesdays and Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, Odysee, and SubscribeStar members only! All sources are available on Redonkulas.com! Episode Throwbacks Don’t Ignore the Crazy https://www.youtube.com/watch?v=20mWTD0FK3A Crazy Cutaway https://www.youtube.com/watch?v=pMEdK0RgEn4 Testiculus Redonkulitis https://www.youtube.com/watch?v=0xWvV7MMm_U Show lesshttps://cdn.nicecrew.tv/streaming/hls/8512a4e3-bcfd-4024-8a51-aee0ae5b34ec/3f9cb8fe-0afd-493e-8d43-1081185dc37f-master.m3u8https://nicecrew.tv/videos/embed/hr5AsXW4yoo6SQqXiKMxyY14125202026-03-30T18:26:37.234ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/uMdLpRYSVGowtskUzawY5Lhttps://nicecrew.tv/lazy-static/thumbnails/7c03298f-5183-4264-b85d-48d1beac2e8f.pngTOTAL CLANKER DEATH - Modded Battlefront II - Kyber Launcher - 3/31/2026, 11:05:22 PMTHE EMPIRE DID NOTHING WRONGhttps://cdn.nicecrew.tv/streaming/hls/e9103822-c345-4405-b147-22a9af649d54/c42c0a3f-6a83-41d2-b965-ad605af542c3-master.m3u8https://nicecrew.tv/videos/embed/uMdLpRYSVGowtskUzawY5L4868012026-04-01T00:34:45.364Zbattlefrontgaminglivestar warsYESPRÆDÆ VENATORES ™NOhttps://nicecrew.tv/w/7TokDWsoxmiFjjLRZRFGBihttps://nicecrew.tv/lazy-static/thumbnails/0f27bd7d-de67-44af-a7ac-f3fb1862e915.pngTOTAL CLANKER DEATH - Modded Battlefront II - Kyber Launcher - 4/1/2026, 12:26:32 AMTHE EMPIRE DID NOTHING WRONGhttps://cdn.nicecrew.tv/streaming/hls/37c387f2-813c-4368-9720-9d84238e8ca7/e481d389-b007-4c20-a6a8-24dee8e65c67-master.m3u8https://nicecrew.tv/videos/embed/7TokDWsoxmiFjjLRZRFGBi447542026-04-01T00:41:04.843Zbattlefrontgaminglivestar warsYESPRÆDÆ VENATORES ™NOhttps://nicecrew.tv/w/t3X1MhkH9xEmDS83Pnvjo6https://nicecrew.tv/lazy-static/thumbnails/a333e136-d3cd-43da-9064-0cdc4dfba7bd.jpgTime Laspe: Empty Swaddle and fluffy angelJust wanted to make a quick tome lapse video for this month. Please enjoy. I still hope to make another song for next month at least. -Illustration will be posted later- Creative commons for the musichttps://cdn.nicecrew.tv/streaming/hls/db102275-c3ec-4b4d-a8ac-ad08dff8ccc1/69b0bbbf-3393-4a14-97a5-92128fdd97a3-master.m3u8https://nicecrew.tv/videos/embed/t3X1MhkH9xEmDS83Pnvjo674012026-04-01T00:47:26.666ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/5cBnwXSH3MuxZSnScfjQ16https://nicecrew.tv/lazy-static/thumbnails/1a3ae7ec-9d96-4388-9e93-0bf2300399b8.pngStar Wars Battlefront II - Kyber Mods - Battlefront PlusShowing a few custom weapons, skills, and the absolute chud Thrawnhttps://cdn.nicecrew.tv/streaming/hls/220388d0-82e0-4035-ba1e-223b85736f55/dce34623-1c58-4a1d-ad20-5d000a95a468-master.m3u8https://nicecrew.tv/videos/embed/5cBnwXSH3MuxZSnScfjQ16248082026-04-07T19:29:57.492Zgamingstar warsbattlefrontYESPRÆDÆ VENATORES ™NOhttps://nicecrew.tv/w/riy3ro6PVoURTTr54DJxHRhttps://nicecrew.tv/lazy-static/thumbnails/3bbbebcc-764f-45bd-845c-62c8df041d1a.jpgI talk about Rain Ambience plus speedpaintHere’s a talking video for tonight, or in the morning depending on the date. Please enjoy! Finished drawing: https://www.side7.com/content/2Br2XP50M7 Creative commons for the music, by Jason Shawhttps://cdn.nicecrew.tv/streaming/hls/cce7db70-dc92-4205-af5b-bc0355fb3417/cffa5edc-9518-4efd-87c7-0af5d355913d-master.m3u8https://nicecrew.tv/videos/embed/riy3ro6PVoURTTr54DJxHR247012026-04-09T04:45:34.975ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/7HjWvT3BEpWHyJh3mMLqQghttps://nicecrew.tv/lazy-static/thumbnails/4583a0c9-5982-4d74-838f-85deaf93d1b8.jpgHivelord takedownHivelord takedownhttps://cdn.nicecrew.tv/streaming/hls/365bffa8-baf2-48c9-9b0d-4124ac3023ff/4a8ee5c3-6f39-45c8-b589-d747eb3df805-master.m3u8https://nicecrew.tv/videos/embed/7HjWvT3BEpWHyJh3mMLqQg2004072026-04-12T01:01:50.114ZYESMain omega_variant channelNOhttps://nicecrew.tv/w/sufBpuiiv1n63XuTpoyXFjhttps://nicecrew.tv/lazy-static/thumbnails/7c3f5bd8-4642-4faa-9d9b-ae9169f84332.jpg“My Promiscuous Wife Found Jesus!”: Virgin Simp Brags About Taking LeftoversThe most important decision is a man’s life is picking a wife. Pretty sure this dude failed. #Redonkulas #CultureWar #ModernWomenShow more Brought to you by “I Don’t Want a Thre*some With Jesus” Check it out on Amazon: https://tinyurl.com/jesus-cappy To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in for Grunt Speak Live Tuesdays and Thursdays at 8pm Eastern And Supporter Sunday streams for Locals, Odysee, and SubscribeStar members only! All sources available on Redonkulas.com! Episode Throwbacks Testiculus Redonkulitis https://www.youtube.com/watch?v=0xWvV7MMm_U Larping Lesbian https://www.youtube.com/watch?v=4_g4Cm-3fOE Life When You’re Stupid https://www.youtube.com/watch?v=evLSsszANtQ Show lesshttps://cdn.nicecrew.tv/streaming/hls/d67f6f49-a344-4b3e-a5f8-2c5d0a92fd24/780f71f3-af52-49c1-b750-48931a6a056f-master.m3u8https://nicecrew.tv/videos/embed/sufBpuiiv1n63XuTpoyXFj1958012026-04-13T16:51:44.834ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/9jHV7x6TUJULqaNrjbiYL6https://nicecrew.tv/lazy-static/thumbnails/0882b0d2-9864-4ca6-b009-1f6a9a730b3b.jpgDefoko Utane/Uta Utane - Sakura Cover vocalA little video of Defoko singing a Japanese Folk tale song. The translation is from this video originally: https://youtu.be/0pFKXWvh6LU?si=3YPZuIoPViZazj0- I'll hopefully add a thumbnail for this video later. I'll probably still experiment with using Defoko more since I'm still slowly learning Japanese myself.https://cdn.nicecrew.tv/streaming/hls/43665421-1a05-4ebe-915b-2892b66536a5/31064d23-dcbc-4f3c-a031-024e6a36c448-master.m3u8https://nicecrew.tv/videos/embed/9jHV7x6TUJULqaNrjbiYL640002026-04-15T10:45:23.983ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/nipHUnTVzJwgv2vLwnLuWShttps://nicecrew.tv/lazy-static/thumbnails/eab7a619-af3f-4039-8dfc-8a4121b45858.jpgUltimate Betrayal: Boogaloo Boi Mike Dunn Admits Being FBI Rat for YearsMike Dunn, the self-proclaimed Boogaloo Boi leader, fully admits he was an FBI informant from 2020-2023. In his own words, he snitched on patriots and veterans the entire time while pretending to be one of them. This is the ultimate betrayal exposed — the man they looked up to was working for the feds the whole time. Full rant + breakdown in the video. #MikeDunn #BoogalooBoi #FBIInformant #Exposed Join this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://cdn.nicecrew.tv/streaming/hls/ac7e2ce9-95d0-4f2a-9edf-7aabbbc898ce/ac28bee5-61a3-40b8-a0da-2d5f97e1e452-master.m3u8https://nicecrew.tv/videos/embed/nipHUnTVzJwgv2vLwnLuWS530452102026-04-16T20:15:55.193ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/2dcxZ8nqHepBLFQqqtaLowhttps://nicecrew.tv/lazy-static/thumbnails/526f361a-feba-4d5e-8926-13589266f6ce.jpgSong Preview 8An attempt at making a post punk song, I might listen to most post-punk music, since it’s been a while since I listened to that kind of music.https://cdn.nicecrew.tv/streaming/hls/09cd2ec8-3ef5-45ec-8bde-f987dd315b62/e71fb680-ed11-4866-98e3-8f1c0e9b65c2-master.m3u8https://nicecrew.tv/videos/embed/2dcxZ8nqHepBLFQqqtaLow139002026-04-16T20:45:10.630ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/jT5gMGyr9gSFw9btadrZi6https://nicecrew.tv/lazy-static/thumbnails/b6fc5488-afc9-4922-ad31-5828c2c249b7.jpgMessage to FBI Informant Mike DunnMessage to FBI Informant Mike Dunnhttps://cdn.nicecrew.tv/streaming/hls/98e60f9d-0a17-4080-8b2a-84da9edf5feb/827d242e-4341-49f3-bf0e-ee32365fc093-master.m3u8https://nicecrew.tv/videos/embed/jT5gMGyr9gSFw9btadrZi6495132026-04-16T23:44:55.975ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/iruQSNW3dyaBSiK1ssMGpBhttps://nicecrew.tv/lazy-static/thumbnails/d746d332-19a1-4834-988d-db69e652c926.jpg9VeilMaid - Bitter SnowflakesJust wanted fo finish up this song since it’s been sitting in my ipad for too long. I hope you all enjoy at least. Song made using GarageBandhttps://cdn.nicecrew.tv/streaming/hls/8d3ab9f5-f20f-4666-a05a-32f414cd0e61/3bf25fe5-c478-4503-9c28-01f34b42780b-master.m3u8https://nicecrew.tv/videos/embed/iruQSNW3dyaBSiK1ssMGpB285002026-04-23T22:04:57.726ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/pnjrcRA3XuY9wCAcfYnhNFhttps://nicecrew.tv/lazy-static/thumbnails/30fd4f41-8210-48ba-b6dd-1f2d7190d3ce.pngFar Far West - WE WUZ COWBOYZJust a regular mission with some extra crumbs habbening.https://cdn.nicecrew.tv/streaming/hls/bd3c2b46-de22-4148-b13f-e7da05d6e61b/efa63661-bc16-4b2d-a6c1-fb65379570cd-master.m3u8https://nicecrew.tv/videos/embed/pnjrcRA3XuY9wCAcfYnhNF904022026-04-29T20:46:55.521Zgamingindiefar far westfpsYESPRÆDÆ VENATORES ™NOhttps://nicecrew.tv/w/976ch9tM59CbDuaiubpTPThttps://nicecrew.tv/lazy-static/thumbnails/5bd2747e-746e-484e-888e-a751661c84cc.jpgTime Laspe - Pink AlienA time laspe video where I made an illustration using newly bought paint markers, and used water color paints for the background. Please enjoy. ——— Finished drawing: https://www.side7.com/content/PXrd7Ona80https://cdn.nicecrew.tv/streaming/hls/41a2c5e9-a66e-4714-8db9-92beae6f517d/91e48133-2ee1-48c0-8c9a-640f2f790c61-master.m3u8https://nicecrew.tv/videos/embed/976ch9tM59CbDuaiubpTPT83002026-05-02T08:41:08.457ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/fVMngvwJV5w1Vs91nS8EjThttps://nicecrew.tv/lazy-static/thumbnails/c9b58a89-1e0d-469a-a2c4-d6d13cac198a.jpgHave you played this elementary school bead game?This was an ancient blood memory unlocked when my grandmother was visiting about a school yard game we would play with beads and whatever kind of board this is. Here's an example playing of it, and it was really fun trying to figure out how it's actually played from memory and play testing, just wondering if anyone had played this before and knew what it was called or if I got some rules wrong. I shit myself while typing this by the way!https://cdn.nicecrew.tv/streaming/hls/78e251ba-faae-4067-b478-e75a5f9481f7/83aba870-92ba-4af3-979a-24bd3076029b-master.m3u8https://nicecrew.tv/videos/embed/fVMngvwJV5w1Vs91nS8EjT190572026-05-03T02:36:52.374ZYESBrother TylerNOhttps://nicecrew.tv/w/8ot5J9HfYvJD7BWyguHDyuhttps://nicecrew.tv/lazy-static/thumbnails/5b3247d7-bdd8-4249-8cef-d10d983e0db6.jpgWhy So Many Men Choose Self-DeletionSoy-ciety literally sets men up to fail with a trifecta of misery. #Redonkulas #CultureWar #SelfDeletionShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesday and Thursday at 8pm Eastern time! And Supporter Sunday streams for Locals, Odysee, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://cdn.nicecrew.tv/streaming/hls/3bd305eb-7ae9-456a-9d08-5c7d126bc218/d79d96c4-c7b5-4066-bc56-99e22b6fe7c6-master.m3u8https://nicecrew.tv/videos/embed/8ot5J9HfYvJD7BWyguHDyu1035012026-05-04T14:25:09.891ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/gXZPvANW42wKYdbhPByqNPhttps://nicecrew.tv/lazy-static/thumbnails/e52b1a4e-b2fc-4ed8-9337-26e2f195b5dc.jpgThe SPLC Indictment Just Reopened a VERY Dangerous StoryJoin this channel to get access to perks: https://www.youtube.com/channel/UCaCK9mXMXCSzPlRTrZrQ8Hg/join Support my work!: Venmo: https://venmo.com/radixverum Cash App: https://cash.app/$RadixVerum DonorBox: https://donorbox.org/support-radix Locals: https://radixverum.locals.com My links: https://twitter.com/NotRadix https://radixverum.substack.com/ Thanks for watching my content friends!https://cdn.nicecrew.tv/streaming/hls/814a9e9b-b37c-4934-b054-e3d6ccd6018b/93bb5b3e-6634-452d-83bf-4107fddc246c-master.m3u8https://nicecrew.tv/videos/embed/gXZPvANW42wKYdbhPByqNP27020572026-05-08T23:16:42.524ZYESRadix Verum ☦NOhttps://nicecrew.tv/w/gADzRAYfu33ASvrSumoRoDhttps://nicecrew.tv/lazy-static/thumbnails/ddd83c57-c9be-44e2-a996-45b5abab0065.webpFOIDFIELD: #3 GREEN LADYFOIDFIELD: #3 GREEN LADYhttps://cdn.nicecrew.tv/streaming/hls/7e4f87a5-33a6-4535-a284-5a039c3cd335/63fc1558-2542-4d46-a134-d9bd14871fb6-master.m3u8https://nicecrew.tv/videos/embed/gADzRAYfu33ASvrSumoRoD40032026-05-10T00:22:46.670Zgamingarknightsendfieldfoidfield#3YESPRÆDÆ VENATORES ™NOhttps://nicecrew.tv/w/mivczHcugnNaDL6fuMTQunhttps://nicecrew.tv/lazy-static/thumbnails/d36e1f7a-c824-4f85-9655-68c4c4bfc256.jpgtime laspe - Root Beer Fluffish plus talkingA video about me talking about root beer, with b-roll footage of a fluffish that’s themed around my favorite soft drink. I added a mild epilepsy warning in the tile because it goes a little fast near the end in the video. Please let me know if I should change that, it wouldn’t hurt to be cautious though. ——— Creative commons for the music. Finished drawing: https://www.side7.com/content/5bMNLRLVrehttps://cdn.nicecrew.tv/streaming/hls/a4686987-dfed-46b6-9c5f-dbc7f6d97a75/d2c01324-0607-4d23-9142-9efb1e2b26b9-master.m3u8https://nicecrew.tv/videos/embed/mivczHcugnNaDL6fuMTQun208002026-05-10T05:31:33.521ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/nKZaJK2CigFPztfm15rWA4https://nicecrew.tv/lazy-static/thumbnails/7a17f36b-04d6-415e-bdb0-3f5be383f998.jpgWasted Your 20s? How to Kill Regret & FINALLY Launch Your LifeIt can be a brutal truth to realize you’ve wasted the one thing we can’t get back. Learn to forgive yourself and drive on. #Redonkulas #MaleImprovement #WastedTimeShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesday and Thursday at 8pm Eastern time! And Supporter Sunday streams for Locals, Odysee, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://cdn.nicecrew.tv/streaming/hls/b0341ffb-2d65-460c-9e53-d7c685393877/d7d423c3-001a-4fbd-a6aa-4806e33ba0cf-master.m3u8https://nicecrew.tv/videos/embed/nKZaJK2CigFPztfm15rWA4776002026-05-11T17:58:43.688ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/hrno34ydn2T6LtmfUWtFfrhttps://nicecrew.tv/lazy-static/thumbnails/7fed5058-812f-433c-8b76-e32fcc066ca6.jpgKiller 5 minute cheese sauceEasy! https://cdn.nicecrew.tv/streaming/hls/851cfd18-882f-446f-8948-44fcbb5f8459/c327460c-e19c-462e-9fc3-9ac339c14bcc-master.m3u8https://nicecrew.tv/videos/embed/hrno34ydn2T6LtmfUWtFfr3555152026-05-16T00:00:43.193ZYESBrother TylerNOhttps://nicecrew.tv/w/metpXz4pJXygcdu9H3VUzRhttps://nicecrew.tv/lazy-static/thumbnails/c0709056-6c3a-44b3-9613-d2b801186045.jpgMy Brother’s Girlfriend is the Oil Camp Harlot Who Took 36 Guys in a RowShould I speak up before she becomes family? #Redonkulas #TrueStory #ModernWomenShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesday and Thursday at 8pm Eastern time! And Supporter Sunday streams for Locals, Odysee, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://cdn.nicecrew.tv/streaming/hls/a3d8560b-9fec-4e99-9f28-d015c6309c03/463701ca-f261-4cd3-8e7d-54319fcb16b6-master.m3u8https://nicecrew.tv/videos/embed/metpXz4pJXygcdu9H3VUzR8820122026-05-18T16:03:36.899ZYESRedonkulas RegimentNOhttps://nicecrew.tv/w/u87QpCmfn2NyhrqBADPhd8https://nicecrew.tv/lazy-static/thumbnails/4b69162c-1534-4514-9386-2e32b05f0c7e.pngShowcasing My Custom BJDJust showing a custom BJD using air dry clay, tinfoil and some masking tape. I’m still pretty confident with how this is looking. It’s been a long time since I used clay, so I’m looking forward to claying up the the other limbs. I’m still keeping white elastic string and aves epoxy clay in the back of my mind too. Please enjoy!https://cdn.nicecrew.tv/streaming/hls/e3be4d04-57d2-47d7-ac50-3a3c21c1d4a7/cd6d8e5c-c73e-4712-877b-69c6381e0037-master.m3u8https://nicecrew.tv/videos/embed/u87QpCmfn2NyhrqBADPhd8304022026-05-19T23:32:30.568ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/pA8aPmqGtoLJjp28kRTmikhttps://nicecrew.tv/lazy-static/thumbnails/6e183523-955f-4dfe-ab5e-c6202b6289b7.pngwarhammer skulls 2026, and then perfect order or Ascended Heros - 5/22/2026, 1:02:54 AMDono Link https://nicecrew.tv/p/nctv-gibs/subscribe?creatorId=400 alternate channels https://nicecrew.tv/c/zeke_kyle_channel/videos Socials https://nicecrew.digital/@Zeke_kyle https://x.com/Ez_Kyle2https://cdn.nicecrew.tv/streaming/hls/bf05e543-d2d3-4d50-b423-555ad08ac4e5/200fb07f-caa6-4366-8cde-95088cce5427-master.m3u8https://nicecrew.tv/videos/embed/pA8aPmqGtoLJjp28kRTmik7567022026-05-24T12:16:14.560ZYESZeke KyleNOhttps://nicecrew.tv/w/btqXjVd88hnVzphLQzVBCthttps://nicecrew.tv/lazy-static/thumbnails/8dcc12d1-b5d5-4a99-b305-447df18603a7.jpg9VeilMaid - Dripping PessimismA gloomy song about rain and pessimism. Please enjoy. I only used the electric piano with sustainhttps://cdn.nicecrew.tv/streaming/hls/54cfd8c6-5ca7-49c5-a637-c99d117bc387/e4488a7b-27c2-4232-87eb-2d3f03dffad4-master.m3u8https://nicecrew.tv/videos/embed/btqXjVd88hnVzphLQzVBCt340002026-05-27T02:59:15.321ZYESDreamy's LoungeNOhttps://nicecrew.tv/w/iGKdquuw98KHSRKqncp1Gwhttps://nicecrew.tv/lazy-static/thumbnails/7628669d-2bce-46c5-95ba-1782c29b0d07.jpg02 S10 zr2 front suspension rebuild showcaseQuick run through of my rebuild with some torque specs and ramblings.https://cdn.nicecrew.tv/streaming/hls/8f5bbd5d-2628-4af5-97bc-651642412316/27123a78-e4d4-4e64-9794-9fc3933de94d-master.m3u8https://nicecrew.tv/videos/embed/iGKdquuw98KHSRKqncp1Gw414032026-05-31T16:47:23.677ZYESMain omega_variant channelNOhttps://nicecrew.tv/w/2PH2NAcJdZy153xLLoiS9ghttps://nicecrew.tv/lazy-static/thumbnails/dfc56d67-cdf3-46ef-bf00-d8ee5bd57760.jpgEx-Wife Has Cancer… Now My Alienated Kids Are Back Home (But They Hate Me)Popp gets a heart-wrenching letter that hits close to home. What should he do? #Redonkulas #TrueStory #ModernWomenShow more To donate to this content, see our list of channels, purchase merchandise or join Popp’s Preppers, click here: https://linktr.ee/redonkulas Send physical donations to: Redonkulas.com Productions 29488 Woodward Avenue, Unit 407 Royal Oak, MI 48073 If you write a check, make it out to Second Class Citizen, 501c3 All donations are tax deductible And be sure to tune in to see the Redonkulas Regiment Live! Tuesday and Thursday at 8pm Eastern time! And Supporter Sunday streams for Locals, Odysee, and SubscribeStar members only! All sources available on Redonkulas.com! Show lesshttps://cdn.nicecrew.tv/streaming/hls/0ec261d5-1e28-45d0-84d6-f0f7379eb8ef/32f29b4a-7479-4deb-aa3f-c67aade05c91-master.m3u8https://nicecrew.tv/videos/embed/2PH2NAcJdZy153xLLoiS9g959052026-06-01T15:42:14.347ZYESRedonkulas RegimentNOhttps://nicecrew.tv/c/mattys_autism_emporium/videoshttps://nicecrew.tv/c/cybershells_cyberstreams/videoshttps://nicecrew.tv/c/brother_tyler/videoshttps://nicecrew.tv/c/matty_gaming/videoshttps://nicecrew.tv/c/skizm_channel/videoshttps://nicecrew.tv/c/bigtlarrity_channel/videoshttps://nicecrew.tv/c/omega_variant_channel/videoshttps://nicecrew.tv/c/coffee_channel/videoshttps://nicecrew.tv/c/radix_verum_channel/videoshttps://nicecrew.tv/c/thymeandplace_channel/videoshttps://nicecrew.tv/c/based_lord_channel/videoshttps://nicecrew.tv/c/nips_channel/videoshttps://nicecrew.tv/c/audiobible/videoshttps://nicecrew.tv/c/just_joe_radio/videoshttps://nicecrew.tv/c/mark_frye_/videoshttps://nicecrew.tv/c/nnr/videoshttps://nicecrew.tv/c/krac/videoshttps://nicecrew.tv/c/pastorshadilay/videoshttps://nicecrew.tv/c/d0c40r0_channel/videoshttps://nicecrew.tv/c/szeklerland_channel/videoshttps://nicecrew.tv/c/thymeandplac3_channel/videoshttps://nicecrew.tv/c/gk_anime_dungeon/videoshttps://nicecrew.tv/c/fireandforget_channel/videoshttps://nicecrew.tv/c/cocktails_channel/videoshttps://nicecrew.tv/c/exnihilo_channel/videoshttps://nicecrew.tv/c/redpilledradio/videoshttps://nicecrew.tv/c/snidely_whiplash_channel/videoshttps://nicecrew.tv/c/redonkulasregiment_channel/videoshttps://nicecrew.tv/c/apocrypha/videoshttps://nicecrew.tv/c/owl_channel/videoshttps://nicecrew.tv/c/killyourtv_channel/videoshttps://nicecrew.tv/c/caudill_channel/videoshttps://nicecrew.tv/c/morbeus_channel/videoshttps://nicecrew.tv/c/cosmonautkatyusha_channel/videoshttps://nicecrew.tv/c/teknoskillz_channel/videoshttps://nicecrew.tv/c/capt._fuggeta_channel/videoshttps://nicecrew.tv/c/house_of_fishfuk/videoshttps://nicecrew.tv/c/jolly_rancher_channel/videoshttps://nicecrew.tv/c/poastaljen_channel/videoshttps://nicecrew.tv/c/lolocaustianity_channel/videoshttps://nicecrew.tv/c/cowanon_channel/videoshttps://nicecrew.tv/c/reichsgesetz/videoshttps://nicecrew.tv/c/kidnap_and_kill/videoshttps://nicecrew.tv/c/kaptainkisty_channel/videoshttps://nicecrew.tv/c/sapphire_star/videoshttps://nicecrew.tv/c/bluenippledwench_channel/videoshttps://nicecrew.tv/c/decayable_channel/videoshttps://nicecrew.tv/c/stardust-1_channel/videoshttps://nicecrew.tv/c/formerly_trucks_channel/videoshttps://nicecrew.tv/c/pixie-1_channel/videoshttps://nicecrew.tv/c/legionofclowns/videoshttps://nicecrew.tv/c/awivr_channel/videoshttps://nicecrew.tv/c/purple_deer77_channel/videoshttps://nicecrew.tv/c/cobaltsasquatch_channel/videoshttps://nicecrew.tv/c/cobaltsasquatchfoundry/videoshttps://nicecrew.tv/c/sister_mads/videoshttps://nicecrew.tv/c/blankdeblank-1_channel/videoshttps://nicecrew.tv/c/flanker_channel/videoshttps://nicecrew.tv/c/deepstatiklabs_channel/videoshttps://nicecrew.tv/c/kektoonslive/videoshttps://nicecrew.tv/c/praxisofevil_channel/videoshttps://nicecrew.tv/c/nicecrew_bot_channel/videoshttps://nicecrew.tv/c/erwiflooooooow/videoshttps://nicecrew.tv/c/zeke_kyle_channel/videoshttps://nicecrew.tv/c/caverntavern/videoshttps://nicecrew.tv/c/randbot2020/videoshttps://nicecrew.tv/a/matty/video-channelshttps://nicecrew.tv/a/cybershell/video-channelshttps://nicecrew.tv/a/tyler/video-channelshttps://nicecrew.tv/a/skizm/video-channelshttps://nicecrew.tv/a/bigtlarrity/video-channelshttps://nicecrew.tv/a/omega_variant/video-channelshttps://nicecrew.tv/a/coffee/video-channelshttps://nicecrew.tv/a/radix_verum/video-channelshttps://nicecrew.tv/a/thymeandplace/video-channelshttps://nicecrew.tv/a/the_almighty_kek/video-channelshttps://nicecrew.tv/a/based_lord/video-channelshttps://nicecrew.tv/a/nips/video-channelshttps://nicecrew.tv/a/justjoeradio/video-channelshttps://nicecrew.tv/a/mark/video-channelshttps://nicecrew.tv/a/goalkeeper/video-channelshttps://nicecrew.tv/a/nightnationreview/video-channelshttps://nicecrew.tv/a/kracalactaka/video-channelshttps://nicecrew.tv/a/pastorshadilaykekistan/video-channelshttps://nicecrew.tv/a/d0c40r0/video-channelshttps://nicecrew.tv/a/szeklerland/video-channelshttps://nicecrew.tv/a/thymeandplac3/video-channelshttps://nicecrew.tv/a/fireandforget/video-channelshttps://nicecrew.tv/a/observer_noticer/video-channelshttps://nicecrew.tv/a/reichsgesetztv/video-channelshttps://nicecrew.tv/a/on_the_record/video-channelshttps://nicecrew.tv/a/cocktails/video-channelshttps://nicecrew.tv/a/exnihilo/video-channelshttps://nicecrew.tv/a/red_pilled_radio/video-channelshttps://nicecrew.tv/a/snidely_whiplash/video-channelshttps://nicecrew.tv/a/redonkulasregiment/video-channelshttps://nicecrew.tv/a/owl/video-channelshttps://nicecrew.tv/a/killyourtv/video-channelshttps://nicecrew.tv/a/caudill/video-channelshttps://nicecrew.tv/a/morbeus/video-channelshttps://nicecrew.tv/a/cosmonautkatyusha/video-channelshttps://nicecrew.tv/a/teknoskillz/video-channelshttps://nicecrew.tv/a/capt._fuggeta/video-channelshttps://nicecrew.tv/a/john_elway/video-channelshttps://nicecrew.tv/a/jolly_rancher/video-channelshttps://nicecrew.tv/a/poastaljen/video-channelshttps://nicecrew.tv/a/lolocaustianity/video-channelshttps://nicecrew.tv/a/cowanon/video-channelshttps://nicecrew.tv/a/kaptainkisty/video-channelshttps://nicecrew.tv/a/bluenippledwench/video-channelshttps://nicecrew.tv/a/decayable/video-channelshttps://nicecrew.tv/a/stardust-1/video-channelshttps://nicecrew.tv/a/formerly_trucks/video-channelshttps://nicecrew.tv/a/pixie-1/video-channelshttps://nicecrew.tv/a/clownprimarch/video-channelshttps://nicecrew.tv/a/awivr/video-channelshttps://nicecrew.tv/a/purple_deer77/video-channelshttps://nicecrew.tv/a/cobaltsasquatch/video-channelshttps://nicecrew.tv/a/blankdeblank-1/video-channelshttps://nicecrew.tv/a/flanker/video-channelshttps://nicecrew.tv/a/deepstatiklabs/video-channelshttps://nicecrew.tv/a/praxisofevil/video-channelshttps://nicecrew.tv/a/erwiflow/video-channelshttps://nicecrew.tv/a/nicecrew_bot/video-channelshttps://nicecrew.tv/a/nine2fivestudio/video-channelshttps://nicecrew.tv/a/zeke_kyle/video-channelshttps://nicecrew.tv/a/randbot/video-channels